Query         gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 101
No_of_seqs    120 out of 974
Neff          6.3 
Searched_HMMs 13730
Date          Wed Jun  1 09:58:15 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 255764504.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2c7pa1 c.66.1.26 (A:1-327) DN  99.3 2.1E-13 1.6E-17   94.7   0.6   55    1-55    152-208 (327)
  2 d1dcta_ c.66.1.26 (A:) DNA met  99.1 2.1E-11 1.5E-15   83.3   4.8   51    1-51    142-193 (324)
  3 d1g55a_ c.66.1.26 (A:) DNMT2 {  99.0   2E-10 1.5E-14   77.7   4.5   57    1-57    148-224 (343)
  4 d1uhra_ a.42.1.1 (A:) SWI/SNF   55.6       1 7.5E-05   22.5  -0.3   44   28-71      7-50  (93)
  5 d1v31a_ a.42.1.1 (A:) Hypothet  53.5     1.1 7.8E-05   22.4  -0.4   44   28-71      7-50  (93)
  6 d2j2za1 b.1.11.1 (A:1-124) Pil  16.1      34  0.0025   13.8   2.4   15    7-21     77-91  (124)
  7 d1hlva1 a.4.1.7 (A:1-66) DNA-b   8.3      34  0.0025   13.8  -0.2   16   51-66     35-50  (66)
  8 d2co7b1 b.1.11.1 (B:8-135) Per   7.6      67  0.0049   12.1   2.6   14    8-21     78-91  (128)
  9 d1p5va1 b.1.11.1 (A:7-147) Cha   6.2      79  0.0058   11.7   2.6   15    7-21     80-94  (141)
 10 d2akja1 d.58.36.1 (A:346-430)    5.4      88  0.0064   11.5   0.7   16    6-21      9-25  (85)

No 1  
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]}
Probab=99.28  E-value=2.1e-13  Score=94.65  Aligned_cols=55  Identities=33%  Similarity=0.680  Sum_probs=47.4

Q ss_pred             CCHHHCCCCCCCCEEEEEEEECCC--CCCCCCCCCCCCCCHHHHHCCCCCCCCCCCH
Q ss_conf             983435797376279999984788--8755888777777844531256774323468
Q gi|255764504|r    1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISN   55 (101)
Q Consensus         1 Lna~dfGvPQ~ReRvfiVg~~~~~--~~f~~P~~~~~~~~l~diL~~~vd~k~~ls~   55 (101)
                      |||+||||||+|+|+||||++++.  ..+.||++......++|+|++..+.++.+.+
T Consensus       152 l~a~~~GvPQ~R~R~fivg~r~~~~~~~~~~p~p~~~~~~i~d~l~~~~~~~~~~~~  208 (327)
T d2c7pa1         152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVID  208 (327)
T ss_dssp             EEGGGGTCSBCCEEEEEEEEBGGGCCCCCCCCCCCCCCCCGGGTCCCGGGTGGGEEC
T ss_pred             ECHHHCCCCCHHHHHEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCC
T ss_conf             238980898465443253123675533112222223454333311346412331134


No 2  
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]}
Probab=99.13  E-value=2.1e-11  Score=83.30  Aligned_cols=51  Identities=31%  Similarity=0.570  Sum_probs=41.6

Q ss_pred             CCHHHCCCCCCCCEEEEEEEECCC-CCCCCCCCCCCCCCHHHHHCCCCCCCC
Q ss_conf             983435797376279999984788-875588877777784453125677432
Q gi|255764504|r    1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKS   51 (101)
Q Consensus         1 Lna~dfGvPQ~ReRvfiVg~~~~~-~~f~~P~~~~~~~~l~diL~~~vd~k~   51 (101)
                      |||+||||||+|+|+||||++++. ..|.+|.+.....++.+.+.+..+...
T Consensus       142 lna~~~GvPQ~R~R~fiv~~r~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~  193 (324)
T d1dcta_         142 LNANDYGVAQDRKRVFYIGFRKELNINYLPPIPHLIKPTFKDVIWDLKDNPI  193 (324)
T ss_dssp             EEGGGGTCSBCCEEEEEEEEEGGGCCCCCCCCCCSSCCCGGGTTGGGTTCCE
T ss_pred             EECCCCCCCHHHCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCC
T ss_conf             2033356862331045752037877565556664666404444554146775


No 3  
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]}
Probab=98.97  E-value=2e-10  Score=77.72  Aligned_cols=57  Identities=25%  Similarity=0.415  Sum_probs=37.7

Q ss_pred             CCHHHCCCCCCCCEEEEEEEECCC-CCCCCCCCCC------------------CCCCHHHHHCCCCCC-CCCCCHHH
Q ss_conf             983435797376279999984788-8755888777------------------777844531256774-32346889
Q gi|255764504|r    1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG------------------IKPRLGDILEEHIDD-KSTISNKL   57 (101)
Q Consensus         1 Lna~dfGvPQ~ReRvfiVg~~~~~-~~f~~P~~~~------------------~~~~l~diL~~~vd~-k~~ls~~~   57 (101)
                      |||+||||||+|+|+||||++++. ..|.+|....                  ....+.++|++.++. ++.++.+.
T Consensus       148 lna~dyGvPQ~R~Rvfivg~r~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~  224 (343)
T d1g55a_         148 LSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPGQVLMEFPKIEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKS  224 (343)
T ss_dssp             ECGGGGTCSCCCCEEEEEEEESSSCCTTCCTTCEESSCCC------------CCCCCGGGGCCTTCCHHHHBCCHHH
T ss_pred             EECCCCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCHHHCCCCHHH
T ss_conf             30134687645203899998278666678863113467732001244445655554245430456641220367176


No 4  
>d1uhra_ a.42.1.1 (A:) SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) {Mouse (Mus musculus) [TaxId: 10090]}
Probab=55.55  E-value=1  Score=22.47  Aligned_cols=44  Identities=23%  Similarity=0.426  Sum_probs=35.3

Q ss_pred             CCCCCCCCCCCHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             58887777778445312567743234688998899787655532
Q gi|255764504|r   28 KFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIA   71 (101)
Q Consensus        28 ~~P~~~~~~~~l~diL~~~vd~k~~ls~~~~~~l~~~~~~~k~~   71 (101)
                      -||++......|.++|.......-.+...+|+|++.+...+...
T Consensus         7 g~p~~~~lS~~La~~lg~~~~sR~~v~k~iw~YIk~n~Lqdp~n   50 (93)
T d1uhra_           7 GQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHE   50 (93)
T ss_dssp             SSCCEEEECTTHHHHTCCSEEEHHHHHHHHHHHHHHTTCBCSSC
T ss_pred             CCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99787778999999878887689999999999999966778877


No 5  
>d1v31a_ a.42.1.1 (A:) Hypothetical protein AT5G14170 (rafl11-05-p19) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
Probab=53.50  E-value=1.1  Score=22.35  Aligned_cols=44  Identities=20%  Similarity=0.357  Sum_probs=34.8

Q ss_pred             CCCCCCCCCCCHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             58887777778445312567743234688998899787655532
Q gi|255764504|r   28 KFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIA   71 (101)
Q Consensus        28 ~~P~~~~~~~~l~diL~~~vd~k~~ls~~~~~~l~~~~~~~k~~   71 (101)
                      -||++......|.++|.......--++..+|+|++.....+...
T Consensus         7 G~~~~~~lS~~La~~lg~~~~sR~~v~k~iw~YIk~n~Lqd~~n   50 (93)
T d1v31a_           7 GVPEKFKLSTALMDVLGIEVETRPRIIAAIWHYVKARKLQNPND   50 (93)
T ss_dssp             SSCCCEECCHHHHHHSCCSEECSHHHHHHHHHHHHHTTCBCSSC
T ss_pred             CCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             98687358999999887686769999999999999847777878


No 6  
>d2j2za1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
Probab=16.07  E-value=34  Score=13.79  Aligned_cols=15  Identities=33%  Similarity=0.671  Sum_probs=11.4

Q ss_pred             CCCCCCCEEEEEEEE
Q ss_conf             797376279999984
Q gi|255764504|r    7 GVPQRRERLYIIDFL   21 (101)
Q Consensus         7 GvPQ~ReRvfiVg~~   21 (101)
                      ++||.||.+|-+.+.
T Consensus        77 ~lP~drEs~~~l~i~   91 (124)
T d2j2za1          77 KLPQDRESLFYFNLR   91 (124)
T ss_dssp             GSCSSSCEEEEEEEE
T ss_pred             CCCCCEEEEEEEEEE
T ss_conf             898760699999999


No 7  
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]}
Probab=8.26  E-value=34  Score=13.78  Aligned_cols=16  Identities=19%  Similarity=0.038  Sum_probs=5.8

Q ss_pred             CCCCHHHHHHHHHHHH
Q ss_conf             2346889988997876
Q gi|255764504|r   51 STISNKLWEGHQKRKE   66 (101)
Q Consensus        51 ~~ls~~~~~~l~~~~~   66 (101)
                      |=+.......+.+.+.
T Consensus        35 fGv~~STvs~IlKnK~   50 (66)
T d1hlva1          35 FNIPPSTLSTILKNKR   50 (66)
T ss_dssp             HTCCHHHHHHHHHTHH
T ss_pred             HCCCHHHHHHHHHHHH
T ss_conf             5997647999998799


No 8  
>d2co7b1 b.1.11.1 (B:8-135) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
Probab=7.58  E-value=67  Score=12.13  Aligned_cols=14  Identities=29%  Similarity=0.389  Sum_probs=7.0

Q ss_pred             CCCCCCEEEEEEEE
Q ss_conf             97376279999984
Q gi|255764504|r    8 VPQRRERLYIIDFL   21 (101)
Q Consensus         8 vPQ~ReRvfiVg~~   21 (101)
                      .|+.||.+|-+.+.
T Consensus        78 lp~drEs~f~l~i~   91 (128)
T d2co7b1          78 MPTDRETLQWVCIK   91 (128)
T ss_dssp             CCSSSCEEEEEEEE
T ss_pred             CCCCCEEEEEEEEE
T ss_conf             99781799999999


No 9  
>d1p5va1 b.1.11.1 (A:7-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
Probab=6.18  E-value=79  Score=11.71  Aligned_cols=15  Identities=20%  Similarity=0.211  Sum_probs=0.0

Q ss_pred             CCCCCCCEEEEEEEE
Q ss_conf             797376279999984
Q gi|255764504|r    7 GVPQRRERLYIIDFL   21 (101)
Q Consensus         7 GvPQ~ReRvfiVg~~   21 (101)
                      ..|+.||.+|-+.++
T Consensus        80 ~lP~DrEslf~l~i~   94 (141)
T d1p5va1          80 VFPRDKESLKWLCVK   94 (141)
T ss_dssp             CCCSSSCEEEEEEEE
T ss_pred             CCCCCCEEEEEEEEE
T ss_conf             899763699999999


No 10 
>d2akja1 d.58.36.1 (A:346-430) Ferredoxin--nitrite reductase, NIR {Spinach (Spinacia oleracea) [TaxId: 3562]}
Probab=5.43  E-value=88  Score=11.45  Aligned_cols=16  Identities=31%  Similarity=0.700  Sum_probs=0.0

Q ss_pred             CCC-CCCCCEEEEEEEE
Q ss_conf             579-7376279999984
Q gi|255764504|r    6 FGV-PQRRERLYIIDFL   21 (101)
Q Consensus         6 fGv-PQ~ReRvfiVg~~   21 (101)
                      ||| ||+..=.|+|+++
T Consensus         9 ~Gv~~Qk~~g~~~vri~   25 (85)
T d2akja1           9 LGVHPQKQQGLSFVGLH   25 (85)
T ss_dssp             BEEEECSSTTEEEEEEC
T ss_pred             EEEEECCCCCEEEEEEE
T ss_conf             68840377986999997


Done!