BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus str. psy62] (101 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus str. psy62] gi|254547855|gb|ACT56990.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 211 bits (537), Expect = 3e-53, Method: Compositional matrix adjust. Identities = 101/101 (100%), Positives = 101/101 (100%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG Sbjct: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI Sbjct: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 >gi|319407456|emb|CBI81106.1| Cytosine-specific methyltransferase NlaX [Bartonella sp. 1-1C] Length = 307 Score = 145 bits (366), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 68/101 (67%), Positives = 80/101 (79%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA DFGVPQ RER+YI+ FL+ S FKFP+P+ IK R+GDIL+ +D+K TISN LW G Sbjct: 147 LKARDFGVPQNRERIYIVGFLDHSTNFKFPSPMNIKTRVGDILDNDVDEKYTISNTLWHG 206 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK NK+ GKGFGYGLF S TNTLSARYYKDGSEI Sbjct: 207 HQRRKAQNKLNGKGFGYGLFNMESPYTNTLSARYYKDGSEI 247 >gi|313667524|ref|YP_004047808.1| cytosine-specific methyltransferase [Neisseria lactamica ST-640] gi|309378245|emb|CBX23130.1| DNA cytosine methyltransferase M.NlaX [Neisseria lactamica Y92-1009] gi|313004986|emb|CBN86414.1| cytosine-specific methyltransferase [Neisseria lactamica 020-06] Length = 313 Score = 144 bits (363), Expect = 4e-33, Method: Composition-based stats. Identities = 65/101 (64%), Positives = 81/101 (80%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA DFG+PQ RER+Y++ FLN V+F+FP P+G +GDILE + D+K TIS+KLW+G Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK N+ AGKGFGYGLF SA TNT+SARYYKDGSEI Sbjct: 205 HQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245 >gi|127471|sp|P24581|MTNX_NEILA RecName: Full=Cytosine-specific methyltransferase NlaX; Short=M.NlaX gi|45004|emb|CAA38357.1| cytosine-specific methyltransferase of NlaIII [Neisseria lactamica] Length = 313 Score = 142 bits (357), Expect = 2e-32, Method: Composition-based stats. Identities = 64/101 (63%), Positives = 81/101 (80%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA DFG+PQ RER+Y++ FLN V+F+FP P+G +GDILE + D+K TIS+KLW+G Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +Q+RK N+ AGKGFGYGLF SA TNT+SARYYKDGSEI Sbjct: 205 YQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245 >gi|261400948|ref|ZP_05987073.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970] gi|269209191|gb|EEZ75646.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970] Length = 313 Score = 142 bits (357), Expect = 2e-32, Method: Composition-based stats. Identities = 64/101 (63%), Positives = 81/101 (80%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA DFG+PQ RER+Y++ FLN V+F+FP P+G +GDILE + D+K TIS+KLW+G Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +Q+RK N+ AGKGFGYGLF SA TNT+SARYYKDGSEI Sbjct: 205 YQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245 >gi|315637499|ref|ZP_07892709.1| modification methylase EcoRII [Arcobacter butzleri JV22] gi|315478217|gb|EFU68940.1| modification methylase EcoRII [Arcobacter butzleri JV22] Length = 326 Score = 139 bits (350), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 65/101 (64%), Positives = 81/101 (80%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFGVPQ RER+YII FL+ S++FK+P PL K RLGDIL++++DDK TIS+KLW G Sbjct: 163 LNAKDFGVPQNRERIYIIAFLDHSIDFKYPKPLNKKNRLGDILDDNVDDKYTISDKLWAG 222 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK+ +K G GFGY LF NS T+T+SARYYKDGSEI Sbjct: 223 HQRRKKEHKEKGNGFGYSLFTHNSEYTSTISARYYKDGSEI 263 >gi|150026187|ref|YP_001297013.1| type II modification methyltransferase [Flavobacterium psychrophilum JIP02/86] gi|149772728|emb|CAL44211.1| Probable type II modification methyltransferase [Flavobacterium psychrophilum JIP02/86] Length = 335 Score = 138 bits (348), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 63/101 (62%), Positives = 83/101 (82%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA +FG+PQ RER+YI+ FL+ S++FKFPTP + ++GDILE+ +D+K TIS++LWEG Sbjct: 152 LKAKEFGLPQNRERIYIVGFLDNSIKFKFPTPTKLPTKVGDILEQKVDEKYTISDRLWEG 211 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK NK GKGFG+G+ ENS TNT+SARYYKDGSEI Sbjct: 212 HQRRKIANKEKGKGFGFGIVNENSEYTNTISARYYKDGSEI 252 >gi|119026301|ref|YP_910146.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC 15703] gi|118765885|dbj|BAF40064.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC 15703] Length = 383 Score = 133 bits (334), Expect = 9e-30, Method: Compositional matrix adjust. Identities = 66/105 (62%), Positives = 79/105 (75%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A DFGVPQ RER+YI+ F V +FK+P P I RLGDILE+++DDK TIS+ Sbjct: 214 LAAKDFGVPQNRERIYIVGFDKEQVPNWADFKYPEPPCIPTRLGDILEKNVDDKYTISDA 273 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW GHQ+RK+ NK AGKGFGYGLF E+S NT+SARYYKDGSEI Sbjct: 274 LWAGHQRRKQENKKAGKGFGYGLFDEDSPYANTISARYYKDGSEI 318 >gi|1657420|gb|AAC45971.1| DNA cytosine methyltransferase M.SenPI [Salmonella enterica subsp. enterica serovar Enteritidis] Length = 379 Score = 131 bits (330), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 A DFGVPQ RER+YI+ F V F FPTPL K R+GDILE+ +D+K T+S+ LW Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GHQ+RK N AGKGFGYGLF ENS TNT+SARYYKDGSEI Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317 >gi|32470131|ref|NP_863573.1| DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae] gi|462656|sp|P34879|MTS2_SHISO RecName: Full=Modification methylase SsoII; Short=M.SsoII; AltName: Full=Cytosine-specific methyltransferase SsoII gi|11559818|gb|AAG38101.1|AF300473_2 DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae] gi|294244|gb|AAA98279.1| C5-cytosine methylase [Plasmid P4] Length = 379 Score = 131 bits (330), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 A DFGVPQ RER+YI+ F V F FPTPL K R+GDILE+ +D+K T+S+ LW Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GHQ+RK N AGKGFGYGLF ENS TNT+SARYYKDGSEI Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317 >gi|1871451|dbj|BAA11167.1| C5-cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi] gi|3421011|emb|CAA76526.1| M.Ecl18kI (DNA-methyltransferase) [Enterobacter cloacae] Length = 379 Score = 131 bits (330), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 A DFGVPQ RER+YI+ F V F FPTPL K R+GDILE+ +D+K T+S+ LW Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GHQ+RK N AGKGFGYGLF ENS TNT+SARYYKDGSEI Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317 >gi|323968851|gb|EGB64187.1| DNA-cytosine methyltransferase [Escherichia coli TA007] Length = 282 Score = 131 bits (330), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 A DFGVPQ RER+YI+ F V F FPTPL K R+GDILE+ +D+K T+S+ LW Sbjct: 118 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 177 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GHQ+RK N AGKGFGYGLF ENS TNT+SARYYKDGSEI Sbjct: 178 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 220 >gi|157737722|ref|YP_001490405.1| DNA (cytosine-5-)-methyltransferase [Arcobacter butzleri RM4018] gi|157699576|gb|ABV67736.1| DNA (Cytosine-5-)-methyltransferase [Arcobacter butzleri RM4018] Length = 326 Score = 131 bits (329), Expect = 4e-29, Method: Compositional matrix adjust. Identities = 62/101 (61%), Positives = 78/101 (77%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +FGVPQ RER+YII FL+ S++FK+P L K RLGDIL+ ++DDK TIS+KLW G Sbjct: 163 LNARNFGVPQNRERIYIIAFLDHSIDFKYPKSLNKKNRLGDILDNNVDDKYTISDKLWAG 222 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK+ +K G GFGY LF S T+T+SARYYKDGSEI Sbjct: 223 HQRRKKEHKEKGNGFGYSLFTHESEYTSTISARYYKDGSEI 263 >gi|462657|sp|P34877|MTSA_LACLC RecName: Full=Modification methylase ScrFIA; Short=M.ScrFI-A; Short=M.ScrFIA; AltName: Full=Cytosine-specific methyltransferase ScrFIA gi|149493|gb|AAA25220.1| SCRFI methylase [Lactococcus lactis] gi|2327034|gb|AAB66696.1| 5-methyl-cytosine methyltransferase [Lactococcus lactis subsp. cremoris] Length = 389 Score = 130 bits (327), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 65/104 (62%), Positives = 79/104 (75%), Gaps = 4/104 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 KA DFG+PQ RER+YI+ F S+ +F+ PTPL K R+G+ILE +DDK TIS+KL Sbjct: 221 KARDFGLPQNRERIYIVGFDRKSISNYSDFQMPTPLQEKTRVGNILESVVDDKYTISDKL 280 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 W+GHQ+RK NK GKGFGY LF ++S TNTLSARYYKDGSEI Sbjct: 281 WDGHQRRKTENKKNGKGFGYTLFNQDSEYTNTLSARYYKDGSEI 324 >gi|78777762|ref|YP_394077.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM 1251] gi|78498302|gb|ABB44842.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM 1251] Length = 328 Score = 129 bits (325), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 60/101 (59%), Positives = 78/101 (77%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A D+GVPQ RER+YI+ FL+ VEF+FP P+ ++GDILE+ +D+K TIS+KLW G Sbjct: 163 LNAKDYGVPQNRERIYIVGFLDNEVEFEFPKPIEKYVKVGDILEDKVDEKYTISDKLWAG 222 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK +K G GFGY +F ENS T+T+SARYYKDGSEI Sbjct: 223 HQRRKIEHKAKGNGFGYSMFNENSIYTSTISARYYKDGSEI 263 >gi|50914506|ref|YP_060478.1| Type II restriction-modification system methylation subunit [Streptococcus pyogenes MGAS10394] gi|40218542|gb|AAR83196.1| type II modification methylase [Streptococcus pyogenes] gi|50261587|gb|AAT72355.1| methylase [Streptococcus pyogenes] gi|50903580|gb|AAT87295.1| Type II restriction-modification system methylation subunit [Streptococcus pyogenes MGAS10394] gi|114386439|gb|ABI74454.1| DNA methyltransferase [Streptococcus pyogenes] Length = 408 Score = 126 bits (317), Expect = 8e-28, Method: Compositional matrix adjust. Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 KA DFGVPQ RER+YI+ F +N EF+FP P ++ +LG+IL+ +D+K TIS+K Sbjct: 242 FKARDFGVPQNRERIYIVGFDKTCVNNFSEFRFPEPFHLETKLGNILQTDVDEKYTISDK 301 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LWEGHQ+RK +K G GFGY LF +S TNTLSARYYKDGSEI Sbjct: 302 LWEGHQRRKAEHKTKGNGFGYSLFNADSPYTNTLSARYYKDGSEI 346 >gi|152998369|ref|YP_001343204.1| DNA-cytosine methyltransferase [Marinomonas sp. MWYL1] gi|150839293|gb|ABR73269.1| DNA-cytosine methyltransferase [Marinomonas sp. MWYL1] Length = 417 Score = 123 bits (309), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 57/102 (55%), Positives = 79/102 (77%), Gaps = 1/102 (0%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 +K+ DFGVPQ R+R+YI+ + + ++ F +P +G+ R+GDILE + + K TIS++LWE Sbjct: 255 LKSVDFGVPQNRQRIYIVLWKDGEIDKFDYPESMGLDTRVGDILEANPNPKLTISDRLWE 314 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GHQ+RK NKI GKGFGYG+ E+S TNT+SARYYKDGSE+ Sbjct: 315 GHQRRKMQNKINGKGFGYGIVTEDSPYTNTISARYYKDGSEV 356 >gi|224418923|ref|ZP_03656929.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT 98-5491] gi|253827874|ref|ZP_04870759.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT 98-5491] gi|313142438|ref|ZP_07804631.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT 98-5491] gi|253511280|gb|EES89939.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT 98-5491] gi|313131469|gb|EFR49086.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT 98-5491] Length = 328 Score = 121 bits (304), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 60/101 (59%), Positives = 73/101 (72%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A D+GVPQ RER+ I+ F + +V F FP P +LGDILE+ D+K TISN+LWE Sbjct: 164 LNARDYGVPQNRERIIIVGFKDHNVHFDFPKPYNYSVKLGDILEKTPDEKYTISNRLWES 223 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RKE K G GFGY LF ENS T+T+SARYYKDGSEI Sbjct: 224 HQQRKELQKAKGNGFGYRLFDENSPYTSTISARYYKDGSEI 264 >gi|283471715|emb|CAQ50926.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Staphylococcus aureus subsp. aureus ST398] Length = 397 Score = 120 bits (301), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 ++A DFG PQ RER+YI+ F ++ F FP PL I+ LG ILE +++DK TIS++ Sbjct: 227 LRARDFGCPQNRERIYIVGFDKQQIKNAENFSFPEPLPIETSLGSILESNVNDKYTISDR 286 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW GHQ+RK +K G GFGY +F E S TNTLSARYYKDGSEI Sbjct: 287 LWYGHQRRKREHKAKGNGFGYSIFNETSPYTNTLSARYYKDGSEI 331 >gi|325989685|ref|YP_004249384.1| cytosine-specific methyltransferase [Mycoplasma suis KI3806] gi|323574770|emb|CBZ40430.1| Cytosine-specific methyltransferase [Mycoplasma suis] Length = 326 Score = 120 bits (300), Expect = 9e-26, Method: Compositional matrix adjust. Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 +K+ DFG+PQ RER+YI+ F VE F P+P +GDILE+ +++K TIS+ Sbjct: 160 LKSRDFGIPQNRERIYIVGFNKDLVESYENFSMPSPTLKATCVGDILEKEVNNKYTISDL 219 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LWEGH++RKE +K+ G+GFG+ LF ENS+ TNT+SARYYKDGSEI Sbjct: 220 LWEGHKRRKEEHKLKGRGFGFSLFSENSSYTNTISARYYKDGSEI 264 >gi|321310755|ref|YP_004193084.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str. Langford 1] gi|319802599|emb|CBY93245.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str. Langford 1] Length = 362 Score = 119 bits (299), Expect = 9e-26, Method: Compositional matrix adjust. Identities = 62/105 (59%), Positives = 72/105 (68%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 ++A DFGVPQ RER+YI+ F +V+ FKFP LGDILE +DDK TISN Sbjct: 196 LRARDFGVPQNRERIYIVGFDKDAVQGYRNFKFPEATHKNTCLGDILESEVDDKYTISNT 255 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LWEGH++RK NK GKGFGY LF S NTLSARYYKDGSE+ Sbjct: 256 LWEGHKRRKVENKKKGKGFGYSLFNFESPYANTLSARYYKDGSEV 300 >gi|325973250|ref|YP_004250314.1| cytosine-specific DNA modification methylase, HpaII-like protein [Mycoplasma suis str. Illinois] gi|323651852|gb|ADX97934.1| cytosine-specific DNA modification methylase, HpaII-like protein [Mycoplasma suis str. Illinois] Length = 326 Score = 119 bits (299), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 +K+ DFG+PQ RER+YI+ F VE F P+P +GDILE+ +++K TIS+ Sbjct: 160 LKSRDFGIPQNRERIYIVGFNKDLVESYENFSMPSPTLKATCVGDILEKEVNNKYTISDL 219 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LWEGH++RKE +K+ G+GFG+ LF ENS+ TNT+SARYYKDGSEI Sbjct: 220 LWEGHKRRKEEHKLKGRGFGFSLFSENSSYTNTISARYYKDGSEI 264 >gi|299536257|ref|ZP_07049570.1| DNA-methyltransferase MKpn2kI [Lysinibacillus fusiformis ZC1] gi|298728243|gb|EFI68805.1| DNA-methyltransferase MKpn2kI [Lysinibacillus fusiformis ZC1] Length = 403 Score = 119 bits (297), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLN----PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 ++A DFGVPQ RER++++ F V FKFP PL LGDIL + +D+K TIS+K Sbjct: 212 LRAADFGVPQNRERVFMVGFNKRIGGELVPFKFPKPLSTPTNLGDILFKKVDEKYTISDK 271 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 L+EGH +RKE +K G GFG+ LF ENS+ TNTLSARYYKDGSEI Sbjct: 272 LYEGHLRRKEMHKQKGNGFGFSLFDENSSYTNTLSARYYKDGSEI 316 >gi|315931535|gb|EFV10502.1| DNA (cytosine-5) methyltransferase [Campylobacter jejuni subsp. jejuni 327] Length = 284 Score = 115 bits (289), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 59/106 (55%), Positives = 75/106 (70%), Gaps = 5/106 (4%) Query: 1 MKACDFGVPQRRERLYIIDFL-----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + A +FG+PQ RER+YI+ FL N S F + IK +LGDILE+++D+K TIS+ Sbjct: 151 LNARNFGIPQNRERIYIVAFLKNKFKNISFNFNELKNIEIKSKLGDILEKNVDEKYTISD 210 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 KLW GHQ+RK +K G GFGY LF NS T+T+SARYYKDGSEI Sbjct: 211 KLWAGHQRRKLEHKKKGNGFGYSLFNHNSDYTSTISARYYKDGSEI 256 >gi|157414453|ref|YP_001481709.1| hypothetical protein C8J_0133 [Campylobacter jejuni subsp. jejuni 81116] gi|283955585|ref|ZP_06373079.1| hypothetical protein C1336_000030018 [Campylobacter jejuni subsp. jejuni 1336] gi|157385417|gb|ABV51732.1| hypothetical protein C8J_0133 [Campylobacter jejuni subsp. jejuni 81116] gi|283792928|gb|EFC31703.1| hypothetical protein C1336_000030018 [Campylobacter jejuni subsp. jejuni 1336] Length = 321 Score = 115 bits (288), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 59/106 (55%), Positives = 75/106 (70%), Gaps = 5/106 (4%) Query: 1 MKACDFGVPQRRERLYIIDFL-----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + A +FG+PQ RER+YI+ FL N S F + IK +LGDILE+++D+K TIS+ Sbjct: 151 LNARNFGIPQNRERIYIVAFLKNKFKNISFNFNELKNIEIKSKLGDILEKNVDEKYTISD 210 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 KLW GHQ+RK +K G GFGY LF NS T+T+SARYYKDGSEI Sbjct: 211 KLWAGHQRRKLEHKKKGNGFGYSLFNHNSDYTSTISARYYKDGSEI 256 >gi|255066464|ref|ZP_05318319.1| modification methylase EcoRII [Neisseria sicca ATCC 29256] gi|298369378|ref|ZP_06980696.1| modification methylase EcoRII [Neisseria sp. oral taxon 014 str. F0314] gi|255049344|gb|EET44808.1| modification methylase EcoRII [Neisseria sicca ATCC 29256] gi|298283381|gb|EFI24868.1| modification methylase EcoRII [Neisseria sp. oral taxon 014 str. F0314] Length = 357 Score = 114 bits (285), Expect = 4e-24, Method: Compositional matrix adjust. Identities = 57/103 (55%), Positives = 72/103 (69%), Gaps = 2/103 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 M A DF +PQ RER+YI+ F + + +F+FP PL ++GDILE D K TIS++LW Sbjct: 190 MAAKDFNLPQNRERIYIVGFRSAKDAAQFEFPHPLPKTVKVGDILESFPDAKYTISDRLW 249 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +GH +RK +K G GFGYGLF S TNT+SARYYKDGSEI Sbjct: 250 QGHLRRKAEHKQKGNGFGYGLFNAQSEYTNTISARYYKDGSEI 292 >gi|170729237|ref|YP_001763263.1| DNA-cytosine methyltransferase [Shewanella woodyi ATCC 51908] gi|169814584|gb|ACA89168.1| DNA-cytosine methyltransferase [Shewanella woodyi ATCC 51908] Length = 416 Score = 114 bits (285), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 57/102 (55%), Positives = 73/102 (71%), Gaps = 1/102 (0%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 M++ DFGVPQ R+R+YII + + +E F++P P G ++ DILE +K TIS+KLW Sbjct: 255 MRSVDFGVPQNRQRIYIILWKDGLIEQFQYPKPSGKDTKVADILESEPCEKLTISDKLWA 314 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GH++RK NK GKGFGYGL S TNT+SARYYKDGSEI Sbjct: 315 GHKRRKIENKAKGKGFGYGLVSPESEYTNTISARYYKDGSEI 356 >gi|256760956|ref|ZP_05501536.1| type II restriction-modification system methylation subunit [Enterococcus faecalis T3] gi|256682207|gb|EEU21902.1| type II restriction-modification system methylation subunit [Enterococcus faecalis T3] Length = 405 Score = 112 bits (279), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 58/104 (55%), Positives = 74/104 (71%), Gaps = 4/104 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 KA DFG PQ RER+YI+ F S++ F+FPT K +GDILE+ +D+K TIS+ L Sbjct: 237 KARDFGAPQNRERIYIVGFDKLSLKNIDLFEFPTAPKPKTCVGDILEDSVDEKYTISDTL 296 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 WEGH++RK +K G GFG+ LF +S TNT+SARYYKDGSEI Sbjct: 297 WEGHKRRKLEHKEKGNGFGFSLFNSSSPYTNTISARYYKDGSEI 340 >gi|1709152|sp|P50185|MTD5_DACSA RecName: Full=Modification methylase DsaV; Short=M.DsaV; AltName: Full=Cytosine-specific methyltransferase DsaV gi|505694|gb|AAA86046.1| DsaV methyltransferase [Dactylococcopsis salina] Length = 351 Score = 111 bits (277), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 49/104 (47%), Positives = 76/104 (73%), Gaps = 3/104 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A DF +PQ+RER++I+ F N ++ F FP P+ + ++GD+LE+ +D+K TI++++ Sbjct: 146 ISATDFNLPQKRERIFIVGFQDKNNKNLIFDFPKPIELTAKVGDLLEKEVDEKYTITDRM 205 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 WEGHQ RK+ ++ G GFG+ L NS+ T T+SARYYKDGSE+ Sbjct: 206 WEGHQNRKKAHRKRGNGFGFSLVNRNSSYTRTISARYYKDGSEV 249 >gi|262402975|ref|ZP_06079535.1| DNA-methyltransferase MKpn2kI [Vibrio sp. RC586] gi|262350474|gb|EEY99607.1| DNA-methyltransferase MKpn2kI [Vibrio sp. RC586] Length = 410 Score = 108 bits (270), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 17/118 (14%) Query: 1 MKACDFGVPQRRERLYIIDF-------LNPSVEFKFPTPLGIKPRLGDILE-EHI----- 47 ++A DFGVPQ RER++I+ F +N F +P R+GDILE +H+ Sbjct: 216 LRAADFGVPQNRERIFIVGFDKNYFRGVNFDSLFSWPEAPKTPTRVGDILEPQHVLDEEK 275 Query: 48 ----DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 D+ TIS+KLW+GH+KRKE +KI G GFGY LF +S TNT+SARYYKDGSEI Sbjct: 276 QALGKDRYTISDKLWDGHKKRKEEHKIKGNGFGYSLFNADSEYTNTISARYYKDGSEI 333 >gi|319893523|ref|YP_004150398.1| DNA-cytosine methyltransferase [Staphylococcus pseudintermedius HKU10-03] gi|317163219|gb|ADV06762.1| DNA-cytosine methyltransferase [Staphylococcus pseudintermedius HKU10-03] Length = 394 Score = 107 bits (268), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 55/105 (52%), Positives = 73/105 (69%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 +KA DFGVPQ RER+YI+ F + ++ P P + LG ILE+++D+K TIS+K Sbjct: 227 LKAKDFGVPQNRERIYIVGFDKRRIKKWRDYIPPKPPKSQTLLGKILEKNVDEKYTISDK 286 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW GH++RK +K+ G GFG+ L+ S TNTLSARYYKDGSEI Sbjct: 287 LWSGHKRRKAEHKLKGNGFGFTLYNGESPYTNTLSARYYKDGSEI 331 >gi|260554958|ref|ZP_05827179.1| DNA-methyltransferase MKpn2kI [Acinetobacter baumannii ATCC 19606] gi|260411500|gb|EEX04797.1| DNA-methyltransferase MKpn2kI [Acinetobacter baumannii ATCC 19606] Length = 413 Score = 107 bits (267), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 57/114 (50%), Positives = 74/114 (64%), Gaps = 13/114 (11%) Query: 1 MKACDFGVPQRRERLYIIDF--------LNPSVEFKFPTPLGIKPRLGDILEE-----HI 47 ++A DFGVPQ RER++++ F N F +P P + RLGDILE+ Sbjct: 222 LRAADFGVPQNRERIFLVGFDKNYFGEECNFDQLFSWPVPPKKQTRLGDILEDVSKLKKS 281 Query: 48 DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +D TIS++LW+GHQ+RKE + I G GFGY L+ +S TNTLSARYYKDGSEI Sbjct: 282 EDVYTISDRLWQGHQRRKEEHGIKGNGFGYTLYTGDSPYTNTLSARYYKDGSEI 335 >gi|124024750|ref|YP_001013866.1| site-specific DNA methylase [Prochlorococcus marinus str. NATL1A] gi|123959818|gb|ABM74601.1| Site-specific DNA methylase [Prochlorococcus marinus str. NATL1A] Length = 305 Score = 106 bits (265), Expect = 9e-22, Method: Compositional matrix adjust. Identities = 50/101 (49%), Positives = 76/101 (75%), Gaps = 1/101 (0%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFGVPQ RER++I +++ + F+FP P ++ ++GDIL++++ DK T+S+K+W Sbjct: 146 LNAKDFGVPQNRERIFIFGYID-FIFFEFPEPSKVQTKVGDILDDNVPDKFTLSDKMWTN 204 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +RKENN+ G GFG+ LF ++S T+T+SARYYKDGSEI Sbjct: 205 AIRRKENNRKRGYGFGFSLFDKDSEYTSTISARYYKDGSEI 245 >gi|229530048|ref|ZP_04419438.1| type II restriction-modification system methylation subunit [Vibrio cholerae 12129(1)] gi|229333822|gb|EEN99308.1| type II restriction-modification system methylation subunit [Vibrio cholerae 12129(1)] Length = 270 Score = 104 bits (259), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 58/118 (49%), Positives = 73/118 (61%), Gaps = 17/118 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEF----KFPTPLGIKPRLGDILEE-------- 45 ++A DFG PQ RER++II F P+++F +P R+GDIL+ Sbjct: 76 LRAADFGSPQNRERIFIIGFNKDEFPNIDFDKLFSWPKAPKTPTRVGDILQTQQELELDK 135 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 H D+ TIS+KLWEGHQKRK +K G GFGY LF +S TNT+SARYYKDGSEI Sbjct: 136 KLHGKDRFTISDKLWEGHQKRKAEHKTKGNGFGYSLFNADSEYTNTISARYYKDGSEI 193 >gi|323495143|ref|ZP_08100228.1| DNA-methyltransferase MKpn2kI [Vibrio brasiliensis LMG 20546] gi|323310583|gb|EGA63762.1| DNA-methyltransferase MKpn2kI [Vibrio brasiliensis LMG 20546] Length = 443 Score = 102 bits (254), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 56/118 (47%), Positives = 72/118 (61%), Gaps = 17/118 (14%) Query: 1 MKACDFGVPQRRERLYIIDF-------LNPSVEFKFPTPLGIKPRLGDILEEHID----- 48 ++A DFGVPQ RER++II F ++ F +P P ++GDIL+ + Sbjct: 248 LRAADFGVPQNRERIFIIGFDKDYYTGVDFDQVFNWPEPPKTPTKVGDILQSDQELEAEA 307 Query: 49 -----DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 D TIS++LWEGHQKRKE +K G GFGY L+ S TNT+SARYYKDGSEI Sbjct: 308 KVIGKDCYTISDRLWEGHQKRKEGHKTKGNGFGYTLYNAESEYTNTISARYYKDGSEI 365 >gi|294788070|ref|ZP_06753314.1| modification methylase EcoRII [Simonsiella muelleri ATCC 29453] gi|294484363|gb|EFG32046.1| modification methylase EcoRII [Simonsiella muelleri ATCC 29453] Length = 355 Score = 101 bits (252), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 5/106 (4%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKP--RLGDILEEHIDDKSTISN 55 + A +FGVPQ RER+YI+ NP+ F K ++GDIL+ +D+K TIS+ Sbjct: 184 LNAKNFGVPQNRERIYIVAIRNDFNPTFNLDFDKLKNTKVNCQVGDILQNQVDEKYTISD 243 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 KLW GHQ+RK + G GFGY LF S T+T+SARYYKDGSEI Sbjct: 244 KLWAGHQRRKAEHIEKGNGFGYSLFNAQSPYTSTISARYYKDGSEI 289 >gi|66391578|ref|YP_239103.1| hypothetical protein RB43ORF127c [Enterobacteria phage RB43] gi|62288666|gb|AAX78649.1| hypothetical protein RB43ORF127c [Enterobacteria phage RB43] Length = 302 Score = 98.6 bits (244), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 49/96 (51%), Positives = 67/96 (69%), Gaps = 2/96 (2%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKR 64 DFG+PQRRER++I+ FL+ V F FP P R+GDILE+ +DD T+S+ W+G ++R Sbjct: 148 DFGLPQRRERVFIVCFLD-DVFFSFPVPPRTPTRVGDILED-VDDSYTLSDNAWKGFRER 205 Query: 65 KENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 KE NK GKGFGY +S T T++A+YYKDG + Sbjct: 206 KERNKANGKGFGYQAVTADSTHTGTITAQYYKDGVQ 241 >gi|294661528|ref|YP_003579981.1| hypothetical protein KP-KP15_gp115 [Klebsiella phage KP15] gi|292660689|gb|ADE34937.1| hypothetical protein [Klebsiella phage KP15] Length = 308 Score = 97.4 bits (241), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 50/100 (50%), Positives = 68/100 (68%), Gaps = 2/100 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 M DFG+PQRRER++I+ F +P V F FP P R+GDILE +D+ TIS++ W+G Sbjct: 144 MNTKDFGLPQRRERVFIVCFRDP-VFFSFPVPPRTPTRVGDILEPD-NDQYTISDRAWKG 201 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 ++RKE NK GKGFGY +S T T++A+YYKDG + Sbjct: 202 FRERKELNKANGKGFGYQAVTVDSVCTGTITAQYYKDGVQ 241 >gi|237725529|ref|ZP_04556010.1| DNA (cytosine-5-)-methyltransferase [Bacteroides sp. D4] gi|229436216|gb|EEO46293.1| DNA (cytosine-5-)-methyltransferase [Bacteroides dorei 5_1_36/D4] Length = 374 Score = 97.1 bits (240), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 22/123 (17%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLG-----------------IKPRLG 40 + A FGVPQ RERL+I+ + V+ FKFP + IK ++ Sbjct: 166 LNAKYFGVPQNRERLFIVAWYKDIVKATTFKFPYGIAPDGSTIYEKSKDLGDKVIKTKVS 225 Query: 41 DILE--EHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98 DI E + ID TIS++LW GHQ+RK+ NK GKGFGY LF ENS ++T+SARY+KDG Sbjct: 226 DIFEPEDSIDSYYTISDRLWIGHQERKKRNKANGKGFGYSLFNENSVYSSTISARYWKDG 285 Query: 99 SEI 101 SEI Sbjct: 286 SEI 288 >gi|304373674|ref|YP_003858419.1| putative DNA-methyltransferase, type II restriction-modification system [Enterobacteria phage RB16] gi|299829630|gb|ADJ55423.1| putative DNA-methyltransferase, type II restriction-modification system [Enterobacteria phage RB16] Length = 302 Score = 97.1 bits (240), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 49/96 (51%), Positives = 66/96 (68%), Gaps = 2/96 (2%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKR 64 DFG+PQRRER++I+ FL+ V F FP P R+GDILE+ DD T+S+ W+G ++R Sbjct: 148 DFGLPQRRERVFIVCFLD-DVFFSFPVPPRTPTRVGDILEDA-DDSYTLSDNAWKGFRER 205 Query: 65 KENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 KE NK GKGFGY +S T T++A+YYKDG + Sbjct: 206 KERNKANGKGFGYQAVTADSTHTGTITAQYYKDGVQ 241 >gi|317497297|ref|ZP_07955620.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium 5_1_63FAA] gi|316895366|gb|EFV17525.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium 5_1_63FAA] Length = 385 Score = 95.1 bits (235), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 51/106 (48%), Positives = 71/106 (66%), Gaps = 6/106 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-----EFKFPT-PLGIKPRLGDILEEHIDDKSTIS 54 + A FG+PQ RER+ I+ F + +FK+P + K +GDILE+ + ++ TIS Sbjct: 213 LNAYHFGIPQNRERIIIVGFNKDYLPKKFKDFKYPVGKIDKKVCVGDILEKEVGERFTIS 272 Query: 55 NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 +KLWEGHQ RK +K G GFG+ LF ++S T+T+SARYYKDGSE Sbjct: 273 DKLWEGHQARKRMHKKKGNGFGFCLFNKDSKYTSTISARYYKDGSE 318 >gi|308126237|ref|ZP_05908633.2| DNA (cytosine-5-)-methyltransferase [Vibrio parahaemolyticus AQ4037] gi|308107574|gb|EFO45114.1| DNA (cytosine-5-)-methyltransferase [Vibrio parahaemolyticus AQ4037] Length = 426 Score = 95.1 bits (235), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 8/108 (7%) Query: 1 MKACDFGVPQRRERLYIIDF-------LNPSVEFKFPTPLGIKPRLGDILE-EHIDDKST 52 ++A DFG PQ RER+Y++ F L+ + F+FP P ++GDILE D T Sbjct: 248 LRAADFGAPQNRERIYLVGFDKDYFGDLDFNSIFQFPEPTMKPTKVGDILETSDYVDSFT 307 Query: 53 ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 IS+K+W HQKRK +K G GFG+ L + TNT+SARYYKDGSE Sbjct: 308 ISDKIWASHQKRKAGHKNKGNGFGFTLVNSETKYTNTISARYYKDGSE 355 >gi|17863973|gb|AAL46998.1|AF448250_2 putative C-5 cytosine-specific DNA methylase [Bacteroides coprosuis DSM 18011] Length = 401 Score = 94.4 bits (233), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 53/110 (48%), Positives = 67/110 (60%), Gaps = 10/110 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--------FKFPTPLGIKPRLGDILEE--HIDDK 50 + A DFG PQ RER+YI+ F F+FP P K + D+LE+ D Sbjct: 237 LNAKDFGSPQNRERIYIVGFNKNHFTKIDDFNEIFQFPEPSKEKVSVKDVLEKIPANDTI 296 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 TIS ++W+GHQKRK ++ G GFG+ LF ENS TNT+SARYYKDGSE Sbjct: 297 YTISERIWQGHQKRKLKHQNKGNGFGFSLFNENSEYTNTISARYYKDGSE 346 >gi|260909972|ref|ZP_05916659.1| modification methylase EcoRII [Prevotella sp. oral taxon 472 str. F0295] gi|260635922|gb|EEX53925.1| modification methylase EcoRII [Prevotella sp. oral taxon 472 str. F0295] Length = 370 Score = 90.9 bits (224), Expect = 5e-17, Method: Compositional matrix adjust. Identities = 53/121 (43%), Positives = 73/121 (60%), Gaps = 20/121 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIK----------------PRLGD 41 + A FGVPQ RERL+II + V+ FKFP + I ++ + Sbjct: 166 LNAKYFGVPQNRERLFIIAWNRELVDVDCFKFPYGIAIDGTSIYEKRKLKGRTIPTKVSE 225 Query: 42 ILE-EHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 I E +++ TI++++WEGH+ RKE NK+ GKGFGY LF NS T+T+SARY+KDGSE Sbjct: 226 IFEPDNVTTPFTITDRMWEGHKTRKERNKMNGKGFGYSLFNANSEYTSTISARYWKDGSE 285 Query: 101 I 101 I Sbjct: 286 I 286 >gi|228469904|ref|ZP_04054843.1| cytosine-specific methyltransferase NlaX [Porphyromonas uenonis 60-3] gi|228308539|gb|EEK17327.1| cytosine-specific methyltransferase NlaX [Porphyromonas uenonis 60-3] Length = 395 Score = 85.9 bits (211), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 52/122 (42%), Positives = 72/122 (59%), Gaps = 21/122 (17%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPL----------------GIKPRLGD 41 + A FGVPQ RERL+I+ + L + F FP + I+ ++ D Sbjct: 188 LNAKYFGVPQNRERLFIVAWSKDLISADRFLFPYGIDAEGNTIYDKQMAKRCAIRTKVSD 247 Query: 42 ILE-EHID-DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99 I E + I+ D TIS+++W GHQ RK+ N++ GKGFGY F NS T+T+SARY+KDGS Sbjct: 248 IFEPQSIERDGFTISDRMWLGHQTRKKRNRLNGKGFGYSKFTGNSVYTSTISARYWKDGS 307 Query: 100 EI 101 EI Sbjct: 308 EI 309 >gi|304387412|ref|ZP_07369603.1| modification methylase EcoRII [Neisseria meningitidis ATCC 13091] gi|304338505|gb|EFM04624.1| modification methylase EcoRII [Neisseria meningitidis ATCC 13091] Length = 336 Score = 84.7 bits (208), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 44/98 (44%), Positives = 61/98 (62%), Gaps = 5/98 (5%) Query: 8 VPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 VPQ RER++I+ F N + F FP+P +P+L ILE+ +D+ T+S+ LW Q Sbjct: 177 VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDNLWLYLQN 236 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + +K G GFG+GL + + TLSARYYKDGSEI Sbjct: 237 YAKKHKAKGNGFGFGL-VDLDGISRTLSARYYKDGSEI 273 >gi|166368844|ref|YP_001661117.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa NIES-843] gi|166091217|dbj|BAG05925.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa NIES-843] Length = 338 Score = 84.7 bits (208), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 46/94 (48%), Positives = 59/94 (62%), Gaps = 2/94 (2%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67 VPQ R+R++I+ F PS F FP I P++ DILE +D K T+++ LW+ QK + Sbjct: 158 VPQNRKRIFIVGFEKPS-RFMFPEIPDIHPKIKDILEGEVDSKYTLTDHLWDYLQKYADK 216 Query: 68 NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +K G GFGYGL TLSARYYKDGSEI Sbjct: 217 HKEKGNGFGYGL-VNLEGIARTLSARYYKDGSEI 249 >gi|325130344|gb|EGC53110.1| modification methylase EcoRII [Neisseria meningitidis OX99.30304] Length = 337 Score = 84.7 bits (208), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 44/98 (44%), Positives = 61/98 (62%), Gaps = 5/98 (5%) Query: 8 VPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 VPQ RER++I+ F N + F FP+P +P+L ILE+ +D+ T+S+ LW Q Sbjct: 177 VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDNLWLYLQN 236 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + +K G GFG+GL + + TLSARYYKDGSEI Sbjct: 237 YAKKHKAKGNGFGFGL-VDLDGISRTLSARYYKDGSEI 273 >gi|255262721|ref|ZP_05342063.1| cytosine-specific methyltransferase NlaX [Thalassiobium sp. R2A62] gi|255105056|gb|EET47730.1| cytosine-specific methyltransferase NlaX [Thalassiobium sp. R2A62] Length = 421 Score = 84.7 bits (208), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 49/114 (42%), Positives = 70/114 (61%), Gaps = 13/114 (11%) Query: 1 MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPL--GIK-----PRLGDILEEH--I 47 + A +FGVPQ RER+YI+ F ++ + P + G+K RLGD+LE + + Sbjct: 243 LAAKNFGVPQNRERVYIVGFDRDQVSEAEARDLPREILDGLKERKSETRLGDVLETNASV 302 Query: 48 DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 D K TIS++L GH++R ++ G GFG+ LF S NT+SARYYKDGSE+ Sbjct: 303 DPKFTISDRLLAGHERRLRAHRAKGNGFGFSLFNAESPYCNTISARYYKDGSEV 356 >gi|15677157|ref|NP_274310.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis MC58] gi|161870164|ref|YP_001599334.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis 053442] gi|218768314|ref|YP_002342826.1| putative modification methylase [Neisseria meningitidis Z2491] gi|7226530|gb|AAF41666.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis MC58] gi|121052322|emb|CAM08652.1| putative modification methylase [Neisseria meningitidis Z2491] gi|161595717|gb|ABX73377.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis 053442] gi|254670478|emb|CBA06174.1| putative DNA modification methylase [Neisseria meningitidis alpha153] gi|308389411|gb|ADO31731.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis alpha710] gi|316984080|gb|EFV63058.1| modification methylase SsoII [Neisseria meningitidis H44/76] gi|319410559|emb|CBY90927.1| putative type II restriction-modification system enzyme Mod [Neisseria meningitidis WUE 2594] gi|325134466|gb|EGC57111.1| modification methylase EcoRII [Neisseria meningitidis M13399] gi|325136204|gb|EGC58812.1| modification methylase EcoRII [Neisseria meningitidis M0579] gi|325140483|gb|EGC63004.1| modification methylase EcoRII [Neisseria meningitidis CU385] gi|325144567|gb|EGC66866.1| modification methylase EcoRII [Neisseria meningitidis M01-240013] gi|325200082|gb|ADY95537.1| modification methylase EcoRII [Neisseria meningitidis H44/76] gi|325201996|gb|ADY97450.1| modification methylase EcoRII [Neisseria meningitidis M01-240149] gi|325205934|gb|ADZ01387.1| modification methylase EcoRII [Neisseria meningitidis M04-240196] gi|325208252|gb|ADZ03704.1| modification methylase EcoRII [Neisseria meningitidis NZ-05/33] Length = 337 Score = 84.7 bits (208), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 44/98 (44%), Positives = 61/98 (62%), Gaps = 5/98 (5%) Query: 8 VPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 VPQ RER++I+ F N + F FP+P +P+L ILE+ +D+ T+S+ LW Q Sbjct: 177 VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDNLWLYLQN 236 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + +K G GFG+GL + + TLSARYYKDGSEI Sbjct: 237 YAKKHKAKGNGFGFGL-VDLDGISRTLSARYYKDGSEI 273 >gi|118576810|ref|YP_876553.1| C-5 cytosine-specific DNA methylase [Cenarchaeum symbiosum A] gi|118195331|gb|ABK78249.1| C-5 cytosine-specific DNA methylase [Cenarchaeum symbiosum A] Length = 325 Score = 80.1 bits (196), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 44/94 (46%), Positives = 57/94 (60%), Gaps = 2/94 (2%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67 VPQ RERL+I+ F + VEF+FP KPRL DILE + ++ +W ++ KE Sbjct: 159 VPQHRERLFIVGF-DREVEFEFPKMKNAKPRLRDILEPDPGSEYVLTPGVWAALKRHKEA 217 Query: 68 NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + G GFGYG+ + T TLS RYYKDGSEI Sbjct: 218 CRARGAGFGYGI-ADPDGVTRTLSRRYYKDGSEI 250 >gi|238922589|ref|YP_002936102.1| modification methylase [Eubacterium rectale ATCC 33656] gi|238874261|gb|ACR73968.1| modification methylase [Eubacterium rectale ATCC 33656] Length = 392 Score = 80.1 bits (196), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 45/99 (45%), Positives = 60/99 (60%), Gaps = 6/99 (6%) Query: 8 VPQRRERLYIIDF----LNPSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62 VPQ RER+ I+ F +EF F TP+ KP + DILE+ +DDK T+S+ LW Q Sbjct: 220 VPQHRERIIIVGFDMERYGDDIEFDFDITPVNPKPVMRDILEKKVDDKYTLSDNLWTYLQ 279 Query: 63 KRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 ++ AG GFGYG+ + T+SARY+KDGSEI Sbjct: 280 NYAAKHRAAGNGFGYGI-APLDGVSRTISARYHKDGSEI 317 >gi|312898460|ref|ZP_07757850.1| DNA (cytosine-5-)-methyltransferase [Megasphaera micronuciformis F0359] gi|310620379|gb|EFQ03949.1| DNA (cytosine-5-)-methyltransferase [Megasphaera micronuciformis F0359] Length = 400 Score = 79.7 bits (195), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 45/99 (45%), Positives = 59/99 (59%), Gaps = 6/99 (6%) Query: 8 VPQRRERLYIIDF----LNPSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62 VPQ RER+ I+ F + F+F P+ KP + ILE +DDK T+++KLW Q Sbjct: 208 VPQHRERILIVGFDRKRYGRDIGFRFSIAPVNPKPAIKAILETKVDDKYTLTDKLWTYLQ 267 Query: 63 KRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 ++ AG GFGYG+ N + TLSARYYKDGSEI Sbjct: 268 NYAAKHRAAGNGFGYGIADPN-GVSRTLSARYYKDGSEI 305 >gi|323486195|ref|ZP_08091524.1| cytosine-specific methyltransferase [Clostridium symbiosum WAL-14163] gi|323400521|gb|EGA92890.1| cytosine-specific methyltransferase [Clostridium symbiosum WAL-14163] Length = 382 Score = 77.4 bits (189), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 45/99 (45%), Positives = 60/99 (60%), Gaps = 6/99 (6%) Query: 8 VPQRRERLYIIDF----LNPSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62 VPQ RER+ I+ F ++F F TP KP + DIL++ +D+K T+S+KLW Q Sbjct: 210 VPQHRERIIIVGFDRERYGQDIKFDFEITPAIPKPVMKDILDKKVDEKYTLSDKLWIYLQ 269 Query: 63 KRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +K AG GFGYG+ + T+SARYYKDGSEI Sbjct: 270 SYAAKHKAAGNGFGYGI-APLDGVSRTISARYYKDGSEI 307 >gi|237713924|ref|ZP_04544405.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. D1] gi|262409168|ref|ZP_06085712.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. 2_1_22] gi|229446080|gb|EEO51871.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. D1] gi|262352915|gb|EEZ02011.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. 2_1_22] Length = 361 Score = 75.5 bits (184), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 44/98 (44%), Positives = 57/98 (58%), Gaps = 5/98 (5%) Query: 8 VPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 VPQ RER+ I+ F + +F FP + +ILE IDDK T+S+KLW Q Sbjct: 186 VPQHRERIMIVGFNREIFHGEEQFCFPEQKQSTRGIREILESDIDDKYTLSDKLWSYLQN 245 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 E ++ G GFG+G+ N + TLSARYYKDGSEI Sbjct: 246 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 282 >gi|294646710|ref|ZP_06724334.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a] gi|294807186|ref|ZP_06766001.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD CC 1b] gi|292637950|gb|EFF56344.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a] gi|294445609|gb|EFG14261.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD CC 1b] Length = 445 Score = 75.5 bits (184), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 44/98 (44%), Positives = 57/98 (58%), Gaps = 5/98 (5%) Query: 8 VPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 VPQ RER+ I+ F + +F FP + +ILE IDDK T+S+KLW Q Sbjct: 270 VPQHRERIMIVGFNREIFHGEEQFCFPEQKQSTRGIREILESDIDDKYTLSDKLWSYLQN 329 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 E ++ G GFG+G+ N + TLSARYYKDGSEI Sbjct: 330 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 366 >gi|313158099|gb|EFR57504.1| putative DNA (cytosine-5-)-methyltransferase [Alistipes sp. HGB5] Length = 431 Score = 74.7 bits (182), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 44/98 (44%), Positives = 60/98 (61%), Gaps = 5/98 (5%) Query: 8 VPQRRERLYIIDFLN---PSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 VPQ RER+ I+ F N VE FKFP + ++ +ILE +D K T+++KLW Q Sbjct: 267 VPQHRERIMIVGFRNNLFHGVEKFKFPELKDVSHKIRNILEPEVDPKYTLTDKLWVYLQN 326 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + ++ +G GFG+GL + TLSARYYKDGSEI Sbjct: 327 YAKKHQDSGNGFGFGL-VDLDGIARTLSARYYKDGSEI 363 >gi|296282358|ref|ZP_06860356.1| DNA-cytosine methyltransferase [Citromicrobium bathyomarinum JL354] Length = 439 Score = 74.7 bits (182), Expect = 4e-12, Method: Composition-based stats. Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 8/100 (8%) Query: 8 VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLWEGH 61 VPQ+RER++I+ F S + P + P+LG ILE H +D K T++ +LWE Sbjct: 250 VPQKRERIFIVGFREKSAFNLAGLEIPA-VADGPKLGSILEPHDQVDPKYTLTPRLWEYL 308 Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q+ ++ ++ G GFGY LF TLSARY+KDGSEI Sbjct: 309 QEYRKKHEAKGNGFGYSLFGPGD-VARTLSARYHKDGSEI 347 >gi|85709931|ref|ZP_01040996.1| Type II restriction-modification system methylation subunit [Erythrobacter sp. NAP1] gi|85688641|gb|EAQ28645.1| Type II restriction-modification system methylation subunit [Erythrobacter sp. NAP1] Length = 370 Score = 72.8 bits (177), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 43/111 (38%), Positives = 63/111 (56%), Gaps = 10/111 (9%) Query: 1 MKACDFGVPQRRERLYIIDF-------LNPSVEFKFPTPLGIKPRLGDILEEHIDD---K 50 + A +FGVPQ+RER+YI+ F ++ + F G RLGD LE + + Sbjct: 184 LAATEFGVPQKRERVYIVGFDRDHFGNIDANDVFAQLERGGHPTRLGDALEPEGANSLAR 243 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 TIS+KLW G +R ++ G GFG+ +F + NT+++RYYKDG EI Sbjct: 244 YTISDKLWSGLIRRMARHEAKGNGFGHKVFNYDDPYCNTITSRYYKDGREI 294 >gi|53714966|ref|YP_100958.1| C-5 cytosine-specific DNA-methylase [Bacteroides fragilis YCH46] gi|52217831|dbj|BAD50424.1| C-5 cytosine-specific DNA-methylase [Bacteroides fragilis YCH46] Length = 431 Score = 72.8 bits (177), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 42/98 (42%), Positives = 56/98 (57%), Gaps = 5/98 (5%) Query: 8 VPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 VPQ RER+ I+ D + +F FP + +IL+ ID K T+S+KLW Q Sbjct: 270 VPQHRERIMIVGFNQDVFHGKEQFAFPEQKQSTRSIKEILDPDIDGKYTLSDKLWSYLQN 329 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 E ++ G GFG+G+ N + TLSARYYKDGSEI Sbjct: 330 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 366 >gi|210631776|ref|ZP_03297018.1| hypothetical protein COLSTE_00903 [Collinsella stercoris DSM 13279] gi|210159896|gb|EEA90867.1| hypothetical protein COLSTE_00903 [Collinsella stercoris DSM 13279] Length = 390 Score = 70.5 bits (171), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 6/95 (6%) Query: 10 QRRERLYIIDFLNPSVEFKFP---TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKE 66 Q RER+YI+ F + V+F + P + + +ILE +DD+ +S+KLW + K Sbjct: 231 QHRERIYIVGFRD-DVDFSWDDLDCPQNGQ-KAAEILETDVDDRYVLSDKLWSYLKAYKA 288 Query: 67 NNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 ++ AG GFGYGL S TT TLSARY+KDGSEI Sbjct: 289 KHEAAGNGFGYGL-ITPSDTTRTLSARYHKDGSEI 322 >gi|167035739|ref|YP_001670970.1| DNA cytosine methylase [Pseudomonas putida GB-1] gi|166862227|gb|ABZ00635.1| DNA-cytosine methyltransferase [Pseudomonas putida GB-1] Length = 447 Score = 69.7 bits (169), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 45/105 (42%), Positives = 58/105 (55%), Gaps = 16/105 (15%) Query: 8 VPQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 PQ RER+ ++ F L E FP +P LGDIL+E +DDK ++ K Sbjct: 261 TPQHRERIVLVGFRKDLGVHSGFTLKDIAEL-FPKK---RPALGDILDEKVDDKYILTPK 316 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW+ +K G GFG+GL + S+ T TLSARYYKDGSEI Sbjct: 317 LWQYLFNYAIKHKAKGNGFGFGLVGK-SSVTRTLSARYYKDGSEI 360 >gi|296114735|ref|ZP_06833385.1| DNA-cytosine methyltransferase [Gluconacetobacter hansenii ATCC 23769] gi|295978659|gb|EFG85387.1| DNA-cytosine methyltransferase [Gluconacetobacter hansenii ATCC 23769] Length = 419 Score = 68.9 bits (167), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 42/100 (42%), Positives = 57/100 (57%), Gaps = 8/100 (8%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPT----PLGIKPRLGDILEEH--IDDKSTISNKLWEGH 61 VPQ+RER++I+ F +F + P+ PRLG IL H ++ K T++ LW Sbjct: 230 VPQKRERIFIVGF-REKTDFDLKSLVVPPIEKGPRLGSILLPHAEVEPKYTLTEHLWNYL 288 Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q K + AG GFG+GL + TLSARY+KDGSEI Sbjct: 289 QNYKAKHAAAGNGFGFGLCGPDD-VARTLSARYFKDGSEI 327 >gi|86136173|ref|ZP_01054752.1| hypothetical protein MED193_18659 [Roseobacter sp. MED193] gi|85827047|gb|EAQ47243.1| hypothetical protein MED193_18659 [Roseobacter sp. MED193] Length = 399 Score = 68.6 bits (166), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 51/116 (43%), Positives = 58/116 (50%), Gaps = 24/116 (20%) Query: 8 VPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRLGDIL--------------EEH-- 46 VPQ RER++I F V +F P G PRL DIL E H Sbjct: 207 VPQHRERIFISGFRR-DVPTRFCLDDVVIPPGPNPRLSDILHPENGSEIAEPPYTEGHLA 265 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 I DK T+S+KLW Q +K AG GFG+GL S TLSARYYKDGSEI Sbjct: 266 RIADKYTLSDKLWAYLQNYAAKHKAAGNGFGFGLCTPES-VARTLSARYYKDGSEI 320 >gi|94501925|ref|ZP_01308434.1| DNA-cytosine methyltransferase [Oceanobacter sp. RED65] gi|94425919|gb|EAT10918.1| DNA-cytosine methyltransferase [Oceanobacter sp. RED65] Length = 287 Score = 68.6 bits (166), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 41/102 (40%), Positives = 60/102 (58%), Gaps = 9/102 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEF---KFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61 +PQ RER+ ++ F LN + F P P + P L +LE+ +D+K ++ +LWE Sbjct: 94 LPQHRERIVLVGFRKDLNLTNRFTLTNLPKPREV-PSLSSLLEKSVDEKYVLTPRLWEYL 152 Query: 62 QKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 + + ++ G GFGYGL +SA TLSARY+KDGSEI Sbjct: 153 YEYAKKHQAKGNGFGYGLVDPKNSSAVCRTLSARYHKDGSEI 194 >gi|239621327|ref|ZP_04664358.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp. infantis CCUG 52486] gi|239515788|gb|EEQ55655.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp. infantis CCUG 52486] Length = 343 Score = 67.4 bits (163), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 10/100 (10%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKP----RLGDIL--EEHIDDKSTISNKLWEGH 61 VPQ RER YI+ F + F F +KP +G IL + DK +S+KLW Sbjct: 185 VPQHRERTYIVGFREEN-GFTFDD---VKPIAHGNVGSILLPASQVPDKYVLSDKLWTYL 240 Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q K+ ++ AG GFGYG+ + T TLSARY KDGSEI Sbjct: 241 QNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 280 >gi|189439219|ref|YP_001954300.1| site-specific DNA methylase [Bifidobacterium longum DJO10A] gi|189427654|gb|ACD97802.1| Site-specific DNA methylase [Bifidobacterium longum DJO10A] Length = 323 Score = 67.4 bits (163), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 10/100 (10%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKP----RLGDIL--EEHIDDKSTISNKLWEGH 61 VPQ RER YI+ F + F F +KP +G IL + DK +S+KLW Sbjct: 165 VPQHRERTYIVGFREEN-GFTFDD---VKPIAHGNVGSILLPASQVPDKYVLSDKLWTYL 220 Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q K+ ++ AG GFGYG+ + T TLSARY KDGSEI Sbjct: 221 QNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 260 >gi|46191283|ref|ZP_00120453.2| COG0270: Site-specific DNA methylase [Bifidobacterium longum DJO10A] Length = 315 Score = 67.4 bits (163), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 10/100 (10%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKP----RLGDIL--EEHIDDKSTISNKLWEGH 61 VPQ RER YI+ F + F F +KP +G IL + DK +S+KLW Sbjct: 157 VPQHRERTYIVGFREEN-GFTFDD---VKPIAHGNVGSILLPASQVPDKYVLSDKLWTYL 212 Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q K+ ++ AG GFGYG+ + T TLSARY KDGSEI Sbjct: 213 QNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 252 >gi|23466029|ref|NP_696632.1| modification methylase very EcoRII (cytosine-specificmethyltransferase [Bifidobacterium longum NCC2705] gi|23326750|gb|AAN25268.1| modification methylase very similar to EcoRII (cytosine-specificmethyltransferase [Bifidobacterium longum NCC2705] Length = 323 Score = 67.4 bits (163), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 10/100 (10%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKP----RLGDIL--EEHIDDKSTISNKLWEGH 61 VPQ RER YI+ F + F F +KP +G IL + DK +S+KLW Sbjct: 165 VPQHRERTYIVGFREEN-GFTFDD---VKPIAHGNVGSILLPASQVPDKYVLSDKLWTYL 220 Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q K+ ++ AG GFGYG+ + T TLSARY KDGSEI Sbjct: 221 QNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 260 >gi|56751653|ref|YP_172354.1| hypothetical protein syc1644_d [Synechococcus elongatus PCC 6301] gi|81301269|ref|YP_401477.1| DNA-cytosine methyltransferase [Synechococcus elongatus PCC 7942] gi|56686612|dbj|BAD79834.1| hypothetical protein [Synechococcus elongatus PCC 6301] gi|81170150|gb|ABB58490.1| DNA-cytosine methyltransferase [Synechococcus elongatus PCC 7942] Length = 424 Score = 67.0 bits (162), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 46/114 (40%), Positives = 58/114 (50%), Gaps = 22/114 (19%) Query: 8 VPQRRERLYIIDFLNPSVEF---KFPTPLGIKPRLGDIL-----------------EEHI 47 VPQ RER+YI+ F V F F P + DIL E + Sbjct: 234 VPQHRERIYIVGF-REEVGFNWDSFSQPPTDTKCMADILHPNDGSEEVEEPYTVGIEAKV 292 Query: 48 DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +DK T+S+KLW Q ++ AG GFG+GL ++S TLSARYYKDGSEI Sbjct: 293 NDKYTLSDKLWNYLQNYANKHRAAGNGFGFGLVNKDS-IARTLSARYYKDGSEI 345 >gi|114571596|ref|YP_758276.1| DNA-cytosine methyltransferase [Maricaulis maris MCS10] gi|114342058|gb|ABI67338.1| DNA-cytosine methyltransferase [Maricaulis maris MCS10] Length = 406 Score = 66.6 bits (161), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 10/102 (9%) Query: 8 VPQRRERLYIIDFLNPSVEFKFP------TPLGIKPRLGDILEEH--IDDKSTISNKLWE 59 VPQ+RER++I+ F + S +F F P L IL+ H I K T++ KLW+ Sbjct: 228 VPQKRERVFIVGFRD-STDFSFEGFERLIPHASNHPTLDSILQSHNEIGQKYTLTEKLWD 286 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q ++ ++ G GFGY LF + TLSARY+KDGSEI Sbjct: 287 YLQAYRQKHESKGNGFGYSLFGPDD-VARTLSARYHKDGSEI 327 >gi|328947602|ref|YP_004364939.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] gi|328447926|gb|AEB13642.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] Length = 431 Score = 66.2 bits (160), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 46/117 (39%), Positives = 59/117 (50%), Gaps = 24/117 (20%) Query: 8 VPQRRERLYIIDFLN------------PSVEFKFPTPL----GIKPRLGDILEEHID--- 48 VPQ RER+ I+ F N P E K + L G +PRL +++ D Sbjct: 233 VPQHRERIVIVGFRNKVDFSLEDMELPPKGEVKLASILHKTDGTEPRLPQDGDKYFDFEN 292 Query: 49 ----DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 DK T+++ LW Q + ++ G GFGYGL EN TLSARYYKDGSEI Sbjct: 293 NKVLDKYTLTDNLWAYLQAYAQKHRSMGNGFGYGLVNEND-IARTLSARYYKDGSEI 348 >gi|261337441|ref|ZP_05965325.1| modification methylase HpaII [Bifidobacterium gallicum DSM 20093] gi|270277829|gb|EFA23683.1| modification methylase HpaII [Bifidobacterium gallicum DSM 20093] Length = 442 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 44/119 (36%), Positives = 62/119 (52%), Gaps = 29/119 (24%) Query: 8 VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILE------------------- 44 VPQ RER+YI+ F + + + KFP +P L DIL Sbjct: 231 VPQHRERIYIVGFCSKTDFTWDDLKFPDH---QPILADILHKTDGTEPYLPWDGDKYFDF 287 Query: 45 EH--IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 EH + DK T++ +LW+ Q ++ ++ G GFGYGL + + TLSARY+KDGSEI Sbjct: 288 EHQKVQDKYTLTPRLWQYLQDYRKKHEALGHGFGYGLVTPD-MVSRTLSARYHKDGSEI 345 >gi|10957343|ref|NP_058367.1| DNA cytosine methylase [Salmonella typhi] gi|7800396|gb|AAF69992.1|AF250878_153 EcoRII cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi] gi|145849042|emb|CAM91602.1| ecoRII cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] Length = 475 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 15/105 (14%) Query: 9 PQRRERLYIIDFLN----------PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 PQ RER+ ++ F V +P+ +P LG++L+ +D + +S KLW Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSR---RPTLGELLDAEVDSRYILSPKLW 334 Query: 59 EGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 E + ++ G GFG+GL + S TLSARYY+DGSEI Sbjct: 335 EYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379 >gi|313651376|gb|EFS15772.1| modification methylase EcoRII [Shigella flexneri 2a str. 2457T] Length = 463 Score = 64.3 bits (155), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 15/105 (14%) Query: 9 PQRRERLYIIDFLN----------PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 PQ RER+ ++ F V +P+ +P LG++L+ +D + +S KLW Sbjct: 266 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSR---RPTLGELLDAEVDSRYILSPKLW 322 Query: 59 EGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 E + ++ G GFG+GL + S TLSARYY+DGSEI Sbjct: 323 EYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 367 >gi|18466581|ref|NP_569389.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|160431784|ref|YP_001551898.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Choleraesuis] gi|16505897|emb|CAD09776.1| putative DNA modification methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|159885325|dbj|BAF92929.1| putative DNA modification methylase [Salmonella enterica subsp. enterica serovar Choleraesuis] Length = 475 Score = 64.3 bits (155), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 15/105 (14%) Query: 9 PQRRERLYIIDFLN----------PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 PQ RER+ ++ F V +P+ +P LG++L+ +D + +S KLW Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSR---RPTLGELLDAEVDSRYILSPKLW 334 Query: 59 EGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 E + ++ G GFG+GL + S TLSARYY+DGSEI Sbjct: 335 EYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379 >gi|260752101|ref|YP_003237616.1| putative DNA modification methylase [Escherichia coli O111:H- str. 11128] gi|257767571|dbj|BAI39065.1| putative DNA modification methylase [Escherichia coli O111:H- str. 11128] Length = 475 Score = 64.3 bits (155), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 15/105 (14%) Query: 9 PQRRERLYIIDFLN----------PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 PQ RER+ ++ F V +P+ +P LG++L+ +D + +S KLW Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSR---RPTLGELLDAEVDSRYILSPKLW 334 Query: 59 EGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 E + ++ G GFG+GL + S TLSARYY+DGSEI Sbjct: 335 EYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379 >gi|212716092|ref|ZP_03324220.1| hypothetical protein BIFCAT_01005 [Bifidobacterium catenulatum DSM 16992] gi|212661459|gb|EEB22034.1| hypothetical protein BIFCAT_01005 [Bifidobacterium catenulatum DSM 16992] Length = 453 Score = 63.9 bits (154), Expect = 6e-09, Method: Composition-based stats. Identities = 45/119 (37%), Positives = 60/119 (50%), Gaps = 29/119 (24%) Query: 8 VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILE------------------- 44 VPQ RER+YI+ F + + + K P KP L DIL Sbjct: 242 VPQHRERIYIVGFRSHTDFTWDDLKLPEH---KPVLADILHKNDGTEPYLPWDGDRYFDY 298 Query: 45 EH--IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 EH + DK T++ +LW+ Q K ++ G GFGYGL + + TLSARY+KDGSEI Sbjct: 299 EHNKVQDKYTLTPRLWQYLQDYKAKHEAMGHGFGYGLVTPD-MVSRTLSARYHKDGSEI 356 >gi|148244085|ref|YP_001220322.1| DNA-cytosine methyltransferase [Acidiphilium cryptum JF-5] gi|146400648|gb|ABQ29180.1| DNA-cytosine methyltransferase [Acidiphilium cryptum JF-5] Length = 487 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 43/116 (37%), Positives = 56/116 (48%), Gaps = 24/116 (20%) Query: 8 VPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRLGDILEEH---------------- 46 VPQ RER++I F + + EF F P P PRL IL Sbjct: 291 VPQHRERIFIAGFRDRNAEFTFKTLDIPDPAS-GPRLASILHPEDGTEKPDGHFTEGPLA 349 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + ++ T+++ LW Q E ++ AG GFG+GL TLSARYYKDGSEI Sbjct: 350 TVTERYTLTDHLWNYLQNYAEKHRRAGNGFGFGLCGPED-VARTLSARYYKDGSEI 404 >gi|226942156|ref|YP_002797230.1| Cytosine-specific methyltransferase [Laribacter hongkongensis HLHK9] gi|226717083|gb|ACO76221.1| Cytosine-specific methyltransferase [Laribacter hongkongensis HLHK9] Length = 420 Score = 63.5 bits (153), Expect = 9e-09, Method: Composition-based stats. Identities = 47/117 (40%), Positives = 59/117 (50%), Gaps = 26/117 (22%) Query: 9 PQRRERLYIIDFLNPSVEFKF---PTPL--------------GIKPRL---GDILEEH-- 46 PQ RER+ I F P V F + P P G +P L GD +H Sbjct: 231 PQHRERILIAGFREP-VAFDWDAIPLPPKGSRTLRTVLHRTDGSEPVLPWDGDRFFDHQA 289 Query: 47 --IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + DK T++ KLW+ Q E ++ G GFG+GL +S T TLSARYYKDGSEI Sbjct: 290 RCVQDKYTLTPKLWDYLQAYAEKHRAKGNGFGFGLVGPDS-VTRTLSARYYKDGSEI 345 >gi|254251049|ref|ZP_04944367.1| Site-specific DNA methylase [Burkholderia dolosa AUO158] gi|124893658|gb|EAY67538.1| Site-specific DNA methylase [Burkholderia dolosa AUO158] Length = 530 Score = 63.2 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 45/116 (38%), Positives = 56/116 (48%), Gaps = 24/116 (20%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIK------------PRL---GDILEEH--- 46 PQ RER+ I+ F P+ + P GIK PRL GD +H Sbjct: 331 PQHRERIVIVGFREPTPFSWESLQLPEKGGIKMKDILHKLDGSEPRLEHDGDRYFDHEKQ 390 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 ++DK T++ LW+ Q +K G GFGYGL TLSARYYKDGSEI Sbjct: 391 KVNDKYTLTPNLWKYLQDYAAKHKAKGNGFGYGLVGPED-IARTLSARYYKDGSEI 445 >gi|126464142|ref|YP_001045255.1| DNA-cytosine methyltransferase [Rhodobacter sphaeroides ATCC 17029] gi|126105953|gb|ABN78483.1| DNA-cytosine methyltransferase [Rhodobacter sphaeroides ATCC 17029] Length = 417 Score = 62.8 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 42/116 (36%), Positives = 59/116 (50%), Gaps = 23/116 (19%) Query: 8 VPQRRERLYIIDF---LNPSVEF-KFPTPLGIK-PRLGDIL-----------------EE 45 VPQ RER++I+ L+ ++ K P G+ PR G +L E Sbjct: 222 VPQHRERIFIVGVRKDLDMKIDLSKLVLPSGVTGPRFGTVLHKEDGSELPNNRSFLDPEG 281 Query: 46 HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + D+ T+S+KLW+ Q E ++ G GFG+GL TLSARY+KDGSEI Sbjct: 282 RVSDRYTLSDKLWKYLQDYAEKHRQKGNGFGFGL-TRRGDVARTLSARYHKDGSEI 336 >gi|323968854|gb|EGB64190.1| DNA-cytosine methyltransferase [Escherichia coli TA007] Length = 272 Score = 62.0 bits (149), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 4/57 (7%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 A DFGVPQ RER+YI+ F V F FPTPL K R+GDILE+ +D+K T+S+ Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSD 271 >gi|300899219|ref|ZP_07117494.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1] gi|300357175|gb|EFJ73045.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1] Length = 477 Score = 62.0 bits (149), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F G P L +L+ ++ K ++ LW+ Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 336 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 337 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|218695565|ref|YP_002403232.1| DNA cytosine methylase [Escherichia coli 55989] gi|256022383|ref|ZP_05436248.1| DNA cytosine methylase [Escherichia sp. 4_1_40B] gi|218352297|emb|CAU98056.1| DNA cytosine methylase [Escherichia coli 55989] gi|323972739|gb|EGB67939.1| DNA-cytosine methyltransferase [Escherichia coli TA007] gi|332343686|gb|AEE57020.1| DNA-cytosine methyltransferase [Escherichia coli UMNK88] Length = 472 Score = 61.6 bits (148), Expect = 3e-08, Method: Composition-based stats. Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F G P L +L+ ++ K ++ LW+ Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 331 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|301029418|ref|ZP_07192512.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1] gi|299877722|gb|EFI85933.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1] Length = 476 Score = 61.6 bits (148), Expect = 3e-08, Method: Composition-based stats. Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F G P L +L+ ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378 >gi|193071315|ref|ZP_03052233.1| DNA-cytosine methyltransferase [Escherichia coli E110019] gi|331683510|ref|ZP_08384111.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299] gi|192955357|gb|EDV85842.1| DNA-cytosine methyltransferase [Escherichia coli E110019] gi|331079725|gb|EGI50922.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299] Length = 472 Score = 61.6 bits (148), Expect = 3e-08, Method: Composition-based stats. Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F G P L +L+ ++ K ++ LW+ Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 331 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|186476891|ref|YP_001858361.1| DNA-cytosine methyltransferase [Burkholderia phymatum STM815] gi|184193350|gb|ACC71315.1| DNA-cytosine methyltransferase [Burkholderia phymatum STM815] Length = 428 Score = 61.6 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 41/118 (34%), Positives = 55/118 (46%), Gaps = 29/118 (24%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45 PQ RER+ +I F + + + P PRL IL Sbjct: 237 PQHRERIIMIGFRARTSFSWDDLRLPEE---GPRLASILHRTDGTEPVLPWDGDRFFDHA 293 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 H+ K T++ KLW Q + ++ AG GFGYG+ + S T TLSARY+KDGSEI Sbjct: 294 ARHVQPKYTLTPKLWTYLQNYADKHRAAGNGFGYGMAYPQS-VTRTLSARYHKDGSEI 350 >gi|82776352|ref|YP_402701.1| DNA cytosine methylase [Shigella dysenteriae Sd197] gi|309789422|ref|ZP_07684012.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1617] gi|81240500|gb|ABB61210.1| DNA cytosine methylase [Shigella dysenteriae Sd197] gi|308922816|gb|EFP68333.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1617] Length = 472 Score = 61.6 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F G P L +L+ ++ K ++ LW+ Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 331 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|311279100|ref|YP_003941331.1| DNA-cytosine methyltransferase [Enterobacter cloacae SCF1] gi|308748295|gb|ADO48047.1| DNA-cytosine methyltransferase [Enterobacter cloacae SCF1] Length = 492 Score = 61.6 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 37/103 (35%), Positives = 56/103 (54%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN F G+ +P G++LE +D K ++ LW+ Sbjct: 293 LPQHRERIVLVGFRRDLNLHQGFSLRALPGLYPAQRPTFGELLEPTVDAKFILTPVLWKY 352 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYGL + + TLSARYYKDG+EI Sbjct: 353 LYRYAKKHQARGNGFGYGLVDPTNPDSVARTLSARYYKDGAEI 395 >gi|261340425|ref|ZP_05968283.1| DNA (cytosine-5-)-methyltransferase [Enterobacter cancerogenus ATCC 35316] gi|288317516|gb|EFC56454.1| DNA (cytosine-5-)-methyltransferase [Enterobacter cancerogenus ATCC 35316] Length = 477 Score = 61.6 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F + +P + D+LE +D K ++ LW+ Sbjct: 277 LPQHRERIVLVGFRRDLNLMGDFTLRNLPALYPARRPTIADLLEPAVDAKFILTPVLWKY 336 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFG+G+ N + T TLSARYYKDG+EI Sbjct: 337 LYRYAKKHQAKGNGFGFGMVNPNDPHSVTRTLSARYYKDGAEI 379 >gi|296103580|ref|YP_003613726.1| DNA cytosine methylase [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295058039|gb|ADF62777.1| DNA cytosine methylase [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 471 Score = 61.6 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 37/103 (35%), Positives = 56/103 (54%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F + +P + D+LE +D K ++ LW+ Sbjct: 271 LPQHRERIVLVGFRRDLNLKGDFTLRDIPSLYPARRPSVADLLEPAVDAKFILTPVLWKY 330 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFG+GL N T TLSARYYKDG+EI Sbjct: 331 LYRYAKKHQAKGNGFGFGLVNPNDPHCVTRTLSARYYKDGAEI 373 >gi|37524351|ref|NP_927695.1| DNA cytosine methylase [Photorhabdus luminescens subsp. laumondii TTO1] gi|36783775|emb|CAE12633.1| DNA-cytosine methyltransferase [Photorhabdus luminescens subsp. laumondii TTO1] Length = 478 Score = 61.2 bits (147), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F FP +P L D+LE +D K ++ L Sbjct: 281 LPQHRERIVLVGFRKDLNIHQGFTLRDISRYFPKE---RPTLADLLEPEVDSKYILTPNL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ ++ G GFG+GL N+ + T TLSARY+KDGSEI Sbjct: 338 WKYLYNYARKHQAKGNGFGFGLIDPNNKDSVTRTLSARYHKDGSEI 383 >gi|163732386|ref|ZP_02139832.1| hypothetical protein RLO149_03007 [Roseobacter litoralis Och 149] gi|161394684|gb|EDQ19007.1| hypothetical protein RLO149_03007 [Roseobacter litoralis Och 149] Length = 410 Score = 61.2 bits (147), Expect = 4e-08, Method: Composition-based stats. Identities = 45/114 (39%), Positives = 57/114 (50%), Gaps = 22/114 (19%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDIL---------EEH--------I 47 VPQ RER+ I+ F V F F P + R+ DIL E H + Sbjct: 222 VPQHRERIVIVGF-REDVPFSFDDVILPPHRERRMRDILHPENGNENPESHFTLGNDAAV 280 Query: 48 DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 K T+S+KLW+ Q +K G GFG+GL + + TLSARYYKDGSEI Sbjct: 281 SGKYTLSDKLWKYLQDYAAKHKAKGNGFGFGL-VDGDSIARTLSARYYKDGSEI 333 >gi|300904853|ref|ZP_07122678.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1] gi|301304244|ref|ZP_07210359.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1] gi|300403236|gb|EFJ86774.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1] gi|300840501|gb|EFK68261.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1] gi|315257206|gb|EFU37174.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 85-1] Length = 472 Score = 61.2 bits (147), Expect = 4e-08, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + +++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQVRGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|237732007|ref|ZP_04562488.1| DNA cytosine methylase [Citrobacter sp. 30_2] gi|226907546|gb|EEH93464.1| DNA cytosine methylase [Citrobacter sp. 30_2] Length = 476 Score = 60.8 bits (146), Expect = 5e-08, Method: Composition-based stats. Identities = 36/103 (34%), Positives = 58/103 (56%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F + P+ L ++LE +D K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKSDFTLRDIVTRYPQRRTTLAELLEPTVDAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + + + T TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPGNPDSVTRTLSARYYKDGAEI 378 >gi|188494720|ref|ZP_03001990.1| DNA-cytosine methyltransferase [Escherichia coli 53638] gi|188489919|gb|EDU65022.1| DNA-cytosine methyltransferase [Escherichia coli 53638] Length = 472 Score = 60.8 bits (146), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 35/103 (33%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F +N +F G P L +L+ ++ K ++ LW+ Sbjct: 272 LPQHRERIVLVGFRRDINLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 331 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|324112381|gb|EGC06359.1| DNA-cytosine methyltransferase [Escherichia fergusonii B253] Length = 473 Score = 60.8 bits (146), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G +LE +D K +S KL Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQ---RPLFGQLLESSVDSKYILSPKL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101 W+ + + G GFG+GL N+A + TLSARY+KDGSEI Sbjct: 338 WQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 383 >gi|325499566|gb|EGC97425.1| DNA cytosine methylase [Escherichia fergusonii ECD227] Length = 473 Score = 60.8 bits (146), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G +LE +D K +S KL Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQ---RPLFGQLLESSVDSKYILSPKL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101 W+ + + G GFG+GL N+A + TLSARY+KDGSEI Sbjct: 338 WQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 383 >gi|291085206|ref|ZP_06352388.2| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC 29220] gi|291072321|gb|EFE10430.1| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC 29220] Length = 476 Score = 60.8 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 36/103 (34%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F L +F PR L D+LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLQLKSDFTLRNIATCYPRRRTTLADLLEPTVEAKYVLTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + + T TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPGNPDCVTRTLSARYYKDGAEI 378 >gi|218551294|ref|YP_002385086.1| DNA cytosine methylase [Escherichia fergusonii ATCC 35469] gi|218358836|emb|CAQ91493.1| DNA modification methylase [Escherichia fergusonii ATCC 35469] Length = 485 Score = 60.8 bits (146), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G +LE +D K +S KL Sbjct: 293 LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQ---RPLFGQLLESSVDSKYILSPKL 349 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101 W+ + + G GFG+GL N+A + TLSARY+KDGSEI Sbjct: 350 WQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 395 >gi|170769440|ref|ZP_02903893.1| DNA-cytosine methyltransferase [Escherichia albertii TW07627] gi|170121764|gb|EDS90695.1| DNA-cytosine methyltransferase [Escherichia albertii TW07627] Length = 472 Score = 60.5 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F FPT + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKASFTLRDINQCFPTQ---RVTLAQLLDPVVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|209520785|ref|ZP_03269531.1| DNA-cytosine methyltransferase [Burkholderia sp. H160] gi|209498782|gb|EDZ98891.1| DNA-cytosine methyltransferase [Burkholderia sp. H160] Length = 432 Score = 60.5 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 41/118 (34%), Positives = 55/118 (46%), Gaps = 29/118 (24%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45 PQ RER+ I+ F + + + P PRLG IL Sbjct: 238 PQHRERIIIVGFRGETTFTWDDLRLPEQ---GPRLGAILHRKDGSEPVLPWDHDRFFDHA 294 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ KLW Q ++ AG GFG+GL + +S T TLSARY+KDGSEI Sbjct: 295 ARRVQPKYTLTPKLWAYLQNYAAKHRAAGNGFGFGLAYPDS-VTRTLSARYHKDGSEI 351 >gi|157158517|ref|YP_001463262.1| DNA cytosine methylase [Escherichia coli E24377A] gi|157080547|gb|ABV20255.1| DNA-cytosine methyltransferase [Escherichia coli E24377A] Length = 472 Score = 60.1 bits (144), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDSMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|238783073|ref|ZP_04627100.1| Modification methylase EcoRII [Yersinia bercovieri ATCC 43970] gi|238716074|gb|EEQ08059.1| Modification methylase EcoRII [Yersinia bercovieri ATCC 43970] Length = 475 Score = 60.1 bits (144), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP +P G++LE +DDK ++ L Sbjct: 281 LPQHRERIVLVGFRKDLNIDKDFTLKDIHKFFPEK---RPTFGELLEPVVDDKYILTPHL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 W+ + ++ G GFG+GL + + TLSARY+KDGSEI Sbjct: 338 WKYLYNYAKKHQAKGNGFGFGLVDPTNSDSVARTLSARYHKDGSEI 383 >gi|323186716|gb|EFZ72038.1| DNA-cytosine methyltransferase [Escherichia coli RN587/1] Length = 472 Score = 60.1 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|215487159|ref|YP_002329590.1| DNA cytosine methylase [Escherichia coli O127:H6 str. E2348/69] gi|312967158|ref|ZP_07781376.1| DNA-cytosine methyltransferase [Escherichia coli 2362-75] gi|215265231|emb|CAS09622.1| DNA cytosine methylase [Escherichia coli O127:H6 str. E2348/69] gi|312288622|gb|EFR16524.1| DNA-cytosine methyltransferase [Escherichia coli 2362-75] Length = 472 Score = 60.1 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|152970972|ref|YP_001336081.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|150955821|gb|ABR77851.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 477 Score = 60.1 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDFLNP----------SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F + ++P ++P G++LE +D K ++ L Sbjct: 277 LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYP---AVRPTFGELLEPTVDSKFILTPVL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 W+ + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 334 WKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379 >gi|187923141|ref|YP_001894783.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN] gi|187714335|gb|ACD15559.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN] Length = 426 Score = 60.1 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 40/118 (33%), Positives = 54/118 (45%), Gaps = 29/118 (24%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45 PQ RER+ I+ F + + + P PRLG IL Sbjct: 232 PQHRERIIIVGFRGKTAFSWDDLRLPQD---GPRLGSILHRTDGSEPVLPWDHDRFFDHA 288 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+G+ + S T TLSARY+KDGSEI Sbjct: 289 GRRVQPKYTLTPNLWTYLQNYAEKHRAAGNGFGFGMAYPTS-VTRTLSARYHKDGSEI 345 >gi|213581465|ref|ZP_03363291.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] Length = 295 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F +P L ++LE ++ K ++ LW+ Sbjct: 108 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 167 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 168 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 210 >gi|119355933|ref|YP_910577.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides DSM 266] gi|119353282|gb|ABL64153.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides DSM 266] Length = 425 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 44/114 (38%), Positives = 57/114 (50%), Gaps = 21/114 (18%) Query: 8 VPQRRERLYIIDFL-NPSVEF-KFPTPLG-IKPRLGDILE-----------------EHI 47 VPQ RER++I F + F +F P G +P + IL I Sbjct: 224 VPQHRERIFIAGFREDCGFSFDRFDLPHGNERPVIETILHPENGMEDEEPPYTVGPLARI 283 Query: 48 DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 D+ T+S+ LWE QK E ++ G GFG+GL + TLSARYYKDGSEI Sbjct: 284 SDRYTLSDHLWEYLQKYAEKHRAKGNGFGFGLVGPHD-VARTLSARYYKDGSEI 336 >gi|62180565|ref|YP_216982.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|62128198|gb|AAX65901.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|322715041|gb|EFZ06612.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|322616984|gb|EFY13892.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322618223|gb|EFY15115.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322625894|gb|EFY22713.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322626346|gb|EFY23156.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322632761|gb|EFY29506.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322639103|gb|EFY35796.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322640419|gb|EFY37075.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322647220|gb|EFY43719.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322648528|gb|EFY44979.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] gi|322655540|gb|EFY51848.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322660318|gb|EFY56556.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322662999|gb|EFY59206.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322668184|gb|EFY64343.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322674057|gb|EFY70151.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322675591|gb|EFY71665.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322682998|gb|EFY79014.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322686692|gb|EFY82670.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|323195420|gb|EFZ80600.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323198052|gb|EFZ83169.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323204476|gb|EFZ89482.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323207566|gb|EFZ92514.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323210995|gb|EFZ95855.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323217551|gb|EGA02270.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323226697|gb|EGA10894.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323231573|gb|EGA15686.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323236016|gb|EGA20095.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323240586|gb|EGA24629.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323245478|gb|EGA29478.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323247596|gb|EGA31547.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323254424|gb|EGA38240.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323257764|gb|EGA41444.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323262129|gb|EGA45692.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323266252|gb|EGA49742.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323270729|gb|EGA54168.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPGSVARTLSARYYKDGAEI 378 >gi|168462467|ref|ZP_02696398.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|194443436|ref|YP_002041256.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|238912436|ref|ZP_04656273.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] gi|194402099|gb|ACF62321.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|195634356|gb|EDX52708.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Newport str. SL317] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|168239231|ref|ZP_02664289.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|194734985|ref|YP_002115026.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|204931362|ref|ZP_03222061.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|194710487|gb|ACF89708.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197288080|gb|EDY27467.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|204319845|gb|EDZ05054.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|167552776|ref|ZP_02346527.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205322616|gb|EDZ10455.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|161613440|ref|YP_001587405.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|205352316|ref|YP_002226117.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|207856496|ref|YP_002243147.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|161362804|gb|ABX66572.1| hypothetical protein SPAB_01156 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|205272097|emb|CAR36949.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|206708299|emb|CAR32602.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|326627365|gb|EGE33708.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|200390041|ref|ZP_03216652.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|199602486|gb|EDZ01032.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Virchow str. SL491] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|168259722|ref|ZP_02681695.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|205351069|gb|EDZ37700.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNISRCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|197251440|ref|YP_002146032.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197215143|gb|ACH52540.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Agona str. SL483] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|198242597|ref|YP_002215094.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|197937113|gb|ACH74446.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|326622842|gb|EGE29187.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Dublin str. 3246] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNISRCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|56413096|ref|YP_150171.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197362022|ref|YP_002141659.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|56127353|gb|AAV76859.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197093499|emb|CAR58960.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|224583511|ref|YP_002637309.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|224468038|gb|ACN45868.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|168244842|ref|ZP_02669774.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|194449372|ref|YP_002046042.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194407676|gb|ACF67895.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|205336375|gb|EDZ23139.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|168234164|ref|ZP_02659222.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|168821682|ref|ZP_02833682.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|194470868|ref|ZP_03076852.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|197263635|ref|ZP_03163709.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|194457232|gb|EDX46071.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|197241890|gb|EDY24510.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|205331847|gb|EDZ18611.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|205341769|gb|EDZ28533.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|320085391|emb|CBY95172.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|331668651|ref|ZP_08369499.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271] gi|331063845|gb|EGI35756.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271] Length = 458 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 258 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 314 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 315 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 360 >gi|309795932|ref|ZP_07690345.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7] gi|308120382|gb|EFO57644.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|301018179|ref|ZP_07182696.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1] gi|300399832|gb|EFJ83370.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|16765328|ref|NP_460943.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|167993566|ref|ZP_02574660.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|16420526|gb|AAL20902.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|205328427|gb|EDZ15191.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|261247157|emb|CBG24980.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] gi|267993981|gb|ACY88866.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301158505|emb|CBW18015.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312912981|dbj|BAJ36955.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|321224636|gb|EFX49699.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|323130270|gb|ADX17700.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] gi|332988880|gb|AEF07863.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|260855934|ref|YP_003229825.1| DNA cytosine methylase [Escherichia coli O26:H11 str. 11368] gi|300822269|ref|ZP_07102410.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7] gi|257754583|dbj|BAI26085.1| DNA cytosine methylase [Escherichia coli O26:H11 str. 11368] gi|300525152|gb|EFK46221.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7] gi|309702249|emb|CBJ01566.1| DNA-cytosine methyltransferase [Escherichia coli ETEC H10407] gi|323937230|gb|EGB33510.1| DNA-cytosine methyltransferase [Escherichia coli E1520] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|16760934|ref|NP_456551.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|29141374|ref|NP_804716.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|213424982|ref|ZP_03357732.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] gi|289829483|ref|ZP_06547095.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] gi|25286126|pir||AH0754 site-specific DNA-methyltransferase (cytosine-specific) (EC 2.1.1.73) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|16503231|emb|CAD05739.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Typhi] gi|29137001|gb|AAO68565.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|157161430|ref|YP_001458748.1| DNA cytosine methylase [Escherichia coli HS] gi|157067110|gb|ABV06365.1| DNA-cytosine methyltransferase [Escherichia coli HS] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQTRGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|331653374|ref|ZP_08354379.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718] gi|331049472|gb|EGI21544.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|46581246|ref|YP_012054.1| type II DNA modification methyltransferase [Desulfovibrio vulgaris str. Hildenborough] gi|46450667|gb|AAS97314.1| type II DNA modification methyltransferase, putative [Desulfovibrio vulgaris str. Hildenborough] gi|311234912|gb|ADP87766.1| DNA-cytosine methyltransferase [Desulfovibrio vulgaris RCH1] Length = 358 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/109 (33%), Positives = 55/109 (50%), Gaps = 15/109 (13%) Query: 8 VPQRRERLYIIDFLNPSV-------------EFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 +PQ RER++++ F P +F + G + L ++E + +K T+ Sbjct: 172 IPQHRERIFMVGFRLPEACPAGAQKWDVKDFDFGKVSRRGSQKDLESVIEPDVPEKYTLG 231 Query: 55 NKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 W + K N+ G+GFGYG+ A TT TLSARY+KDG+EI Sbjct: 232 PGTWNTLVRHKANHAAKGQGFGYGMITPPFAGQTTRTLSARYHKDGAEI 280 >gi|320641809|gb|EFX11197.1| DNA cytosine methylase [Escherichia coli O157:H7 str. G5101] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|307138628|ref|ZP_07497984.1| DNA cytosine methylase [Escherichia coli H736] gi|331642581|ref|ZP_08343716.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736] gi|331039379|gb|EGI11599.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|291283137|ref|YP_003499955.1| DNA-cytosine methyltransferase [Escherichia coli O55:H7 str. CB9615] gi|209766674|gb|ACI81649.1| DNA cytosine methylase [Escherichia coli] gi|290763010|gb|ADD56971.1| DNA-cytosine methyltransferase [Escherichia coli O55:H7 str. CB9615] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|91211180|ref|YP_541166.1| DNA cytosine methylase [Escherichia coli UTI89] gi|117624099|ref|YP_853012.1| DNA cytosine methylase [Escherichia coli APEC O1] gi|218558817|ref|YP_002391730.1| DNA cytosine methylase [Escherichia coli S88] gi|91072754|gb|ABE07635.1| DNA cytosine methylase [Escherichia coli UTI89] gi|115513223|gb|ABJ01298.1| DNA cytosine methylase [Escherichia coli APEC O1] gi|218365586|emb|CAR03313.1| DNA cytosine methylase [Escherichia coli S88] gi|294492656|gb|ADE91412.1| DNA-cytosine methyltransferase [Escherichia coli IHE3034] gi|307626564|gb|ADN70868.1| DNA cytosine methylase [Escherichia coli UM146] gi|323952452|gb|EGB48325.1| DNA-cytosine methyltransferase [Escherichia coli H252] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|323977859|gb|EGB72945.1| DNA-cytosine methyltransferase [Escherichia coli TW10509] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLREISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|323962004|gb|EGB57603.1| DNA-cytosine methyltransferase [Escherichia coli H489] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|15802395|ref|NP_288421.1| DNA cytosine methylase [Escherichia coli O157:H7 EDL933] gi|15831953|ref|NP_310726.1| DNA cytosine methylase [Escherichia coli O157:H7 str. Sakai] gi|16129907|ref|NP_416470.1| DNA cytosine methyltransferase [Escherichia coli str. K-12 substr. MG1655] gi|89108792|ref|AP_002572.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. W3110] gi|168752207|ref|ZP_02777229.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4113] gi|168758275|ref|ZP_02783282.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4401] gi|168771615|ref|ZP_02796622.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4486] gi|168777717|ref|ZP_02802724.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4196] gi|168783359|ref|ZP_02808366.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4076] gi|168789321|ref|ZP_02814328.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC869] gi|168801737|ref|ZP_02826744.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC508] gi|170081604|ref|YP_001730924.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. DH10B] gi|195939267|ref|ZP_03084649.1| DNA cytosine methylase [Escherichia coli O157:H7 str. EC4024] gi|208810340|ref|ZP_03252216.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4206] gi|208816602|ref|ZP_03257722.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4045] gi|208821263|ref|ZP_03261583.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4042] gi|209400193|ref|YP_002271076.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4115] gi|209919382|ref|YP_002293466.1| DNA cytosine methylase [Escherichia coli SE11] gi|217328629|ref|ZP_03444710.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. TW14588] gi|218689956|ref|YP_002398168.1| DNA cytosine methylase [Escherichia coli ED1a] gi|238901165|ref|YP_002926961.1| DNA cytosine methylase [Escherichia coli BW2952] gi|253773091|ref|YP_003035922.1| DNA cytosine methylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254793611|ref|YP_003078448.1| DNA cytosine methylase [Escherichia coli O157:H7 str. TW14359] gi|256017846|ref|ZP_05431711.1| DNA cytosine methylase [Shigella sp. D9] gi|261227545|ref|ZP_05941826.1| DNA cytosine methylase [Escherichia coli O157:H7 str. FRIK2000] gi|261254631|ref|ZP_05947164.1| DNA cytosine methylase [Escherichia coli O157:H7 str. FRIK966] gi|293415271|ref|ZP_06657914.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli B185] gi|300818618|ref|ZP_07098826.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1] gi|300920181|ref|ZP_07136630.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1] gi|301327749|ref|ZP_07220953.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1] gi|301644580|ref|ZP_07244570.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1] gi|307312454|ref|ZP_07592088.1| DNA-cytosine methyltransferase [Escherichia coli W] gi|312973821|ref|ZP_07787993.1| DNA-cytosine methyltransferase [Escherichia coli 1827-70] gi|332278872|ref|ZP_08391285.1| DNA cytosine methylase [Shigella sp. D9] gi|83305674|sp|P0AEE0|DCM_ECO57 RecName: Full=DNA-cytosine methyltransferase gi|83305675|sp|P0AED9|DCM_ECOLI RecName: Full=DNA-cytosine methyltransferase; AltName: Full=M.EcoDcm gi|12516070|gb|AAG56975.1|AE005418_3 DNA cytosine methylase [Escherichia coli O157:H7 str. EDL933] gi|41239|emb|CAA31705.1| unnamed protein product [Escherichia coli K-12] gi|145719|gb|AAA03723.1| DNA cytosine methylase [Escherichia coli] gi|1736630|dbj|BAA15788.1| DNA cytosine methylase [Escherichia coli str. K12 substr. W3110] gi|1788271|gb|AAC75027.1| DNA cytosine methyltransferase [Escherichia coli str. K-12 substr. MG1655] gi|13362167|dbj|BAB36122.1| DNA cytosine methylase [Escherichia coli O157:H7 str. Sakai] gi|169889439|gb|ACB03146.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. DH10B] gi|187767102|gb|EDU30946.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4196] gi|188013903|gb|EDU52025.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4113] gi|188999305|gb|EDU68291.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4076] gi|189354901|gb|EDU73320.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4401] gi|189359668|gb|EDU78087.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4486] gi|189371047|gb|EDU89463.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC869] gi|189376137|gb|EDU94553.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC508] gi|208724856|gb|EDZ74563.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4206] gi|208730945|gb|EDZ79634.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4045] gi|208741386|gb|EDZ89068.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4042] gi|209161593|gb|ACI39026.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4115] gi|209766668|gb|ACI81646.1| DNA cytosine methylase [Escherichia coli] gi|209766670|gb|ACI81647.1| DNA cytosine methylase [Escherichia coli] gi|209766672|gb|ACI81648.1| DNA cytosine methylase [Escherichia coli] gi|209766676|gb|ACI81650.1| DNA cytosine methylase [Escherichia coli] gi|209912641|dbj|BAG77715.1| DNA cytosine methylase [Escherichia coli SE11] gi|217317976|gb|EEC26403.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. TW14588] gi|218427520|emb|CAR08415.2| DNA cytosine methylase [Escherichia coli ED1a] gi|238860813|gb|ACR62811.1| DNA cytosine methylase [Escherichia coli BW2952] gi|253324135|gb|ACT28737.1| DNA-cytosine methyltransferase [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254593011|gb|ACT72372.1| DNA cytosine methylase [Escherichia coli O157:H7 str. TW14359] gi|260448927|gb|ACX39349.1| DNA-cytosine methyltransferase [Escherichia coli DH1] gi|291432919|gb|EFF05898.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli B185] gi|300412803|gb|EFJ96113.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1] gi|300528790|gb|EFK49852.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1] gi|300845711|gb|EFK73471.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1] gi|301077088|gb|EFK91894.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1] gi|306907625|gb|EFN38128.1| DNA-cytosine methyltransferase [Escherichia coli W] gi|310332416|gb|EFP99651.1| DNA-cytosine methyltransferase [Escherichia coli 1827-70] gi|315061260|gb|ADT75587.1| DNA cytosine methylase [Escherichia coli W] gi|315136597|dbj|BAJ43756.1| DNA cytosine methylase [Escherichia coli DH1] gi|320191934|gb|EFW66581.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC1212] gi|320198651|gb|EFW73251.1| DNA-cytosine methyltransferase [Escherichia coli EC4100B] gi|320647167|gb|EFX16000.1| DNA cytosine methylase [Escherichia coli O157:H- str. 493-89] gi|320652452|gb|EFX20750.1| DNA cytosine methylase [Escherichia coli O157:H- str. H 2687] gi|320658054|gb|EFX25816.1| DNA cytosine methylase [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320658625|gb|EFX26319.1| DNA cytosine methylase [Escherichia coli O55:H7 str. USDA 5905] gi|320668523|gb|EFX35350.1| DNA cytosine methylase [Escherichia coli O157:H7 str. LSU-61] gi|323174657|gb|EFZ60277.1| DNA-cytosine methyltransferase [Escherichia coli LT-68] gi|323183944|gb|EFZ69331.1| DNA-cytosine methyltransferase [Escherichia coli 1357] gi|323378163|gb|ADX50431.1| DNA-cytosine methyltransferase [Escherichia coli KO11] gi|323948336|gb|EGB44323.1| DNA-cytosine methyltransferase [Escherichia coli H120] gi|326342371|gb|EGD66152.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. 1044] gi|326344875|gb|EGD68622.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. 1125] gi|332101224|gb|EGJ04570.1| DNA cytosine methylase [Shigella sp. D9] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|110642066|ref|YP_669796.1| DNA cytosine methylase [Escherichia coli 536] gi|191173268|ref|ZP_03034798.1| DNA-cytosine methyltransferase [Escherichia coli F11] gi|110343658|gb|ABG69895.1| DNA-cytosine methyltransferase [Escherichia coli 536] gi|190906385|gb|EDV65994.1| DNA-cytosine methyltransferase [Escherichia coli F11] gi|222033699|emb|CAP76440.1| DNA-cytosine methyltransferase [Escherichia coli LF82] gi|312946553|gb|ADR27380.1| DNA cytosine methylase [Escherichia coli O83:H1 str. NRG 857C] gi|324013473|gb|EGB82692.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 60-1] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|300931174|ref|ZP_07146520.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1] gi|300461007|gb|EFK24500.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1] Length = 477 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 334 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|300975476|ref|ZP_07173024.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1] gi|300410366|gb|EFJ93904.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|74312499|ref|YP_310918.1| DNA cytosine methylase [Shigella sonnei Ss046] gi|73855976|gb|AAZ88683.1| DNA cytosine methylase [Shigella sonnei Ss046] gi|323168918|gb|EFZ54598.1| DNA-cytosine methyltransferase [Shigella sonnei 53G] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|295675907|ref|YP_003604431.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1002] gi|295435750|gb|ADG14920.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1002] Length = 430 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 40/118 (33%), Positives = 55/118 (46%), Gaps = 29/118 (24%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45 PQ RER+ I+ F + + + P PRLG IL Sbjct: 236 PQHRERIIIVGFRGKTAFTWDDLRLPDE---GPRLGAILHRTDGTEPVLPWDHDRFFDHA 292 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ KLW Q ++ AG GFG+G+ + +S T TLSARY+KDGSEI Sbjct: 293 TRRVQPKYTLTPKLWAYLQNYAAKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 349 >gi|284921868|emb|CBG34943.1| DNA-cytosine methyltransferase [Escherichia coli 042] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|259909642|ref|YP_002649998.1| DNA cytosine methylase [Erwinia pyrifoliae Ep1/96] gi|224965264|emb|CAX56796.1| Cytosine-specific methyltransferase [Erwinia pyrifoliae Ep1/96] gi|261863687|gb|ACY01298.1| unknown [Erwinia pyrifoliae] gi|283479721|emb|CAY75637.1| DNA cytosine methylase [Erwinia pyrifoliae DSM 12163] Length = 473 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 38/106 (35%), Positives = 55/106 (51%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F FP +P G +LE+ +D K ++ +L Sbjct: 281 LPQHRERIVLVGFRRDLNIHQNFTLSNISRYFPDK---RPEFGSLLEKTVDSKYILTPRL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 WE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVDPTNSGSVARTLSARYHKDGSEI 383 >gi|218554541|ref|YP_002387454.1| DNA cytosine methylase [Escherichia coli IAI1] gi|260868553|ref|YP_003234955.1| DNA cytosine methylase [Escherichia coli O111:H- str. 11128] gi|218361309|emb|CAQ98893.1| DNA cytosine methylase [Escherichia coli IAI1] gi|257764909|dbj|BAI36404.1| DNA cytosine methylase [Escherichia coli O111:H- str. 11128] gi|323180787|gb|EFZ66327.1| DNA-cytosine methyltransferase [Escherichia coli 1180] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|323968376|gb|EGB63783.1| DNA-cytosine methyltransferase [Escherichia coli M863] gi|327253092|gb|EGE64746.1| DNA-cytosine methyltransferase [Escherichia coli STEC_7v] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLREISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|218699478|ref|YP_002407107.1| DNA cytosine methylase [Escherichia coli IAI39] gi|218369464|emb|CAR17229.1| DNA cytosine methylase [Escherichia coli IAI39] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|315290247|gb|EFU49625.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 153-1] Length = 478 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 278 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 334 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 335 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 380 >gi|300940416|ref|ZP_07155001.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1] gi|300454810|gb|EFK18303.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378 >gi|288934555|ref|YP_003438614.1| DNA-cytosine methyltransferase [Klebsiella variicola At-22] gi|288889264|gb|ADC57582.1| DNA-cytosine methyltransferase [Klebsiella variicola At-22] Length = 466 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 35/103 (33%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF-----LNPSVEFKFPTPL--GIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F L+ + L ++P G++LE +D K ++ LW+ Sbjct: 266 LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTVDAKFILTPVLWKY 325 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + ++ G GFGYGL + + TLSARYYKDG+EI Sbjct: 326 LYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 368 >gi|170681403|ref|YP_001743285.1| DNA cytosine methylase [Escherichia coli SMS-3-5] gi|170519121|gb|ACB17299.1| DNA-cytosine methyltransferase [Escherichia coli SMS-3-5] gi|324119009|gb|EGC12898.1| DNA-cytosine methyltransferase [Escherichia coli E1167] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|82543581|ref|YP_407528.1| DNA cytosine methylase [Shigella boydii Sb227] gi|81244992|gb|ABB65700.1| DNA cytosine methylase [Shigella boydii Sb227] gi|332096894|gb|EGJ01883.1| DNA-cytosine methyltransferase [Shigella boydii 3594-74] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|187732725|ref|YP_001879611.1| DNA cytosine methylase [Shigella boydii CDC 3083-94] gi|293446340|ref|ZP_06662762.1| DNA-cytosine methyltransferase [Escherichia coli B088] gi|187429717|gb|ACD08991.1| DNA-cytosine methyltransferase [Shigella boydii CDC 3083-94] gi|291323170|gb|EFE62598.1| DNA-cytosine methyltransferase [Escherichia coli B088] gi|320175451|gb|EFW50550.1| DNA-cytosine methyltransferase [Shigella dysenteriae CDC 74-1112] gi|320184499|gb|EFW59303.1| DNA-cytosine methyltransferase [Shigella flexneri CDC 796-83] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|315286667|gb|EFU46100.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 110-3] Length = 475 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 275 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 331 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 332 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 377 >gi|331663456|ref|ZP_08364366.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143] gi|331059255|gb|EGI31232.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|300923873|ref|ZP_07139889.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1] gi|300419870|gb|EFK03181.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1] Length = 477 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 334 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|300956520|ref|ZP_07168803.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1] gi|300316661|gb|EFJ66445.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1] Length = 477 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 334 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|293410317|ref|ZP_06653893.1| conserved hypothetical protein [Escherichia coli B354] gi|291470785|gb|EFF13269.1| conserved hypothetical protein [Escherichia coli B354] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|170019707|ref|YP_001724661.1| DNA cytosine methylase [Escherichia coli ATCC 8739] gi|169754635|gb|ACA77334.1| DNA-cytosine methyltransferase [Escherichia coli ATCC 8739] gi|323940380|gb|EGB36571.1| DNA-cytosine methyltransferase [Escherichia coli E482] gi|332093084|gb|EGI98148.1| DNA-cytosine methyltransferase [Shigella boydii 5216-82] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|191169235|ref|ZP_03030988.1| DNA-cytosine methyltransferase [Escherichia coli B7A] gi|190900713|gb|EDV60509.1| DNA-cytosine methyltransferase [Escherichia coli B7A] Length = 472 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|315296465|gb|EFU55762.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 16-3] Length = 476 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 276 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378 >gi|300994233|ref|ZP_07180788.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1] gi|300304943|gb|EFJ59463.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1] Length = 477 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 334 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|324018843|gb|EGB88062.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 117-3] Length = 472 Score = 59.3 bits (142), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|300951590|ref|ZP_07165422.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1] gi|300449174|gb|EFK12794.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1] Length = 478 Score = 59.3 bits (142), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 278 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 334 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 335 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 380 >gi|218705454|ref|YP_002412973.1| DNA cytosine methylase [Escherichia coli UMN026] gi|293405443|ref|ZP_06649435.1| DNA cytosine methylase [Escherichia coli FVEC1412] gi|298381087|ref|ZP_06990686.1| DNA cytosine methylase [Escherichia coli FVEC1302] gi|218432551|emb|CAR13444.1| DNA cytosine methylase [Escherichia coli UMN026] gi|291427651|gb|EFF00678.1| DNA cytosine methylase [Escherichia coli FVEC1412] gi|298278529|gb|EFI20043.1| DNA cytosine methylase [Escherichia coli FVEC1302] Length = 472 Score = 59.3 bits (142), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|238919389|ref|YP_002932904.1| DNA cytosine methylase [Edwardsiella ictaluri 93-146] gi|238868958|gb|ACR68669.1| modification methylase [Edwardsiella ictaluri 93-146] Length = 471 Score = 59.3 bits (142), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 39/103 (37%), Positives = 53/103 (51%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F KP G++LE +D K +S KLWE Sbjct: 279 LPQHRERIVLVGFRRDLNIHHDFTLQKIQQFYPEKKPTFGELLEPAVDSKYILSPKLWEY 338 Query: 61 HQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 + + G GFG+GL + TLSARY+KDGSEI Sbjct: 339 LYNYAKKHAEKGNGFGFGLVDPKNKESIARTLSARYHKDGSEI 381 >gi|206577074|ref|YP_002237693.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342] gi|206566132|gb|ACI07908.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342] Length = 477 Score = 59.3 bits (142), Expect = 1e-07, Method: Composition-based stats. Identities = 35/103 (33%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF-----LNPSVEFKFPTPL--GIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F L+ + L ++P G++LE +D K ++ LW+ Sbjct: 277 LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTVDAKFILTPVLWKY 336 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + ++ G GFGYGL + + TLSARYYKDG+EI Sbjct: 337 LYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 379 >gi|193066646|ref|ZP_03047681.1| DNA-cytosine methyltransferase [Escherichia coli E22] gi|260844359|ref|YP_003222137.1| DNA cytosine methylase [Escherichia coli O103:H2 str. 12009] gi|192925721|gb|EDV80380.1| DNA-cytosine methyltransferase [Escherichia coli E22] gi|257759506|dbj|BAI31003.1| DNA cytosine methylase [Escherichia coli O103:H2 str. 12009] Length = 472 Score = 59.3 bits (142), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|330911766|gb|EGH40276.1| DNA-cytosine methyltransferase [Escherichia coli AA86] Length = 472 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|301050676|ref|ZP_07197538.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1] gi|300297633|gb|EFJ54018.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1] Length = 477 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 334 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|26248232|ref|NP_754272.1| DNA cytosine methylase [Escherichia coli CFT073] gi|227885611|ref|ZP_04003416.1| DNA cytosine methylase [Escherichia coli 83972] gi|237705920|ref|ZP_04536401.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA] gi|331647554|ref|ZP_08348646.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605] gi|26108636|gb|AAN80839.1|AE016762_92 DNA-cytosine methyltransferase [Escherichia coli CFT073] gi|226900677|gb|EEH86936.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA] gi|227837184|gb|EEJ47650.1| DNA cytosine methylase [Escherichia coli 83972] gi|281179022|dbj|BAI55352.1| DNA cytosine methylase [Escherichia coli SE15] gi|307553973|gb|ADN46748.1| DNA cytosine methylase [Escherichia coli ABU 83972] gi|320194327|gb|EFW68958.1| DNA-cytosine methyltransferase [Escherichia coli WV_060327] gi|323956356|gb|EGB52099.1| DNA-cytosine methyltransferase [Escherichia coli H263] gi|324005878|gb|EGB75097.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 57-2] gi|331043278|gb|EGI15416.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605] Length = 472 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|295098276|emb|CBK87366.1| DNA-methyltransferase (dcm) [Enterobacter cloacae subsp. cloacae NCTC 9394] Length = 477 Score = 59.3 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F + +P + D+LE +D K ++ LW+ Sbjct: 277 LPQHRERIVLVGFRRDLNLKGDFTLRDLPSLYPARRPTVADLLEPAVDAKFILTPVLWKY 336 Query: 61 HQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 + + ++ G GFG+G+ + T TLSARYYKDG+EI Sbjct: 337 LYRYAKKHQAKGNGFGFGMVNPLNPDSVTRTLSARYYKDGAEI 379 >gi|320182772|gb|EFW57655.1| DNA-cytosine methyltransferase [Shigella boydii ATCC 9905] Length = 472 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|24113334|ref|NP_707844.1| DNA cytosine methylase [Shigella flexneri 2a str. 301] gi|30063396|ref|NP_837567.1| DNA cytosine methylase [Shigella flexneri 2a str. 2457T] gi|110805927|ref|YP_689447.1| DNA cytosine methylase [Shigella flexneri 5 str. 8401] gi|24052347|gb|AAN43551.1| DNA cytosine methylase [Shigella flexneri 2a str. 301] gi|30041648|gb|AAP17376.1| DNA cytosine methylase [Shigella flexneri 2a str. 2457T] gi|110615475|gb|ABF04142.1| DNA cytosine methylase [Shigella flexneri 5 str. 8401] gi|281601397|gb|ADA74381.1| Cytosine-specific methyltransferase [Shigella flexneri 2002017] gi|313650184|gb|EFS14597.1| DNA-cytosine methyltransferase [Shigella flexneri 2a str. 2457T] gi|332756118|gb|EGJ86471.1| DNA-cytosine methyltransferase [Shigella flexneri 4343-70] gi|332757312|gb|EGJ87649.1| DNA-cytosine methyltransferase [Shigella flexneri 2747-71] gi|332757528|gb|EGJ87863.1| DNA-cytosine methyltransferase [Shigella flexneri K-671] gi|332766700|gb|EGJ96904.1| cytosine-specific methyltransferase [Shigella flexneri 2930-71] gi|333003060|gb|EGK22614.1| DNA-cytosine methyltransferase [Shigella flexneri VA-6] gi|333003307|gb|EGK22853.1| DNA-cytosine methyltransferase [Shigella flexneri K-218] gi|333004068|gb|EGK23602.1| DNA-cytosine methyltransferase [Shigella flexneri K-272] gi|333017687|gb|EGK36999.1| DNA-cytosine methyltransferase [Shigella flexneri K-304] gi|333017841|gb|EGK37148.1| DNA-cytosine methyltransferase [Shigella flexneri K-227] Length = 472 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|238895488|ref|YP_002920223.1| DNA cytosine methylase [Klebsiella pneumoniae NTUH-K2044] gi|330000908|ref|ZP_08303852.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. MS 92-3] gi|238547805|dbj|BAH64156.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] gi|328537840|gb|EGF64032.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. MS 92-3] Length = 477 Score = 59.3 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDFLNP----------SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F + ++P ++P G++LE +D K ++ L Sbjct: 277 LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYP---AVRPTFGELLEPTVDAKFILTPVL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 W+ + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 334 WKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379 >gi|194430436|ref|ZP_03062919.1| DNA-cytosine methyltransferase [Escherichia coli B171] gi|194411515|gb|EDX27854.1| DNA-cytosine methyltransferase [Escherichia coli B171] Length = 472 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQCVTRTLSARYYKDGAEI 374 >gi|320331203|gb|EFW87160.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea str. race 4] gi|330882725|gb|EGH16874.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea str. race 4] Length = 420 Score = 59.3 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 41/118 (34%), Positives = 56/118 (47%), Gaps = 29/118 (24%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEH------------------ 46 PQ RER+ I+ F + + + PT PRL IL + Sbjct: 228 PQHRERIIIVGFREKTGFSWDDLRLPTD---GPRLASILHKTDGTERVLPWDEDRFFDHK 284 Query: 47 ---IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+G+ F +S T TLSARY+KDGSEI Sbjct: 285 KRVVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGMAFPDS-VTRTLSARYHKDGSEI 341 >gi|306814216|ref|ZP_07448382.1| DNA cytosine methylase [Escherichia coli NC101] gi|305852375|gb|EFM52826.1| DNA cytosine methylase [Escherichia coli NC101] Length = 472 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F P L +L+ ++ K ++ LW+ Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISACFPAQRVTLAQLLDPIVEAKYILTPVLWKY 331 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|323222338|gb|EGA06720.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] Length = 259 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F +P L ++LE ++ K ++ LW+ Sbjct: 59 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 118 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 119 LYRYAKKHQARGNGFGYGMVYPDNPGSVARTLSARYYKDGAEI 161 >gi|323191533|gb|EFZ76794.1| modification methylase EcoRII [Escherichia coli RN587/1] Length = 474 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 11/104 (10%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPT-----PLGIKPRLGDILEEHIDDKSTISNKLWE 59 +PQ RER+ ++ F LN +F P +P G++L+ ++DDK ++ +LWE Sbjct: 281 LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQN-RPTFGELLDHNVDDKYILTPRLWE 339 Query: 60 GHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 340 YLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383 >gi|169786848|ref|YP_001700742.1| modification methylase (cytosine-specific methyltransferase)(HpaIIM-like) [Acinetobacter baumannii SDF] gi|169150765|emb|CAP02959.1| modification methylase (Cytosine-specific methyltransferase)(HpaIIM-like) [Acinetobacter baumannii] Length = 366 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 32/87 (36%), Positives = 53/87 (60%), Gaps = 3/87 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F + +F++PTP G K D+ EE+ + K +SN+ Sbjct: 186 INAKDFGVPQNRERIFIVGFHKDTGVHDFEYPTPTGKKVCFADVKEENVVPTKYYLSNQY 245 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS 84 + ++ K +++ G GFGY + +NS Sbjct: 246 LQTLERHKAHHESKGNGFGYAIIPDNS 272 >gi|161505003|ref|YP_001572115.1| DNA cytosine methylase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|160866350|gb|ABX22973.1| hypothetical protein SARI_03133 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 474 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 38/103 (36%), Positives = 53/103 (51%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN F +P G +L+ +D K +S KLWE Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLKNIHKFYPEKRPTFGQLLDPAVDSKYILSPKLWEY 340 Query: 61 HQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 341 LYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383 >gi|331645413|ref|ZP_08346517.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli M605] gi|331045575|gb|EGI17701.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli M605] Length = 474 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 11/104 (10%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPT-----PLGIKPRLGDILEEHIDDKSTISNKLWE 59 +PQ RER+ ++ F LN +F P +P G++L+ ++DDK ++ +LWE Sbjct: 281 LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQN-RPTFGELLDHNVDDKYILTPRLWE 339 Query: 60 GHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 340 YLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383 >gi|213853126|ref|ZP_03382658.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. M223] Length = 219 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F +P L ++LE ++ K ++ LW+ Sbjct: 19 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 78 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 79 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 121 >gi|323158561|gb|EFZ44575.1| DNA-cytosine methyltransferase [Escherichia coli E128010] Length = 472 Score = 58.9 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVMLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQCVTRTLSARYYKDGAEI 374 >gi|300724477|ref|YP_003713798.1| DNA cytosine methylase [Xenorhabdus nematophila ATCC 19061] gi|297631015|emb|CBJ91699.1| DNA cytosine methylase [Xenorhabdus nematophila ATCC 19061] Length = 476 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F FP +P L ++L+ ++D K ++ L Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRNMNQLFPAQ---RPTLKELLDSNVDKKYILTPAL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 W+ + ++ G GFG+GL F + ++ TLSARY+KDGSEI Sbjct: 338 WKYLYNYAKKHQAKGNGFGFGLVFPDNPNSVARTLSARYHKDGSEI 383 >gi|213650730|ref|ZP_03380783.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. J185] Length = 405 Score = 58.9 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 205 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 261 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 262 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 307 >gi|157147667|ref|YP_001454986.1| DNA cytosine methylase [Citrobacter koseri ATCC BAA-895] gi|157084872|gb|ABV14550.1| hypothetical protein CKO_03470 [Citrobacter koseri ATCC BAA-895] Length = 474 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 38/103 (36%), Positives = 53/103 (51%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN F +P G +L+ +D K +S KLWE Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLKNIHKFYPEKRPTFGQLLDPAVDSKYILSPKLWEY 340 Query: 61 HQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 341 LYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383 >gi|149184876|ref|ZP_01863193.1| hypothetical protein ED21_17522 [Erythrobacter sp. SD-21] gi|148830987|gb|EDL49421.1| hypothetical protein ED21_17522 [Erythrobacter sp. SD-21] Length = 410 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 41/113 (36%), Positives = 55/113 (48%), Gaps = 20/113 (17%) Query: 8 VPQRRERLYIIDFLNPS----VEFKFPTPLGIKPRL-------GDILEEH--------ID 48 +PQ RER+ ++ F S + K P + R +I E H + Sbjct: 222 LPQNRERIVLVGFREKSGFDWADLKLPVEGEARMRSVLHPENGSEIAESHYTEGELATVS 281 Query: 49 DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 K T+SN LW+ + ++ AG GFGYGL + T TLSARYYKDGSEI Sbjct: 282 AKYTLSNHLWKYLRDYSAKHRAAGNGFGYGLVGPDD-TCRTLSARYYKDGSEI 333 >gi|331658007|ref|ZP_08358969.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206] gi|331056255|gb|EGI28264.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206] Length = 472 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPIVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|327394286|dbj|BAK11708.1| modification methylase EcoRII [Pantoea ananatis AJ13355] Length = 459 Score = 58.9 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 40/108 (37%), Positives = 55/108 (50%), Gaps = 15/108 (13%) Query: 6 FGVPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISN 55 F +PQ RER+ ++ + S +F FP + P L +LE DDK +S Sbjct: 270 FFLPQHRERIVLVGIRRDIAGSAQFSLRDIRQFFPAQV---PSLQSLLEPQPDDKYILSP 326 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW + + +K G GFG+GL ++ TLSARYYKDGSEI Sbjct: 327 VLWRYLYQYAKKHKARGNGFGFGLNDPHNVHCCVRTLSARYYKDGSEI 374 >gi|213622824|ref|ZP_03375607.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] Length = 324 Score = 58.9 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F +P +P L ++LE ++ K ++ L Sbjct: 124 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 180 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 181 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 226 >gi|189423370|ref|YP_001950547.1| DNA-cytosine methyltransferase [Geobacter lovleyi SZ] gi|189419629|gb|ACD94027.1| DNA-cytosine methyltransferase [Geobacter lovleyi SZ] Length = 415 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 43/113 (38%), Positives = 55/113 (48%), Gaps = 21/113 (18%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIK--PRLGDIL-----------------EEHID 48 VPQ RER+ I+ F F F + K P+L IL + + Sbjct: 226 VPQHRERIIIVGF-REKTGFSFDSLQLPKEGPKLFSILHPEDGTEQEETPFTVGDKAKVH 284 Query: 49 DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +K ++N LW Q +K AG GFG+GL +N T TLSARYYKDGSEI Sbjct: 285 EKYILTNNLWSYLQAYAAKHKAAGNGFGFGLVGKND-TARTLSARYYKDGSEI 336 >gi|291617874|ref|YP_003520616.1| EcoRIIM [Pantoea ananatis LMG 20103] gi|291152904|gb|ADD77488.1| EcoRIIM [Pantoea ananatis LMG 20103] Length = 459 Score = 58.5 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 40/108 (37%), Positives = 55/108 (50%), Gaps = 15/108 (13%) Query: 6 FGVPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISN 55 F +PQ RER+ ++ + S +F FP + P L +LE DDK +S Sbjct: 270 FFLPQHRERIVLVGIRRDIAGSAQFSLRDIRQFFPAQV---PSLQSLLEPQPDDKYILSP 326 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW + + +K G GFG+GL ++ TLSARYYKDGSEI Sbjct: 327 VLWRYLYQYAKKHKARGNGFGFGLNDPHNVHCCVRTLSARYYKDGSEI 374 >gi|217980150|ref|YP_002364200.1| DNA-cytosine methyltransferase [Thauera sp. MZ1T] gi|217508321|gb|ACK55106.1| DNA-cytosine methyltransferase [Thauera sp. MZ1T] Length = 419 Score = 58.5 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 26/119 (21%) Query: 8 VPQRRERLYIIDFLNPS-VEFKFPT-----------------PLGIKPRL---GDILEEH 46 VPQ RER+ I+ F N + F + G +P L GD +H Sbjct: 223 VPQHRERILIVGFRNEDGIRFDWDAVGLPQKGVHVMRDILHRTDGTEPVLPWDGDRFFDH 282 Query: 47 ----IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + DK T++ KLW Q + ++ G GFG+GL S TLSARYYKDGSEI Sbjct: 283 AGRRVQDKYTLTPKLWRYLQDYADKHRAKGNGFGFGLVHPGS-VARTLSARYYKDGSEI 340 >gi|331677842|ref|ZP_08378517.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591] gi|331074302|gb|EGI45622.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591] Length = 320 Score = 58.5 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 120 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 176 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 177 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 222 >gi|161617789|ref|YP_001591754.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|161367153|gb|ABX70921.1| hypothetical protein SPAB_05653 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] Length = 474 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G +L+ +D K +S KL Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLKNIDKFYPEK---RPTFGQLLDSVVDSKYILSPKL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383 >gi|331671799|ref|ZP_08372595.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli TA280] gi|331070788|gb|EGI42147.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli TA280] Length = 474 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 11/104 (10%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPT-----PLGIKPRLGDILEEHIDDKSTISNKLWE 59 +PQ RER+ ++ F LN +F P +P G++L+ +DDK ++ +LWE Sbjct: 281 LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQN-RPTFGELLDHDVDDKYILTPRLWE 339 Query: 60 GHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 340 YLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383 >gi|168234623|ref|ZP_02659681.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|194736513|ref|YP_002117411.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|194712015|gb|ACF91236.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197291717|gb|EDY31067.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] Length = 474 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G +L+ +D K +S KL Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLKNIDKFYPEK---RPTFGQLLDSVVDSKYILSPKL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383 >gi|157145245|ref|YP_001452564.1| DNA cytosine methylase [Citrobacter koseri ATCC BAA-895] gi|157082450|gb|ABV12128.1| hypothetical protein CKO_00981 [Citrobacter koseri ATCC BAA-895] Length = 477 Score = 58.5 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F P+ L ++LE ++ + ++ LW+ Sbjct: 277 LPQHRERIVLVGFRRDLNLKTDFTLRDIATRYPQQRITLAELLEPAVEARYVLTPVLWKY 336 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + + + T TLSARYYKDG+EI Sbjct: 337 LYRYAKKHQARGNGFGYGMVYPANPGSVTRTLSARYYKDGAEI 379 >gi|327254549|gb|EGE66165.1| modification methylase EcoRII [Escherichia coli STEC_7v] Length = 474 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 11/104 (10%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPT-----PLGIKPRLGDILEEHIDDKSTISNKLWE 59 +PQ RER+ ++ F LN +F P +P G++L+ +DDK ++ +LWE Sbjct: 281 LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQN-RPTFGELLDHDVDDKYILTPRLWE 339 Query: 60 GHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 340 YLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383 >gi|310767946|gb|ADP12896.1| DNA cytosine methylase [Erwinia sp. Ejp617] Length = 467 Score = 58.5 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 18/107 (16%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPT----------PLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F + K P PL P L +L+ H++ K ++ L Sbjct: 278 LPQHRERIILVGFRR---DLKLPAFSLSALPALYPLQRTP-LKALLDSHVEAKYILTPTL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGL---FFENSATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYGL EN TLSARYYKDGSEI Sbjct: 334 WKYLYQYAKKHQARGNGFGYGLVDPVLEN-GVVRTLSARYYKDGSEI 379 >gi|259908144|ref|YP_002648500.1| DNA cytosine methylase [Erwinia pyrifoliae Ep1/96] gi|224963766|emb|CAX55267.1| DNA-cytosine methyltransferase [Erwinia pyrifoliae Ep1/96] gi|283478063|emb|CAY73979.1| DNA cytosine methylase [Erwinia pyrifoliae DSM 12163] Length = 467 Score = 58.2 bits (139), Expect = 3e-07, Method: Composition-based stats. Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 18/107 (16%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPT----------PLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F + K P PL P L +L+ H++ K ++ L Sbjct: 278 LPQHRERIILVGFRR---DLKLPAFSLSALPALYPLQRTP-LKALLDSHVEAKYILTPTL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLF---FENSATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYGL EN TLSARYYKDGSEI Sbjct: 334 WKYLYQYAKKHQARGNGFGYGLVDPALEN-GVVRTLSARYYKDGSEI 379 >gi|296159065|ref|ZP_06841892.1| DNA-cytosine methyltransferase [Burkholderia sp. Ch1-1] gi|295890626|gb|EFG70417.1| DNA-cytosine methyltransferase [Burkholderia sp. Ch1-1] Length = 426 Score = 58.2 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 40/118 (33%), Positives = 54/118 (45%), Gaps = 29/118 (24%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45 PQ RER+ I+ F + + P PRLG IL Sbjct: 232 PQHRERIIIVGFRGETSFSWDDLHLPEN---GPRLGSILHRTDGSEPVLPWDHDRFFDHT 288 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+G+ + +S T TLSARY+KDGSEI Sbjct: 289 SRRVQPKYTLTPNLWTYLQNYAEKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 345 >gi|170691874|ref|ZP_02883038.1| DNA-cytosine methyltransferase [Burkholderia graminis C4D1M] gi|170143158|gb|EDT11322.1| DNA-cytosine methyltransferase [Burkholderia graminis C4D1M] Length = 438 Score = 58.2 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 42/117 (35%), Positives = 54/117 (46%), Gaps = 27/117 (23%) Query: 9 PQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDIL---------------------E 44 PQ RER+ II F EF F P PRL IL + Sbjct: 245 PQHRERIVIIGF-RSDTEFSFDDLRLP-ATGPRLASILHKTDGSEPLLPHDGERFFDHVQ 302 Query: 45 EHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q + ++ AG GFG+GL ++ T TLSARY+KDGSEI Sbjct: 303 RKVQPKYTLTPNLWAYLQAYADKHRAAGNGFGFGL-VTPASVTRTLSARYHKDGSEI 358 >gi|294979850|pdb|3ME5|A Chain A, Crystal Structure Of Putative Dna Cytosine Methylase From Shigella Flexneri 2a Str. 301 Length = 482 Score = 57.8 bits (138), Expect = 4e-07, Method: Composition-based stats. Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 274 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPXVEAKYILTPVL 330 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG + N+ + T TLSARYYKDG+EI Sbjct: 331 WKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 376 >gi|290508755|ref|ZP_06548126.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. 1_1_55] gi|289778149|gb|EFD86146.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. 1_1_55] Length = 477 Score = 57.8 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 35/103 (33%), Positives = 54/103 (52%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF-----LNPSVEFKFPTPL--GIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F L+ + L ++P G++LE D K ++ LW+ Sbjct: 277 LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTADAKFILTPVLWKY 336 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + ++ G GFGYGL + + TLSARYYKDG+EI Sbjct: 337 LYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 379 >gi|194433657|ref|ZP_03065933.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1012] gi|194418086|gb|EDX34179.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1012] gi|332095525|gb|EGJ00541.1| DNA-cytosine methyltransferase [Shigella dysenteriae 155-74] Length = 472 Score = 57.8 bits (138), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F N +F FP + L +L+ ++ K ++ L Sbjct: 272 LPQHRERIVLVGFRRDFNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|331673470|ref|ZP_08374238.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280] gi|331069668|gb|EGI41055.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280] Length = 472 Score = 57.8 bits (138), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKF----PTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F + L +L+ ++ K ++ LW+ Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFSAQRVTLAQLLDPMVEAKYILTPVLWKY 331 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + N+ + T TLSARYYKDG+EI Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|238787820|ref|ZP_04631617.1| Modification methylase EcoRII [Yersinia frederiksenii ATCC 33641] gi|238724163|gb|EEQ15806.1| Modification methylase EcoRII [Yersinia frederiksenii ATCC 33641] Length = 475 Score = 57.8 bits (138), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 37/106 (34%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP +P G++LE + DK ++ L Sbjct: 281 LPQHRERIVLVGFRKDLNIDKDFTLKDINKFFPEK---RPEFGELLESVVADKYILTPHL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 W+ + ++ G GFG+GL + + TLSARY+KDGSEI Sbjct: 338 WKYLYNYAKKHQAKGNGFGFGLVDPTNSESVARTLSARYHKDGSEI 383 >gi|315498495|ref|YP_004087299.1| transcriptional regulator, xre family [Asticcacaulis excentricus CB 48] gi|315416507|gb|ADU13148.1| transcriptional regulator, XRE family [Asticcacaulis excentricus CB 48] Length = 410 Score = 57.8 bits (138), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 40/113 (35%), Positives = 53/113 (46%), Gaps = 20/113 (17%) Query: 8 VPQRRERLYIIDF------------LNPSVEFKFPTPLG-------IKPRLGDILEEHID 48 VPQ RER+ I+ F L P K + L +P + + Sbjct: 224 VPQHRERIVIVGFREDVPFSWDDLNLPPKGSVKLSSILHPENAIEEAEPPYTTGIRAEVA 283 Query: 49 DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 K T+++KLW Q + +K AG GFG+GL + TLSARYYKDGSEI Sbjct: 284 SKYTLTDKLWAYLQNYADKHKAAGNGFGFGLVGPGD-VSRTLSARYYKDGSEI 335 >gi|156933419|ref|YP_001437335.1| DNA cytosine methylase [Cronobacter sakazakii ATCC BAA-894] gi|156531673|gb|ABU76499.1| hypothetical protein ESA_01237 [Cronobacter sakazakii ATCC BAA-894] Length = 481 Score = 57.8 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 17/107 (15%) Query: 8 VPQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 +PQ RER+ ++ F L EF +P +P G++L+ +D + ++ Sbjct: 283 LPQHRERIVLVGFRRSLNLHDGFTLRALPEF-YPAR---RPAFGELLDPTVDARYVLTPT 338 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFF-ENSAT-TNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYGL +N A+ TLSARYYKDG+EI Sbjct: 339 LWKYLYRYAQKHQAKGNGFGYGLVDPQNPASVARTLSARYYKDGAEI 385 >gi|291463698|pdb|3LX6|A Chain A, Structure Of Probable Cytosine-Specific Methyltransferase From Shigella Flexneri gi|291463699|pdb|3LX6|B Chain B, Structure Of Probable Cytosine-Specific Methyltransferase From Shigella Flexneri Length = 410 Score = 57.4 bits (137), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP + L +L+ ++ K ++ L Sbjct: 212 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPXVEAKYILTPVL 268 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG + N+ + T TLSARYYKDG+EI Sbjct: 269 WKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 314 >gi|300717257|ref|YP_003742060.1| cytosine-specific methyltransferase [Erwinia billingiae Eb661] gi|299063093|emb|CAX60213.1| Cytosine-specific methyltransferase [Erwinia billingiae Eb661] Length = 466 Score = 57.4 bits (137), Expect = 6e-07, Method: Composition-based stats. Identities = 38/102 (37%), Positives = 52/102 (50%), Gaps = 8/102 (7%) Query: 8 VPQRRERLYII----DFLNPSVEFKFPTPLGIKPR--LGDILEEHIDDKSTISNKLWEGH 61 +PQ RER+ ++ D P K + L K R L ++E +D K ++ LW+ Sbjct: 278 LPQHRERIVLVGMRRDLKLPEFTLKALSTLYPKQRIPLRALMEPEVDSKYILTPTLWKYL 337 Query: 62 QKRKENNKIAGKGFGYGLFFENSAT--TNTLSARYYKDGSEI 101 + ++ G GFGYGL T TLSARYYKDGSEI Sbjct: 338 YNYAKKHQAKGNGFGYGLVDPQVETGVVRTLSARYYKDGSEI 379 >gi|304398880|ref|ZP_07380750.1| DNA-cytosine methyltransferase [Pantoea sp. aB] gi|304353584|gb|EFM17961.1| DNA-cytosine methyltransferase [Pantoea sp. aB] Length = 458 Score = 57.4 bits (137), Expect = 6e-07, Method: Composition-based stats. Identities = 38/105 (36%), Positives = 53/105 (50%), Gaps = 14/105 (13%) Query: 8 VPQRRERLYII---------DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 +PQ RER+ ++ DF + +P + P L +LE DDK +S LW Sbjct: 272 LPQHRERIVLVGIRRDLKKQDFTLRDIRRFYPAQV---PSLQSLLERAPDDKYILSPVLW 328 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + +K G GFG+GL ++ TLSARYYKDGSEI Sbjct: 329 RYLYQYAKKHKAKGNGFGFGLNDPHNPDCCVRTLSARYYKDGSEI 373 >gi|262043463|ref|ZP_06016586.1| DNA (cytosine-5-)-methyltransferase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|259039205|gb|EEW40353.1| DNA (cytosine-5-)-methyltransferase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 477 Score = 57.4 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDFLNP----------SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F + ++P + P G++LE +D K ++ L Sbjct: 277 LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYP---AVWPTFGELLEPTVDAKFILTPVL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101 W+ + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 334 WKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379 >gi|260598469|ref|YP_003211040.1| DNA cytosine methylase [Cronobacter turicensis z3032] gi|260217646|emb|CBA31957.1| DNA-cytosine methyltransferase [Cronobacter turicensis z3032] Length = 450 Score = 57.4 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++L+ +D + ++ L Sbjct: 252 LPQHRERIVLVGFRRDLNLHDGFTLRALPELYPAR---RPAFGELLDPTVDARYVLTPTL 308 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-ENSAT-TNTLSARYYKDGSEI 101 W+ + + ++ G GFGYGL +N A+ TLSARYYKDG+EI Sbjct: 309 WKYLYRYAQKHQAKGNGFGYGLVDPQNPASVARTLSARYYKDGAEI 354 >gi|133756232|ref|YP_001096382.1| DNA cytosine methylase [Escherichia coli] gi|110084067|gb|ABG49221.1| hypothetical protein [Escherichia coli] Length = 566 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 370 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 426 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 427 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 472 >gi|330960632|gb|EGH60892.1| DNA cytosine methylase [Pseudomonas syringae pv. maculicola str. ES4326] Length = 178 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Query: 36 KPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95 +P GD+L++ +D K ++ LW+ + E ++ G GFG+GL N TLSARY+ Sbjct: 18 RPSFGDLLDKEVDSKYILTPNLWDYLYRYAEKHRQKGNGFGFGLTRPND-IARTLSARYH 76 Query: 96 KDGSEI 101 KDGSEI Sbjct: 77 KDGSEI 82 >gi|165938005|ref|ZP_02226565.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Yersinia pestis biovar Orientalis str. IP275] gi|165914028|gb|EDR32645.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Yersinia pestis biovar Orientalis str. IP275] Length = 282 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 86 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 142 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 143 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 188 >gi|160431610|ref|YP_001551777.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Dublin] gi|298206539|ref|YP_003717476.1| EcoRII modification enzyme [Escherichia coli] gi|159885479|dbj|BAF93082.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Dublin] gi|296537944|gb|ADH29964.1| EcoRII modification enzyme [Escherichia coli O25b:H4 str. EC958] Length = 477 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383 >gi|134044844|ref|YP_001102126.1| cytosine-specific methyltransferase [Yersinia pestis biovar Orientalis str. IP275] gi|133905378|gb|ABO42140.1| cytosine-specific methyltransferase [Yersinia pestis biovar Orientalis str. IP275] Length = 274 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 78 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 134 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 135 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 180 >gi|296538000|gb|ADH30019.1| EcoRII cytosine methylase [Escherichia coli O25b:H4 str. EC958] Length = 477 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383 >gi|118614638|ref|YP_908421.1| DNA methyltrasferase [Photobacterium damselae subsp. piscicida] gi|118596729|dbj|BAF38033.1| DNA methyltrasferase [Photobacterium damselae subsp. piscicida] Length = 266 Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 70 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 126 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 127 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 172 >gi|327198092|ref|YP_004306459.1| gp47 [Burkholderia phage KL3] gi|310657226|gb|ADP02340.1| gp47 [Burkholderia phage KL3] Length = 422 Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 39/119 (32%), Positives = 55/119 (46%), Gaps = 29/119 (24%) Query: 8 VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------ 45 PQ RER+ I+ F + + + P PRL IL + Sbjct: 228 TPQHRERIVIVGFRKKTGFSWDDLRLPAD---GPRLASILHKTDGSEPVLPWDGERFFDH 284 Query: 46 ---HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+G+ + +S T TLSARY+KDGSEI Sbjct: 285 EKRKVQSKYTLTPNLWTYLQAYAEKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 342 >gi|308187315|ref|YP_003931446.1| DNA cytosine methylase [Pantoea vagans C9-1] gi|308057825|gb|ADO09997.1| DNA cytosine methylase [Pantoea vagans C9-1] Length = 458 Score = 57.0 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 38/105 (36%), Positives = 53/105 (50%), Gaps = 14/105 (13%) Query: 8 VPQRRERLYII---------DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 +PQ RER+ ++ DF + +P + P L +LE+ DDK +S LW Sbjct: 272 LPQHRERIVLVGIRRDLKKQDFTLRDIRRFYPAQV---PSLQSLLEKAPDDKYILSPVLW 328 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + +K G GFG+GL + TLSARYYKDGSEI Sbjct: 329 RYLYQYAKKHKAKGNGFGFGLNDPRNPDCCVRTLSARYYKDGSEI 373 >gi|113706802|ref|YP_724464.1| DNA cytosine methylase [Escherichia coli] gi|190576899|ref|YP_001966231.1| M.EcoRII DNA methylase [Klebsiella pneumoniae] gi|194433606|ref|ZP_03065883.1| modification methylase EcoRII [Shigella dysenteriae 1012] gi|209901141|ref|YP_002286923.1| DNA cytosine methylase [Klebsiella pneumoniae] gi|209901236|ref|YP_002287017.1| DNA cytosine methylase [Klebsiella pneumoniae] gi|215528089|ref|YP_002332862.1| EcoRII cytosine methylase [Klebsiella pneumoniae] gi|302141639|ref|YP_003813098.1| EcoRII methylase [Klebsiella pneumoniae] gi|127448|sp|P05101|MTE2_ECOLX RecName: Full=Modification methylase EcoRII; Short=M.EcoRII; AltName: Full=Cytosine-specific methyltransferase EcoRII gi|41317|emb|CAA28725.1| unnamed protein product [Escherichia coli HB101] gi|109390538|gb|ABG33840.1| EcoRII modification enzyme [Escherichia coli] gi|110264483|gb|ABG56846.1| M.EcoRII DNA methylase [Klebsiella pneumoniae] gi|165928612|gb|ABY74380.1| EcoRII cytosine methylase [Klebsiella pneumoniae] gi|194418198|gb|EDX34290.1| modification methylase EcoRII [Shigella dysenteriae 1012] gi|197092209|gb|ACH42172.1| EcoRII cytosine methylase [Klebsiella pneumoniae] gi|209574187|gb|ACI63075.1| modification methylase [Klebsiella pneumoniae] gi|209574298|gb|ACI63184.1| modification methylase [Klebsiella pneumoniae] gi|296033904|gb|ADG84867.1| EcoRII methylase [Klebsiella pneumoniae] Length = 477 Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383 >gi|48093754|gb|AAT40239.1| Eco128I DNA methylase [Escherichia coli] Length = 332 Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 200 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 256 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 257 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 302 >gi|297622183|ref|YP_003675732.1| EcoRII cytosine-methyltransferase [Klebsiella oxytoca KOX105] gi|296492002|gb|ADH29504.1| EcoRII cytosine-methyltransferase [Klebsiella oxytoca KOX105] Length = 491 Score = 57.0 bits (136), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 295 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 351 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 352 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397 >gi|307729019|ref|YP_003906243.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1003] gi|307583554|gb|ADN56952.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1003] Length = 428 Score = 56.6 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 40/118 (33%), Positives = 54/118 (45%), Gaps = 29/118 (24%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45 PQ RER+ I+ F + + K P PRL IL + Sbjct: 235 PQHRERIVIVGFRQETGFSFDDLKLPAS---GPRLASILHKTDGSEPLLPHDGERFFDPV 291 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+GL ++ T TLSARY+KDGSEI Sbjct: 292 RRSVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGL-VTPASVTRTLSARYHKDGSEI 348 >gi|91782477|ref|YP_557683.1| C-5 cytosine-specific DNA methylase [Burkholderia xenovorans LB400] gi|91686431|gb|ABE29631.1| C-5 cytosine-specific DNA methylase [Burkholderia xenovorans LB400] Length = 418 Score = 56.6 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 41/117 (35%), Positives = 54/117 (46%), Gaps = 27/117 (23%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTPLGIK---PRLGDILEE-------------------- 45 PQ RER+ I+ F EF F L + PRL IL + Sbjct: 231 PQHRERIVIVGF-REETEFTFDD-LNVPAEGPRLASILHKTDGSEPVLAHDGDRFFDHAS 288 Query: 46 -HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + + T++ LW Q ++ AG GFG+GL +S T TLSARY+KDGSEI Sbjct: 289 REVQPRYTLTANLWAYLQAYAAKHRAAGNGFGFGLVTPDS-VTRTLSARYFKDGSEI 344 >gi|226807724|ref|YP_002791420.1| Dcm [Enterobacter cloacae] gi|226810038|ref|YP_002791733.1| Dcm [Enterobacter cloacae] gi|226425951|gb|ACO54044.1| Dcm [Enterobacter cloacae] gi|226426265|gb|ACO54357.1| Dcm [Enterobacter cloacae] Length = 489 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 17/106 (16%) Query: 9 PQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 PQ RER+ +I F L +F +P +P L D+L+ +D K +S KL Sbjct: 292 PQHRERIVLIGFRRDLRLKDGFTLRDIKDF-YPDK---RPSLSDLLDPSVDSKYILSPKL 347 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL + ++ T TLS+RY KDGSEI Sbjct: 348 WEYLYNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 393 >gi|323960520|gb|EGB56149.1| DNA-cytosine methyltransferase [Escherichia coli H489] Length = 477 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 281 LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEH---RPSFGELLEPVVDSKYILTPKL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383 >gi|157412142|ref|YP_001481483.1| DNA cytosine methylase [Escherichia coli APEC O1] gi|99867167|gb|ABF67812.1| cytosine methylase [Escherichia coli APEC O1] Length = 489 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 17/106 (16%) Query: 9 PQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 PQ RER+ +I F L +F +P +P L D+L+ +D K +S KL Sbjct: 292 PQHRERIVLIGFRRDLRLKDGFTLRDIKDF-YPDK---RPSLSDLLDPSVDSKYILSPKL 347 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL + ++ T TLS+RY KDGSEI Sbjct: 348 WEYLYNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 393 >gi|331643338|ref|ZP_08344469.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli H736] gi|331036809|gb|EGI09033.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli H736] Length = 491 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 295 LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEH---RPSFGELLEPVVDSKYILTPKL 351 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 352 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397 >gi|218701133|ref|YP_002408762.1| DNA cytosine methylase [Escherichia coli IAI39] gi|218371119|emb|CAR18947.1| Modification methylase EcoRII (M.EcoRII) (Cytosine-specific methyltransferase EcoRII) [Escherichia coli IAI39] Length = 491 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 295 LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEH---RPSFGELLEPVVDSKYILTPKL 351 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 352 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397 >gi|307139342|ref|ZP_07498698.1| DNA cytosine methylase [Escherichia coli H736] Length = 477 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN F +P +P G++LE +D K ++ KL Sbjct: 281 LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEH---RPSFGELLEPVVDSKYILTPKL 337 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL EN + TLSARY+KDGSEI Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383 >gi|121997219|ref|YP_001002006.1| DNA-cytosine methyltransferase [Halorhodospira halophila SL1] gi|121588624|gb|ABM61204.1| DNA-cytosine methyltransferase [Halorhodospira halophila SL1] Length = 436 Score = 56.6 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 40/113 (35%), Positives = 53/113 (46%), Gaps = 20/113 (17%) Query: 8 VPQRRERLYIIDFLNPSV----EFKFPTPLG------IKPRLGDILEE---------HID 48 VPQ RER+Y++ F + + FP P + P G E + Sbjct: 241 VPQHRERIYMVGFRKDTPFTWNQLDFPAPDARTLREVLHPEDGSEAAEPPYTEGDLATVG 300 Query: 49 DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 DK +S KLW+ Q + ++ AG GFGY T TLSARY+KDGSEI Sbjct: 301 DKYVLSEKLWKYLQDYRAKHEHAGNGFGYSKVGPED-TARTLSARYHKDGSEI 352 >gi|38347986|ref|NP_941235.1| DNA cytosine methylase [Serratia marcescens] gi|190410308|ref|YP_001965811.1| dcm [Klebsiella pneumoniae] gi|38259463|emb|CAE51691.1| DNA-cytosine methyltransferase [Serratia marcescens] gi|146151102|gb|ABQ02868.1| dcm [Klebsiella pneumoniae] Length = 475 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 17/106 (16%) Query: 9 PQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 PQ RER+ +I F L +F +P +P L D+L+ +D K +S KL Sbjct: 278 PQHRERIVLIGFRRDLRLKDGFTLRDIKDF-YPDK---RPSLSDLLDPSVDSKYILSPKL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL + ++ T TLS+RY KDGSEI Sbjct: 334 WEYLYNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 379 >gi|283785730|ref|YP_003365595.1| DNA-cytosine methyltransferase [Citrobacter rodentium ICC168] gi|282949184|emb|CBG88792.1| DNA-cytosine methyltransferase [Citrobacter rodentium ICC168] Length = 477 Score = 55.8 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEF-------KFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F ++P + L ++LE ++ K ++ L Sbjct: 277 LPQHRERIVLVGFRRDLNLKGDFTLRDISTRYPQR---RTTLAELLEPVVEAKYVLTPVL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF--ENSATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYG+ + ++ T TLSARYYKDG+EI Sbjct: 334 WKYLYRYAKKHQAKGNGFGYGMVSPSDPNSVTRTLSARYYKDGAEI 379 >gi|188533556|ref|YP_001907353.1| DNA cytosine methylase [Erwinia tasmaniensis Et1/99] gi|188028598|emb|CAO96460.1| DNA-cytosine methyltransferase [Erwinia tasmaniensis Et1/99] Length = 469 Score = 55.8 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 36/103 (34%), Positives = 53/103 (51%), Gaps = 10/103 (9%) Query: 8 VPQRRERLYIIDFLN----PSVEFKFPTPLGIKPR--LGDILEEHIDDKSTISNKLWEGH 61 +PQ RER+ ++ F P+ L + R L +L+ +++K ++ LW+ Sbjct: 280 LPQHRERIVLVGFRRDLQLPAFSLSLLPALYPRQRTPLNALLDSQVEEKYILTPTLWKYL 339 Query: 62 QKRKENNKIAGKGFGYGLF---FENSATTNTLSARYYKDGSEI 101 + ++ G GFGYGL EN TLSARYYKDGSEI Sbjct: 340 YHYAKKHQARGNGFGYGLVDPALEN-GVVRTLSARYYKDGSEI 381 >gi|225076313|ref|ZP_03719512.1| hypothetical protein NEIFLAOT_01354 [Neisseria flavescens NRL30031/H210] gi|224952437|gb|EEG33646.1| hypothetical protein NEIFLAOT_01354 [Neisseria flavescens NRL30031/H210] Length = 359 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 5/81 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILE-EHIDDKSTISNK 56 + A DFGVPQ RER++I+ F +P +F++P P+G+K DI E E + K +S Sbjct: 181 INAKDFGVPQNRERIFIVGF-HPDTKVNDFEYPKPIGLKTSFSDIREKETVPTKYYLSTV 239 Query: 57 LWEGHQKRKENNKIAGKGFGY 77 + +K KE ++ G GFGY Sbjct: 240 YIDTLRKHKERHEAKGNGFGY 260 >gi|146312197|ref|YP_001177271.1| DNA cytosine methylase [Enterobacter sp. 638] gi|145319073|gb|ABP61220.1| DNA-cytosine methyltransferase [Enterobacter sp. 638] Length = 471 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F LN +F + +P + ++LE D K ++ LW+ Sbjct: 271 LPQHRERIVLVGFRRDLNLKGDFTLRDIPSLYPAHRPSVAELLEPAFDAKFILTPVLWKY 330 Query: 61 HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 + + ++ G GFG+G+ + + T TLSARYYKDG+EI Sbjct: 331 LYRYAKKHQAKGNGFGFGMVDPRNPHSVTRTLSARYYKDGAEI 373 >gi|157368818|ref|YP_001476807.1| DNA cytosine methylase [Serratia proteamaculans 568] gi|157320582|gb|ABV39679.1| DNA-cytosine methyltransferase [Serratia proteamaculans 568] Length = 491 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 37/106 (34%), Positives = 55/106 (51%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F LN +F FP +P G++L E + K ++ L Sbjct: 297 LPQHRERIVLVGFRRDLNIHGDFSLKNLSQFFPKK---RPSFGELLLEDVAPKYILTEHL 353 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF--ENSATTNTLSARYYKDGSEI 101 W+ + ++ G GFG+GL S+ TLSARY+KDGSEI Sbjct: 354 WKYLYNYAKKHQAKGNGFGFGLVNPKNESSVARTLSARYHKDGSEI 399 >gi|149926993|ref|ZP_01915251.1| C-5 cytosine-specific DNA methylase [Limnobacter sp. MED105] gi|149824214|gb|EDM83434.1| C-5 cytosine-specific DNA methylase [Limnobacter sp. MED105] Length = 435 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 43/118 (36%), Positives = 54/118 (45%), Gaps = 26/118 (22%) Query: 8 VPQRRERLYIIDFLNPSVEFKF---PTPLGIKPRLGDILEE------------------- 45 PQ RER+ I F + V F + P P +L +IL + Sbjct: 244 TPQHRERILIAGFAD-QVAFDWDAIPLPPKGSRKLKEILHKTDGSEPYLPWDENRFFDHD 302 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + DK T++ LW Q +K G GFG+GL S TT TLSARYYKDGSEI Sbjct: 303 SKKVQDKYTLTPGLWTYLQNYAAKHKAKGNGFGFGLVGPES-TTRTLSARYYKDGSEI 359 >gi|323525262|ref|YP_004227415.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1001] gi|323382264|gb|ADX54355.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1001] Length = 428 Score = 55.5 bits (132), Expect = 2e-06, Method: Composition-based stats. Identities = 39/118 (33%), Positives = 54/118 (45%), Gaps = 29/118 (24%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45 PQ RER+ I+ F + + + P PRL IL + Sbjct: 235 PQHRERIVIVGFREETGFSFDDLRLPAN---GPRLASILHKTDGSEPLLPHDGERFFDHV 291 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+GL ++ T TLSARY+KDGSEI Sbjct: 292 RRKVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGL-VTPASVTRTLSARYHKDGSEI 348 >gi|169334482|ref|ZP_02861675.1| hypothetical protein ANASTE_00885 [Anaerofustis stercorihominis DSM 17244] gi|169259199|gb|EDS73165.1| hypothetical protein ANASTE_00885 [Anaerofustis stercorihominis DSM 17244] Length = 337 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 3/76 (3%) Query: 5 DFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWEGH 61 +FGVPQ RER+YI+ F N +F FPTP+ ++ DI+EE + K +S+ E Sbjct: 160 NFGVPQNRERIYIVAFRNDIAPKDFIFPTPIDENKKIKDIMEEKPVSPKYYLSDVYLETL 219 Query: 62 QKRKENNKIAGKGFGY 77 +K K ++ G GFGY Sbjct: 220 RKHKARHEAKGNGFGY 235 >gi|161502886|ref|YP_001569998.1| DNA cytosine methylase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|160864233|gb|ABX20856.1| hypothetical protein SARI_00944 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 476 Score = 55.1 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYII----------DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ DF ++ +P +P L ++LE ++ K ++ L Sbjct: 276 LPQHRERIVLVGVRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W+ + ++ G GFGYG+ + ++ + TLSARYYKDG+EI Sbjct: 333 WKYLYCYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|317048624|ref|YP_004116272.1| DNA-cytosine methyltransferase [Pantoea sp. At-9b] gi|316950241|gb|ADU69716.1| DNA-cytosine methyltransferase [Pantoea sp. At-9b] Length = 467 Score = 55.1 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 39/103 (37%), Positives = 51/103 (49%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDF-----LNPSVEFKFPTPLGIK--PRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ L+ + L K P L +LE D K T+S LW Sbjct: 277 LPQHRERIVLVGIRRDTRLSEGFTLRALAQLYPKKVPTLKSLLEPQPDAKYTLSPVLWNY 336 Query: 61 HQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 + + +K G GFG+GL S TLSARYYKDGSEI Sbjct: 337 LYQYAKKHKAKGNGFGFGLNDPRNPSVCVRTLSARYYKDGSEI 379 >gi|238898088|ref|YP_002923769.1| DNA cytosine methylase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gi|229465848|gb|ACQ67622.1| DNA cytosine methylase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] Length = 401 Score = 54.7 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 40/118 (33%), Positives = 55/118 (46%), Gaps = 29/118 (24%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDIL--------------EEHIDD- 49 PQ RER+ I+ F + + K P PRL IL E D Sbjct: 208 PQHRERIIIVGFREKTGFSWDDLKLPEE---GPRLASILHRTDGTEPVLPWDGERFFDHD 264 Query: 50 ------KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + T++ LW Q + ++ AG GFG+G+ + +S T TLSARY+KDGSEI Sbjct: 265 RRAVPLRYTLTPNLWAYLQAYADKHRAAGNGFGFGIVYPDS-VTRTLSARYHKDGSEI 321 >gi|7636053|emb|CAB88410.1| putative methyltransferase [Serratia marcescens] Length = 290 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 38/106 (35%), Positives = 54/106 (50%), Gaps = 17/106 (16%) Query: 9 PQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 PQ RER+ +I F L +F +P +P L D+L+ +D K +S L Sbjct: 93 PQHRERIVLIGFRRDLRLKDGFTLRDIKDF-YPDK---RPSLSDLLDPSVDSKYILSPXL 148 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 WE + + G GFG+GL + ++ T TLS+RY KDGSEI Sbjct: 149 WEYLYNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 194 >gi|254526757|ref|ZP_05138809.1| modification methylase EcoRII [Prochlorococcus marinus str. MIT 9202] gi|221538181|gb|EEE40634.1| modification methylase EcoRII [Prochlorococcus marinus str. MIT 9202] Length = 298 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 37/115 (32%), Positives = 57/115 (49%), Gaps = 23/115 (20%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPT----PLGIKPRLGDILE-----------------EH 46 VPQ R+R+YI+ F + F F + P L +L Sbjct: 105 VPQNRQRIYIVGFREEN-NFNFDDLIIPDISKGPTLSSVLHPEDGSENFEDPYTIPHLSK 163 Query: 47 IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +++K TI+NKLW+ + ++ ++ G GFG+GL + TLSARY+KDG+EI Sbjct: 164 VNEKYTITNKLWDYLKMYEKKHRAKGNGFGFGL-CKREDVARTLSARYHKDGAEI 217 >gi|213027601|ref|ZP_03342048.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] Length = 176 Score = 53.9 bits (128), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 2/68 (2%) Query: 36 KPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSAR 93 +P L ++LE ++ K ++ LW+ + + ++ G GFGYG+ + ++ + TLSAR Sbjct: 11 RPTLAELLEPVVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSAR 70 Query: 94 YYKDGSEI 101 YYKDG+EI Sbjct: 71 YYKDGAEI 78 >gi|213053049|ref|ZP_03345927.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] Length = 169 Score = 53.9 bits (128), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 2/68 (2%) Query: 36 KPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSAR 93 +P L ++LE ++ K ++ LW+ + + ++ G GFGYG+ + ++ + TLSAR Sbjct: 4 RPTLAELLEPVVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSAR 63 Query: 94 YYKDGSEI 101 YYKDG+EI Sbjct: 64 YYKDGAEI 71 >gi|281420730|ref|ZP_06251729.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205] gi|281405022|gb|EFB35702.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205] Length = 432 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + +CD+G+PQ RER++ + F P+ +FK+P P+ ++ ++ D LE++ID K + K Sbjct: 203 LNSCDYGIPQHRERVFCLGFKKPT-DFKYPAPIKLEYKMYDFLEDYIDTKYFLKEK 257 >gi|113971536|ref|YP_735329.1| DNA-cytosine methyltransferase [Shewanella sp. MR-4] gi|113886220|gb|ABI40272.1| DNA-cytosine methyltransferase [Shewanella sp. MR-4] Length = 417 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 39/100 (39%), Positives = 51/100 (51%), Gaps = 8/100 (8%) Query: 8 VPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDILEE---HIDDKSTISNKLWEG 60 V QRR R +++ D FKFP G L D LEE + ++ TIS++LWEG Sbjct: 254 VAQRRVRCFMVCVREDVFQEFGAFKFPEFEGEPIPLRDALEELTAELMEEYTISDRLWEG 313 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 H R + N G GF + N +NT+ ARY KDG E Sbjct: 314 HINRTQRNLDRGTGFTAHVADLNRP-SNTIVARYGKDGKE 352 >gi|54293106|ref|YP_125521.1| hypothetical protein lpl0145 [Legionella pneumophila str. Lens] gi|53752938|emb|CAH14374.1| hypothetical protein lpl0145 [Legionella pneumophila str. Lens] Length = 417 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 41/115 (35%), Positives = 54/115 (46%), Gaps = 24/115 (20%) Query: 8 VPQRRERLYIIDF------------LNPSVEFKFPTPLGIKPRLGDILEE---------H 46 VPQ RER++I+ F L P + L P G +EE Sbjct: 226 VPQHRERIFIVGFREDLPFSWNDLRLPPKNSVLLESIL--HPENGTEIEEKPYTFGEKAE 283 Query: 47 IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + T+S+KLW Q K+ + G GFG+GL E + TLSARY+KDGSEI Sbjct: 284 VSSCFTLSDKLWNYLQDYKKKHSEKGNGFGFGLVSEKN-IARTLSARYHKDGSEI 337 >gi|16923911|gb|AAL31632.1|AF438204_2 C5 DNA methyltransferase [Positive selection vector pMTet1] Length = 418 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A FG+PQ+R+R Y++ FLN ++ F+FP P I +G++LE + S IS L + Sbjct: 246 LDASHFGIPQKRKRFYLVAFLNQNIHFEFPKPPMISKDIGEVLESDVTGYS-ISEHLQKS 304 Query: 61 HQKRKENNK 69 + +K++ K Sbjct: 305 YLFKKDDGK 313 >gi|127464|sp|P11408|MTM1_MORSP RecName: Full=Modification methylase MspI; Short=M.MspI; AltName: Full=Cytosine-specific methyltransferase MspI gi|44539|emb|CAA32393.1| unnamed protein product [Moraxella sp.] Length = 418 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A FG+PQ+R+R Y++ FLN ++ F+FP P I +G++LE + S IS L + Sbjct: 246 LDASHFGIPQKRKRFYLVAFLNQNIHFEFPKPPMISKDIGEVLESDVTGYS-ISEHLQKS 304 Query: 61 HQKRKENNK 69 + +K++ K Sbjct: 305 YLFKKDDGK 313 >gi|313668796|ref|YP_004049080.1| C-5 cytosine-specific DNA-methylase [Neisseria lactamica ST-640] gi|313006258|emb|CBN87720.1| C-5 cytosine-specific DNA-methylase [Neisseria lactamica 020-06] Length = 362 Score = 52.8 bits (125), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 3/80 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57 + A DFGVPQ RER++I+ F + +FK+P P GI+ DI E + + K +S + Sbjct: 180 VNAKDFGVPQNRERIFIVGFRGDTDIKDFKYPEPTGIQTAFQDIREKDTVPTKYYLSTQY 239 Query: 58 WEGHQKRKENNKIAGKGFGY 77 + +K K+ ++ G GFGY Sbjct: 240 IDTLRKHKQRHEEKGNGFGY 259 >gi|254429380|ref|ZP_05043087.1| DNA-cytosine methyltransferase superfamily [Alcanivorax sp. DG881] gi|196195549|gb|EDX90508.1| DNA-cytosine methyltransferase superfamily [Alcanivorax sp. DG881] Length = 435 Score = 52.8 bits (125), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 42/117 (35%), Positives = 58/117 (49%), Gaps = 24/117 (20%) Query: 8 VPQRRERLYIIDFLNPSV------------EFKFPTPL----GIKPRL---GDILEEH-- 46 VPQ RER+ I+ F P E + L G +P L GD +H Sbjct: 244 VPQHRERIAIVGFREPMPFSWDAMKMAGKGEKRMREVLHREDGSEPYLEWDGDRFFDHGK 303 Query: 47 --IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +++K ++ KLW+ + K ++ G GFG+GL +S TLSARYYKDGSEI Sbjct: 304 GEVNEKYILTPKLWKYLKDYKAKHQAKGNGFGFGLVGPDS-VARTLSARYYKDGSEI 359 >gi|462658|sp|P34878|MTSB_LACLC RecName: Full=Modification methylase ScrFIB; Short=M.ScrFI-B; Short=M.ScrFIB; AltName: Full=Cytosine-specific methyltransferase ScrFIB gi|149495|gb|AAA16838.1| methyl-5-cytosine methylase [Lactococcus lactis] gi|2327032|gb|AAB66694.1| 5-methyl-cytosine-methyltransferase [Lactococcus lactis subsp. cremoris] gi|739995|prf||2004282A methyl-5-cytosine methyltransferase Length = 360 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 22/55 (40%), Positives = 35/55 (63%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + A DFG+PQ RER++ I LNP+ +F FP + + D+LEE++ +K + N Sbjct: 201 LNARDFGIPQNRERVFCISILNPNEDFTFPQKQNLTLSMNDLLEENVSEKFYLKN 255 >gi|261400408|ref|ZP_05986533.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970] gi|269209852|gb|EEZ76307.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970] Length = 362 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 3/80 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57 + A DFGVPQ RER++I+ F + +FK+P P GI+ DI E + + K +S + Sbjct: 180 VNAKDFGVPQNRERIFIVGFRGDTDIKDFKYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 239 Query: 58 WEGHQKRKENNKIAGKGFGY 77 + +K K+ ++ G GFGY Sbjct: 240 IDTLRKHKQRHEEKGNGFGY 259 >gi|315608882|ref|ZP_07883855.1| modification methylase EcoRII [Prevotella buccae ATCC 33574] gi|315249409|gb|EFU29425.1| modification methylase EcoRII [Prevotella buccae ATCC 33574] Length = 312 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR--LGDILEEHIDDKSTISNKLW 58 + A DFG+PQ+RER+ I+ F + ++ F FPTP+ I R L DILE +D K + +K+ Sbjct: 147 LNALDFGIPQKRERIIIVGFKD-NILFSFPTPVPISQRKTLKDILEIDVDKKYYVKDKIR 205 Query: 59 EGHQKR 64 E R Sbjct: 206 ESRLMR 211 >gi|153870185|ref|ZP_01999636.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS] gi|152073352|gb|EDN70367.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS] Length = 235 Score = 51.6 bits (122), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 4/70 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + + DFG+PQ+RER I+ F ++ F FP PLGIKP L ILE+ D N L Sbjct: 144 LNSLDFGIPQKRERTIIVGF-QENIAFSFPKPLGIKPDLTKILEK---DSEVEKNILLLM 199 Query: 61 HQKRKENNKI 70 K++E K+ Sbjct: 200 SLKKRECKKL 209 >gi|255514225|gb|EET90487.1| DNA-cytosine methyltransferase [Candidatus Micrarchaeum acidiphilum ARMAN-2] Length = 328 Score = 51.2 bits (121), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 14/113 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---------GIKPRLGD----ILEEHI 47 + A ++GVPQ+R+R++ I E P+ G+KP + + + + Sbjct: 156 LNAANYGVPQKRQRIFFIGVNRRQAEKAILPPVPTHSEHPTNGLKPWVPSKQFLLPPQKV 215 Query: 48 DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 + S ++ G +RK+ N GFG+ F + S +NT+SARY+KDG+E Sbjct: 216 SKRFYYSERMINGFIRRKKKNAERNIGFGWQ-FLDFSKPSNTISARYWKDGAE 267 >gi|167746073|ref|ZP_02418200.1| hypothetical protein ANACAC_00768 [Anaerostipes caccae DSM 14662] gi|167654588|gb|EDR98717.1| hypothetical protein ANACAC_00768 [Anaerostipes caccae DSM 14662] Length = 312 Score = 51.2 bits (121), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 34/57 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + D+G+PQ R R YI+ F N + EF+FP + L D+LE +DDK +S ++ Sbjct: 148 LNTADYGIPQTRNRTYIVCFANDNAEFEFPDKQELNLTLQDLLETEVDDKYFLSERI 204 >gi|292488627|ref|YP_003531511.1| DNA cytosine methylase [Erwinia amylovora CFBP1430] gi|292899788|ref|YP_003539157.1| modification methylase EcoRII [Erwinia amylovora ATCC 49946] gi|291199636|emb|CBJ46755.1| modification methylase EcoRII [Erwinia amylovora ATCC 49946] gi|291554058|emb|CBA21160.1| DNA cytosine methylase [Erwinia amylovora CFBP1430] gi|312172770|emb|CBX81026.1| DNA cytosine methylase [Erwinia amylovora ATCC BAA-2158] Length = 469 Score = 50.8 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 52/107 (48%), Gaps = 18/107 (16%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPT----------PLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F + K P P P L +L+ ++ K ++ L Sbjct: 280 LPQHRERIILVGFRR---DLKLPAFSLSALPAWYPQQRTP-LHALLDTDVEAKYILTPTL 335 Query: 58 WEGHQKRKENNKIAGKGFGYGLF---FENSATTNTLSARYYKDGSEI 101 W+ + ++ G GFGYGL EN TLSARYYKDGSEI Sbjct: 336 WKYLYHYAKKHQARGNGFGYGLVDPALEN-GVVRTLSARYYKDGSEI 381 >gi|320156908|ref|YP_004189287.1| DNA-cytosine methyltransferase [Vibrio vulnificus MO6-24/O] gi|319932220|gb|ADV87084.1| DNA-cytosine methyltransferase [Vibrio vulnificus MO6-24/O] Length = 552 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 39/108 (36%), Positives = 55/108 (50%), Gaps = 14/108 (12%) Query: 8 VPQRRERLYII----DFLNPSVEFKFPTPLGI-----KPRLGDIL---EEHIDDKSTISN 55 PQ RER+ ++ D + + E+K + I + R+ DIL E K T++ Sbjct: 310 TPQHRERIVLVGVRKDLVEKNPEYKKLSLKNIEVPQERLRVSDILTDLSEEETKKYTLTP 369 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LW ++ G GFG+GL ++ A T TLSARYYKDGSEI Sbjct: 370 NLWNYLYHYALKHQSKGNGFGFGLVDPSNPNAVTRTLSARYYKDGSEI 417 >gi|300813374|ref|ZP_07093725.1| Modification methylase HpaII [Peptoniphilus sp. oral taxon 836 str. F0141] gi|300512517|gb|EFK39666.1| Modification methylase HpaII [Peptoniphilus sp. oral taxon 836 str. F0141] Length = 347 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 33/84 (39%), Positives = 47/84 (55%), Gaps = 5/84 (5%) Query: 5 DFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKLWEG 60 DFGVPQ RER+YI+ F ++P+ +F FP + DI+EE K +S+ E Sbjct: 151 DFGVPQNRERIYIVAFREDISPN-KFIFPEETDDTKVIADIMEEKETSPKYYLSDVYLES 209 Query: 61 HQKRKENNKIAGKGFGYGLFFENS 84 +K K+ +K G GFGY + NS Sbjct: 210 LRKHKQRHKAKGNGFGYEIRDVNS 233 >gi|317497298|ref|ZP_07955621.1| C-5 cytosine-specific DNA methylase [Lachnospiraceae bacterium 5_1_63FAA] gi|316895367|gb|EFV17526.1| C-5 cytosine-specific DNA methylase [Lachnospiraceae bacterium 5_1_63FAA] Length = 363 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 24/55 (43%), Positives = 36/55 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + A D+GVPQ RER++ I LN +F+FP +K +L DILE+++D K + N Sbjct: 204 LNARDYGVPQNRERVFCISELNGENKFEFPKSRELKLKLYDILEKNVDSKYYLKN 258 >gi|238917714|ref|YP_002931231.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC 27750] gi|238873074|gb|ACR72784.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC 27750] Length = 311 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 35/57 (61%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + + D+GVPQ R R YI+ F N + F+FP + L D+LE +DDK +S+++ Sbjct: 148 LNSADYGVPQTRNRTYIVCFDNQNARFEFPEKKKLNKTLQDLLEPEVDDKYFLSDRI 204 >gi|309378773|emb|CBX22599.1| putative DNA cytosine methyltransferase [Neisseria lactamica Y92-1009] Length = 342 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 3/80 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57 + A DFGVPQ RER++I+ F + F++P P GI+ DI E + + K +S + Sbjct: 160 VNAKDFGVPQNRERIFIVGFRGDTDIKYFEYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 219 Query: 58 WEGHQKRKENNKIAGKGFGY 77 + +K K+ ++ G GFGY Sbjct: 220 IDTLRKHKQRHEEKGNGFGY 239 >gi|332188292|ref|ZP_08390019.1| DNA-cytosine methyltransferase family protein [Sphingomonas sp. S17] gi|332011688|gb|EGI53766.1| DNA-cytosine methyltransferase family protein [Sphingomonas sp. S17] Length = 423 Score = 49.7 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 28/120 (23%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD-------------------------- 41 VPQ R+R+ ++ F V F + L P + D Sbjct: 229 VPQHRQRILLVGF-QKDVGFDWEKVLAKMPAVADGPKLASILHREDGTEEEGEDDDRRFI 287 Query: 42 ILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + + + K ++++LW+ Q E ++ AG GFG + T+ TLSARYYKDGSEI Sbjct: 288 LADGKVQKKYVLTDRLWQYLQGYAEKHRQAGNGFGCSVVGPKD-TSRTLSARYYKDGSEI 346 >gi|27497145|gb|AAO17336.1| methylase [Neisseria lactamica] Length = 384 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 3/80 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57 + A DFGVPQ RER++I+ F + F++P P GI+ DI E + + K +S + Sbjct: 202 VNAKDFGVPQNRERIFIVGFRGDTDIKYFEYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 261 Query: 58 WEGHQKRKENNKIAGKGFGY 77 + +K K+ ++ G GFGY Sbjct: 262 IDTLRKHKQRHEEKGNGFGY 281 >gi|282879499|ref|ZP_06288233.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS 5C-B1] gi|281306646|gb|EFA98672.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS 5C-B1] Length = 438 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 D+G+PQ RER++ I F P V+F FP P+ ++ ++ D LE+++D K + K Sbjct: 212 DYGIPQHRERIFCIGFHTP-VKFAFPAPIPLEYKMYDFLEDYVDTKYFLKEK 262 >gi|154484133|ref|ZP_02026581.1| hypothetical protein EUBVEN_01844 [Eubacterium ventriosum ATCC 27560] gi|149735175|gb|EDM51061.1| hypothetical protein EUBVEN_01844 [Eubacterium ventriosum ATCC 27560] Length = 366 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 30/76 (39%), Positives = 40/76 (52%), Gaps = 3/76 (3%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR--LGDILEEH-IDDKSTISNKLWEGH 61 DFGVPQ RER+YI+ F F P+G KP + DI+EE + K +S E Sbjct: 168 DFGVPQNRERIYIVAFRKDINSENFEFPVGNKPDTCIRDIMEEQEVSVKYYLSTTYIETL 227 Query: 62 QKRKENNKIAGKGFGY 77 ++ K + G GFGY Sbjct: 228 KRHKARHAAKGNGFGY 243 >gi|313892290|ref|ZP_07825883.1| modification methylase HpaII [Dialister microaerophilus UPII 345-E] gi|313119428|gb|EFR42627.1| modification methylase HpaII [Dialister microaerophilus UPII 345-E] Length = 329 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 30/82 (36%), Positives = 41/82 (50%), Gaps = 3/82 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57 + + +FGVPQ RER+YI+ F N F FP + L DI+E E + + +S Sbjct: 147 LNSKNFGVPQNRERIYIVAFRNDISPENFDFPEGTDTEKTLKDIIEKEEVSSRYYLSETY 206 Query: 58 WEGHQKRKENNKIAGKGFGYGL 79 K KE K G GFGY + Sbjct: 207 LNSLIKHKERQKAKGNGFGYEI 228 >gi|12229852|sp|O30868|MTH2_HAEAE RecName: Full=Modification methylase HaeII; Short=M.HaeII; AltName: Full=Cytosine-specific methyltransferase HaeII gi|2425087|gb|AAB70829.1| HaeII methylase [Haemophilus aegyptius ATCC 11116] Length = 318 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + DFG+PQ+RER+YI+ FL+ + F+FP P+G L +ILE D +N Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILES---DDVVPNNYFLSD 199 Query: 61 HQKRKENNKIA 71 KRK + I Sbjct: 200 ELKRKRLSSIT 210 >gi|254282099|ref|ZP_04957067.1| modification methylase SsoII [gamma proteobacterium NOR51-B] gi|219678302|gb|EED34651.1| modification methylase SsoII [gamma proteobacterium NOR51-B] Length = 356 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 36/98 (36%), Positives = 48/98 (48%), Gaps = 7/98 (7%) Query: 8 VPQRRERLYIIDFLNPSVE----FKFPT-PLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62 V QRR R +++ N F+FP P G P L +L + D K T+S+K+W GH+ Sbjct: 192 VAQRRVRCFMVAVRNDIAANRGAFEFPKFPEGSIP-LRSVLSKEPDPKYTLSDKMWAGHK 250 Query: 63 KRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 R N G GF L +NT+ ARY KD E Sbjct: 251 ARTIRNVERGTGF-TALEANLDKPSNTIVARYGKDAKE 287 >gi|319776347|ref|YP_004138835.1| Cytosine-specific methyltransferase [Haemophilus influenzae F3047] gi|329123500|ref|ZP_08252064.1| modification methylase HaeII [Haemophilus aegyptius ATCC 11116] gi|317450938|emb|CBY87164.1| Cytosine-specific methyltransferase [Haemophilus influenzae F3047] gi|327471082|gb|EGF16537.1| modification methylase HaeII [Haemophilus aegyptius ATCC 11116] Length = 318 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + DFG+PQ+RER+YI+ FL+ + F+FP P+G L +ILE D +N Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILES---DDVVPNNYFLSD 199 Query: 61 HQKRKENNKIA 71 KRK + I Sbjct: 200 ELKRKRLSSIT 210 >gi|68250112|ref|YP_249224.1| modification methylase HaeII [Haemophilus influenzae 86-028NP] gi|68058311|gb|AAX88564.1| modification methylase HaeII [Haemophilus influenzae 86-028NP] Length = 318 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + DFG+PQ+RER+YI+ FL+ + F+FP P+G L +ILE D +N Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILES---DDVVPNNYFLSD 199 Query: 61 HQKRKENNKIA 71 KRK + I Sbjct: 200 ELKRKRLSSIT 210 >gi|148826843|ref|YP_001291596.1| modification methylase HaeII [Haemophilus influenzae PittGG] gi|148718085|gb|ABQ99212.1| modification methylase HaeII [Haemophilus influenzae PittGG] Length = 318 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + DFG+PQ+RER+YI+ FL+ + F+FP P+G L +ILE D +N Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILES---DDVVPNNYFLSD 199 Query: 61 HQKRKENNKIA 71 KRK + I Sbjct: 200 ELKRKRLSSIT 210 >gi|219870523|ref|YP_002474898.1| Type II modification methyltransferase HpaII/DNA (cytosine-5-)-methyltransferase [Haemophilus parasuis SH0165] gi|219690727|gb|ACL31950.1| Type II modification methyltransferase HpaII/DNA (cytosine-5-)-methyltransferase [Haemophilus parasuis SH0165] Length = 350 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 3/80 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F F +P PL K D+ E++ + K +S + Sbjct: 170 LNAKDFGVPQNRERIFIVGFRQDLAINSFYYPAPLNRKVCFNDVKEKNVVPTKYYLSTQY 229 Query: 58 WEGHQKRKENNKIAGKGFGY 77 E +K K ++ G GFGY Sbjct: 230 IETLRKHKARHQDKGNGFGY 249 >gi|127459|sp|P15446|MTH2_HAEPA RecName: Full=Modification methylase HpaII; Short=M.HpaII; AltName: Full=Cytosine-specific methyltransferase HpaII gi|43630|emb|CAA35705.1| unnamed protein product [Haemophilus parainfluenzae] gi|305377|gb|AAA20481.1| HpaII modification methyltransferase [Haemophilus parainfluenzae] Length = 358 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 3/80 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A +FGVPQ RER+YI+ F + F +P PL DI EE + K +S + Sbjct: 176 VNAKNFGVPQNRERIYIVGFHKSTGVNSFSYPEPLDKIVTFADIREEKTVPTKYYLSTQY 235 Query: 58 WEGHQKRKENNKIAGKGFGY 77 + +K KE ++ G GFGY Sbjct: 236 IDTLRKHKERHESKGNGFGY 255 >gi|167854713|ref|ZP_02477492.1| cell division protein MukB [Haemophilus parasuis 29755] gi|167854127|gb|EDS25362.1| cell division protein MukB [Haemophilus parasuis 29755] Length = 361 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 3/80 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F F +P PL K D+ E++ + K +S + Sbjct: 181 LNAKDFGVPQNRERIFIVGFRQDLAINSFYYPAPLNRKVCFNDVKEKNVVPTKYYLSTQY 240 Query: 58 WEGHQKRKENNKIAGKGFGY 77 E +K K ++ G GFGY Sbjct: 241 IETLRKHKARHQDKGNGFGY 260 >gi|145629543|ref|ZP_01785341.1| modification methylase HaeII [Haemophilus influenzae 22.1-21] gi|144978386|gb|EDJ88150.1| modification methylase HaeII [Haemophilus influenzae 22.1-21] Length = 219 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + DFG+PQ+RER+YI+ FL+ + F+FP P+G L +ILE D +N Sbjct: 45 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILES---DDVVPNNYFLSD 100 Query: 61 HQKRKENNKIA 71 KRK + I Sbjct: 101 ELKRKRLSSIT 111 >gi|292670064|ref|ZP_06603490.1| modification methylase EcoRII [Selenomonas noxia ATCC 43541] gi|292648252|gb|EFF66224.1| modification methylase EcoRII [Selenomonas noxia ATCC 43541] Length = 377 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 3/76 (3%) Query: 5 DFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKLWEGH 61 DFGVPQ RER+YI+ F N S F FP + DI+E E + K +S Sbjct: 185 DFGVPQNRERIYIVAFRNDIDSTGFAFPEGHDSNTTIRDIMEAEEVSVKYYLSTVYLASL 244 Query: 62 QKRKENNKIAGKGFGY 77 ++ K +++ G GFGY Sbjct: 245 RRHKAHHEALGHGFGY 260 >gi|159026722|emb|CAO89036.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 455 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 23/48 (47%), Positives = 33/48 (68%), Gaps = 3/48 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE 45 + A DFG+PQ RER++I+ ++ FKFP PLGI P++ DILE+ Sbjct: 169 LNAYDFGLPQNRERVFIVGIRKDIDNYERFKFPLPLGIHPKVLDILED 216 >gi|166368611|ref|YP_001660884.1| cytosine-specific methyltransferase [Microcystis aeruginosa NIES-843] gi|166090984|dbj|BAG05692.1| cytosine-specific methyltransferase [Microcystis aeruginosa NIES-843] Length = 464 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 23/48 (47%), Positives = 33/48 (68%), Gaps = 3/48 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE 45 + A DFG+PQ RER++I+ ++ FKFP PLGI P++ DILE+ Sbjct: 177 LNAYDFGLPQNRERVFIVGIRKDIDNYERFKFPLPLGIHPKVLDILED 224 >gi|119493789|ref|ZP_01624358.1| type II restriction enzyme HaeII [Lyngbya sp. PCC 8106] gi|119452484|gb|EAW33671.1| type II restriction enzyme HaeII [Lyngbya sp. PCC 8106] Length = 689 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 8/87 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58 + A DFG+PQ+RER YI+ FL ++ F FP P+ + L +ILE E + DKS +++ Sbjct: 150 LNALDFGLPQKRERTYIVGFLE-NIHFSFPKPIQKRVSLSEILEPDEQV-DKSLFASEFI 207 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSA 85 + +K ++ K F ++ EN + Sbjct: 208 Q----KKRIQRLKVKPFYPSIWHENKS 230 >gi|288559284|ref|YP_003422770.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1] gi|288541994|gb|ADC45878.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1] Length = 339 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK--STISNKLW 58 + + D+GVPQ RER++I+ F + FKFP P K + D+LE+++ D S I++ Sbjct: 170 LNSKDYGVPQNRERIFIVGFKDNVNTFKFPLPFENKANINDLLEKNVKDHELSGIASDHL 229 Query: 59 EGHQKRKENNKIAGKGF 75 + H + NK K + Sbjct: 230 KKHYEEFLKNKKVNKNY 246 >gi|255279955|ref|ZP_05344510.1| modification methylase EcoRII [Bryantella formatexigens DSM 14469] gi|255269728|gb|EET62933.1| modification methylase EcoRII [Bryantella formatexigens DSM 14469] Length = 311 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 34/57 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + + DFGVPQ R R Y++ F N EF FP ++ L D+LE+ + +K +S ++ Sbjct: 148 LNSADFGVPQTRNRTYLVCFSNQKAEFTFPQTEPLESTLQDLLEQDVAEKYFLSERI 204 >gi|290969050|ref|ZP_06560585.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1 str. 28L] gi|290781006|gb|EFD93599.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1 str. 28L] Length = 333 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 5/81 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56 + + DFGVPQ RER+YI+ F + P+ F+FP + DI+EE K +S+ Sbjct: 147 LNSKDFGVPQNRERIYIVAFREDIAPNT-FRFPEKTDDTKVIADIMEEKEPSSKYYLSDV 205 Query: 57 LWEGHQKRKENNKIAGKGFGY 77 +K K+ ++ G GFGY Sbjct: 206 YLASLRKHKQRHQAKGNGFGY 226 >gi|167751356|ref|ZP_02423483.1| hypothetical protein EUBSIR_02342 [Eubacterium siraeum DSM 15702] gi|167655602|gb|EDR99731.1| hypothetical protein EUBSIR_02342 [Eubacterium siraeum DSM 15702] Length = 475 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 3/80 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + + +FGVPQ RER+YI+ F N +F+FP R+ DI+EE+ + K +S+ Sbjct: 294 LNSKNFGVPQNRERIYIVAFRNDIAPEKFEFPQGNDDTKRIKDIIEENPVPAKYYLSDVY 353 Query: 58 WEGHQKRKENNKIAGKGFGY 77 E ++ K ++ G GFGY Sbjct: 354 LETLRRHKARHESKGNGFGY 373 >gi|329298618|ref|ZP_08255954.1| DNA cytosine methylase [Plautia stali symbiont] Length = 465 Score = 47.8 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 50/106 (47%), Gaps = 15/106 (14%) Query: 8 VPQRRERLYIID----------FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +PQ RER+ ++ F ++ +P + P L +LE K +S L Sbjct: 275 LPQHRERIVLVGIRRDTGLSEGFSLRALAALYPPEV---PALHSLLELQPAAKYILSPTL 331 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 W + + +K G GFG+GL + TLSARYYKDGSEI Sbjct: 332 WHYLYQYAKKHKAKGNGFGFGLNDPRNPHCCVRTLSARYYKDGSEI 377 >gi|326573696|gb|EGE23654.1| DNA-cytosine methyltransferase [Moraxella catarrhalis O35E] Length = 408 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + + D+G+PQ RER+++I F N P F+FP P+ ++ + D LE++ D K + K Sbjct: 180 LNSKDYGIPQHRERIFVIGFKNKPKNGFEFPQPIELEYTMQDFLEDYTDSKYFLKEK 236 >gi|296114006|ref|YP_003627944.1| DNA-cytosine methyltransferase [Moraxella catarrhalis RH4] gi|295921700|gb|ADG62051.1| DNA-cytosine methyltransferase [Moraxella catarrhalis RH4] Length = 410 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + + D+G+PQ RER+++I F N P F+FP P+ ++ + D LE++ D K + K Sbjct: 182 LNSKDYGIPQHRERIFVIGFKNKPKNGFEFPQPIELEYTMQDFLEDYTDSKYFLKEK 238 >gi|15676724|ref|NP_273868.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis MC58] gi|7226061|gb|AAF41239.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis MC58] gi|308389005|gb|ADO31325.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha710] gi|316984499|gb|EFV63467.1| modification methylase HpaII [Neisseria meningitidis H44/76] gi|325129944|gb|EGC52743.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304] gi|325140023|gb|EGC62552.1| DNA-cytosine methyltransferase [Neisseria meningitidis CU385] gi|325206334|gb|ADZ01787.1| DNA-cytosine methyltransferase [Neisseria meningitidis M04-240196] Length = 411 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|218767941|ref|YP_002342453.1| putative modification methylase [Neisseria meningitidis Z2491] gi|6900408|emb|CAB72018.1| putative cytosine-specific methyltransferase [Neisseria meningitidis] gi|121051949|emb|CAM08255.1| putative modification methylase [Neisseria meningitidis Z2491] Length = 411 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|313668701|ref|YP_004048985.1| modification methylase [Neisseria lactamica ST-640] gi|313006163|emb|CBN87625.1| putative modification methylase [Neisseria lactamica 020-06] Length = 372 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 145 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 201 >gi|166368121|ref|YP_001660394.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa NIES-843] gi|166090494|dbj|BAG05202.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa NIES-843] Length = 347 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 32/81 (39%), Positives = 43/81 (53%), Gaps = 5/81 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56 + A FGVPQ R R++I+ F LN F +P P + L DILEE + K +SN+ Sbjct: 145 LNARYFGVPQNRPRIFIVGFREDLN-IYHFSYPQPTHQETCLKDILEEKEVSVKYYLSNQ 203 Query: 57 LWEGHQKRKENNKIAGKGFGY 77 E K K ++ G GFGY Sbjct: 204 YLETLFKHKARHQHKGNGFGY 224 >gi|304387865|ref|ZP_07370039.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC 13091] gi|254670653|emb|CBA06706.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha153] gi|254672637|emb|CBA06420.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha275] gi|261392815|emb|CAX50396.1| putative type II restriction-modification system enzyme Mod [Neisseria meningitidis 8013] gi|304338130|gb|EFM04266.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC 13091] gi|319410190|emb|CBY90526.1| putative type II restriction-modification system enzyme Mod [Neisseria meningitidis WUE 2594] gi|325134031|gb|EGC56686.1| DNA-cytosine methyltransferase [Neisseria meningitidis M13399] gi|325203903|gb|ADY99356.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240355] Length = 411 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|161869767|ref|YP_001598934.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442] gi|161595320|gb|ABX72980.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442] Length = 411 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|325127899|gb|EGC50802.1| DNA-cytosine methyltransferase [Neisseria meningitidis N1568] Length = 411 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|121634611|ref|YP_974856.1| putative modification methylase [Neisseria meningitidis FAM18] gi|4887086|gb|AAD32180.1|AF125564_2 putative site specific DNA methyltransferase [Neisseria meningitidis] gi|120866317|emb|CAM10058.1| putative modification methylase [Neisseria meningitidis FAM18] gi|325132026|gb|EGC54724.1| DNA-cytosine methyltransferase [Neisseria meningitidis M6190] gi|325135954|gb|EGC58564.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579] gi|325137780|gb|EGC60355.1| DNA-cytosine methyltransferase [Neisseria meningitidis ES14902] gi|325142075|gb|EGC64502.1| DNA-cytosine methyltransferase [Neisseria meningitidis 961-5945] gi|325198036|gb|ADY93492.1| DNA-cytosine methyltransferase [Neisseria meningitidis G2136] gi|325202381|gb|ADY97835.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149] gi|325207867|gb|ADZ03319.1| DNA-cytosine methyltransferase [Neisseria meningitidis NZ-05/33] Length = 411 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|325144138|gb|EGC66445.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240013] gi|325200491|gb|ADY95946.1| DNA-cytosine methyltransferase [Neisseria meningitidis H44/76] Length = 406 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 179 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 235 >gi|306828113|ref|ZP_07461376.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pyogenes ATCC 10782] gi|304429650|gb|EFM32696.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pyogenes ATCC 10782] Length = 214 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 32/54 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + A D+GVPQ RER++ + L + FP + RL D+LEE +D+K +S Sbjct: 150 LNAKDYGVPQNRERVFCVSILGDHEPYIFPEKQELTIRLKDVLEEDVDEKYYLS 203 >gi|331270911|ref|YP_004385622.1| putative cytosine-specific DNA methylotransferase [Clostridium botulinum BKT015925] gi|329127303|gb|AEB77247.1| putative cytosine-specific DNA methylotransferase [Clostridium botulinum BKT015925] Length = 318 Score = 45.4 bits (106), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/66 (33%), Positives = 40/66 (60%), Gaps = 12/66 (18%) Query: 1 MKACDFGVPQRRERLYII-------DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53 M D+G+P R RLYI+ DF ++KFPT + +K + D+LE+ ++DK + Sbjct: 151 MNTSDYGLPHTRRRLYIVGQRKDLGDF-----DYKFPTEIELKLNVQDLLEKDVNDKYYL 205 Query: 54 SNKLWE 59 ++K+++ Sbjct: 206 TDKMYK 211 >gi|254443346|ref|ZP_05056822.1| C-5 cytosine-specific DNA methylase superfamily [Verrucomicrobiae bacterium DG1235] gi|198257654|gb|EDY81962.1| C-5 cytosine-specific DNA methylase superfamily [Verrucomicrobiae bacterium DG1235] Length = 349 Score = 45.4 bits (106), Expect = 0.002, Method: Compositional matrix adjust. Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 3/86 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVE-FKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57 +KA DFG+ Q+RER++I+ F VE F +P + ++ DILE H + ++ K Sbjct: 176 LKASDFGLAQKRERVFIVGFRKSLGVEGFSYPEKGNDRSKISDILEPSHSVGQWLLTKKS 235 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN 83 + K+AG G GY + EN Sbjct: 236 LACLRDHSSKQKLAGNGHGYAILDEN 261 >gi|56461628|ref|YP_156909.1| DNA cytosine methylase [Idiomarina loihiensis L2TR] gi|56180638|gb|AAV83360.1| DNA cytosine methylase [Idiomarina loihiensis L2TR] Length = 419 Score = 45.4 bits (106), Expect = 0.002, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFGVPQ R+R Y++ F F FP P IK +G +LE+ + S IS L + Sbjct: 240 LNASDFGVPQNRKRFYLVAFDGKDCGFSFPQPPMIKADIGTLLEKGAEGYS-ISEHLQKT 298 Query: 61 HQKRKENNK 69 + +K++ + Sbjct: 299 YLFKKDDGR 307 >gi|150026305|ref|YP_001297131.1| Type II modification methyltransferase HpaII [Flavobacterium psychrophilum JIP02/86] gi|149772846|emb|CAL44330.1| Type II modification methyltransferase HpaII [Flavobacterium psychrophilum JIP02/86] Length = 425 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 30/87 (34%), Positives = 45/87 (51%), Gaps = 5/87 (5%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHI-DDKSTISNK 56 + A +FGVPQ RER+YI+ F LN S F++P PL P + E+ + K +S + Sbjct: 239 VNAKNFGVPQNRERIYIVGFRQDLNIS-SFEYPEPLENNPTFESVKEKLVPPTKYYLSTQ 297 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFEN 83 + K + G GFGY + +N Sbjct: 298 YVQTLINHKARHASKGNGFGYAIIPDN 324 >gi|159027151|emb|CAO86782.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 347 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 32/81 (39%), Positives = 43/81 (53%), Gaps = 5/81 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56 + A FGVPQ R R++I+ F LN F +P P + L DILEE + K +SN+ Sbjct: 145 LNARYFGVPQNRPRIFIVGFREDLN-IYHFSYPQPTHPETCLKDILEEKEVSVKYYLSNQ 203 Query: 57 LWEGHQKRKENNKIAGKGFGY 77 E K K ++ G GFGY Sbjct: 204 YLETLFKHKARHENKGNGFGY 224 >gi|269121452|ref|YP_003309629.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386] gi|268615330|gb|ACZ09698.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386] Length = 372 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 34/54 (62%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + A ++ +PQ RERL+ + L+ V++ FP P + L D+LE+ +D+K I+ Sbjct: 150 LNALNYEIPQNRERLFCLSILDDKVKYNFPGPKKLNILLKDLLEKEVDEKYFIN 203 >gi|261252209|ref|ZP_05944782.1| DNA-cytosine methyltransferase [Vibrio orientalis CIP 102891] gi|260935600|gb|EEX91589.1| DNA-cytosine methyltransferase [Vibrio orientalis CIP 102891] Length = 584 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 38/105 (36%), Positives = 51/105 (48%), Gaps = 11/105 (10%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLG--IKPR----LGDILEEHIDDKS---TISNKLW 58 +PQ RER+ ++ K L KP L DIL E D+ S T++ LW Sbjct: 307 LPQHRERVVLVGVRKDLTIDKSKLSLNNIQKPTERVPLKDILCELSDEDSSKYTLTPNLW 366 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 ++ G GFG+GL ++ T TLSARY+KDGSEI Sbjct: 367 NYLYNYALKHQTQGNGFGFGLVDPSNINTVTRTLSARYHKDGSEI 411 >gi|288576182|ref|ZP_05978340.2| DNA (cytosine-5-)-methyltransferase [Neisseria mucosa ATCC 25996] gi|288566126|gb|EFC87686.1| DNA (cytosine-5-)-methyltransferase [Neisseria mucosa ATCC 25996] Length = 406 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P F+FP + ++ + D LE++ D K + K Sbjct: 179 MNSKDYGIPQHRERIFVVGFHTPPTNGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 235 >gi|149369548|ref|ZP_01889400.1| C-5 cytosine-specific DNA-methylase [unidentified eubacterium SCB49] gi|149356975|gb|EDM45530.1| C-5 cytosine-specific DNA-methylase [unidentified eubacterium SCB49] Length = 421 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 10/96 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-----LNPSVEFKFPTPLGIKPRLGDILE-EHIDDKSTIS 54 + A FGVPQ RER++I+ F +N FK+P P + L +ILE E + K +S Sbjct: 241 LNAKKFGVPQNRERIFIVGFRKDLGIN---NFKYPEPTDTEAILENILEAEEVSVKYYLS 297 Query: 55 NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 + + + ++ G GFGY + N+ T N + Sbjct: 298 EVYLQTLRNHRARHESKGNGFGYEI-IPNNGTANAV 332 >gi|296313699|ref|ZP_06863640.1| modification methylase NgoBI [Neisseria polysaccharea ATCC 43768] gi|296839717|gb|EFH23655.1| modification methylase NgoBI [Neisseria polysaccharea ATCC 43768] Length = 315 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + DFG+PQ+RER+YI+ F + ++ F FP P+ LGD+LE D Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGDLLENDRD 188 >gi|327403407|ref|YP_004344245.1| DNA-cytosine methyltransferase [Fluviicola taffensis DSM 16823] gi|327318915|gb|AEA43407.1| DNA-cytosine methyltransferase [Fluviicola taffensis DSM 16823] Length = 422 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 5/81 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56 M A +FGVPQ RER++I+ F LN F++P P+ D+ EE + K +S Sbjct: 241 MNAKNFGVPQNRERIFIVGFRKDLNID-SFEYPLPVSKSVTFQDVREEKEVSVKYYLSET 299 Query: 57 LWEGHQKRKENNKIAGKGFGY 77 K KE + G GFG+ Sbjct: 300 YLNTLVKHKERHASKGNGFGF 320 >gi|302671270|ref|YP_003831230.1| DNA-cytosine methyltransferase [Butyrivibrio proteoclasticus B316] gi|302395743|gb|ADL34648.1| DNA-cytosine methyltransferase [Butyrivibrio proteoclasticus B316] Length = 579 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RERL+++ F L+ VEF FP + ++ ++ D L Sbjct: 354 LNARDYGVPQNRERLFVVGFRNDLDLDVEFSFPQAIELEKKMQDFL 399 >gi|325269501|ref|ZP_08136117.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] gi|324988120|gb|EGC20087.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] Length = 388 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + A D+G+PQ RERLY + F +FK+P P+ ++ ++ D LE++ + Sbjct: 180 LNARDYGIPQTRERLYCVGF-KKKTKFKYPAPIPLRYKMYDFLEDYTN 226 >gi|291530358|emb|CBK95943.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3] Length = 696 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 28/76 (36%), Positives = 39/76 (51%), Gaps = 3/76 (3%) Query: 5 DFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWEGH 61 +FGVPQ RER+YI+ F N F FP L DI E + + K +S+ + Sbjct: 158 NFGVPQNRERIYIVAFRNDIAPDNFDFPESTDTNKCLLDIRERNPVPAKYYLSDVYVDTL 217 Query: 62 QKRKENNKIAGKGFGY 77 +K K ++ G GFGY Sbjct: 218 RKHKARHEAKGNGFGY 233 >gi|313674544|ref|YP_004052540.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] gi|312941242|gb|ADR20432.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] Length = 420 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 3/93 (3%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVE-FKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A D+GVPQ+RER++I+ F + +E F++P P D+ EE + K +SN Sbjct: 242 INAKDYGVPQKRERIFIVGFRKDLKIETFEYPEPSKSPVSFEDVKEEEPVSVKYYLSNTY 301 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 +K K + G GFGY + ++ + + Sbjct: 302 LNTLKKHKARHLGKGNGFGYAVIADDEIANSVV 334 >gi|170719133|ref|YP_001784281.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336] gi|168827262|gb|ACA32633.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336] Length = 408 Score = 43.5 bits (101), Expect = 0.009, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + ++G+PQ RER++++ F +P F+FPT + ++ + D LE++ D K + K Sbjct: 180 MNSKNYGIPQHRERIFVVGFKTSPKGGFQFPTKIPLERTMQDFLEDYTDSKYFLKEK 236 >gi|159026805|emb|CAO86650.1| ngoBIM [Microcystis aeruginosa PCC 7806] Length = 331 Score = 43.5 bits (101), Expect = 0.009, Method: Compositional matrix adjust. Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +FG+PQ+RER++I+ F + F +P P + L +ILEE++ D S K+ + Sbjct: 156 LNALNFGLPQKRERIFIVGF-REARGFIWPKPALSRTSLTEILEENVSDFYYASEKIQKS 214 Query: 61 HQKRKENNK 69 ++E K Sbjct: 215 RLLKREGKK 223 >gi|209524941|ref|ZP_03273486.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] gi|209494590|gb|EDZ94900.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] Length = 442 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 4/60 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A DFG+PQ R+R++I+ +N F+FP PL + P+L D + E + K I K Sbjct: 160 INASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNLHPKLFDFV-EGVSQKPVIKKKF 218 >gi|282859944|ref|ZP_06269032.1| DNA (cytosine-5-)-methyltransferase [Prevotella bivia JCVIHMP010] gi|282587347|gb|EFB92564.1| DNA (cytosine-5-)-methyltransferase [Prevotella bivia JCVIHMP010] Length = 448 Score = 43.1 bits (100), Expect = 0.012, Method: Compositional matrix adjust. Identities = 28/81 (34%), Positives = 37/81 (45%), Gaps = 5/81 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56 + A +FGVPQ RER+YI+ F LN F +P P DI E + K +S Sbjct: 258 LNAANFGVPQHRERVYIVGFRKDLNIKA-FNYPMPTDNSKTFADIKEATTVSSKYYLSTT 316 Query: 57 LWEGHQKRKENNKIAGKGFGY 77 + K + G GFGY Sbjct: 317 YLDTLIAHKARHAAKGHGFGY 337 >gi|313678561|ref|YP_004056301.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45] gi|312950401|gb|ADR24996.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45] Length = 315 Score = 43.1 bits (100), Expect = 0.013, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 3/54 (5%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKS 51 + A D+G +PQ RER+YI+ F + F FP P+ ++ + D LE ++DD S Sbjct: 145 LNAKDYGDIPQNRERIYIVGFKDKHSHDAFSFPLPVKLRTSINDCLEVNVDDDS 198 >gi|254804105|ref|YP_003082326.1| putative type II DNA modification methyltransferase [Neisseria meningitidis alpha14] gi|254667647|emb|CBA03458.1| putative type II DNA modification methyltransferase [Neisseria meningitidis alpha14] Length = 315 Score = 43.1 bits (100), Expect = 0.013, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + DFG+PQ+RER+YII F + ++ F FP P+ LG++LE D Sbjct: 142 LNTLDFGLPQKRERIYIIGFSD-NIPFYFPEPINQYRPLGELLENDRD 188 >gi|291320332|ref|YP_003515594.1| modification methylase Bsp6I [Mycoplasma agalactiae] gi|290752665|emb|CBH40638.1| Modification methylase Bsp6I [Mycoplasma agalactiae] Length = 315 Score = 42.7 bits (99), Expect = 0.015, Method: Compositional matrix adjust. Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 3/52 (5%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDD 49 + A D+G +PQ RER+YI+ F + F FP P+ +K L D LE ++DD Sbjct: 145 LNAKDYGDIPQNRERIYIVGFKDKHSYDIFSFPLPVKLKTSLNDCLEVNVDD 196 >gi|254445875|ref|ZP_05059351.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae bacterium DG1235] gi|198260183|gb|EDY84491.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae bacterium DG1235] Length = 321 Score = 42.7 bits (99), Expect = 0.015, Method: Composition-based stats. Identities = 22/45 (48%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ R+RLYI+ S EFKFP G + RL D+L Sbjct: 147 LNASDYGVPQARKRLYIVGIRKDLGSGEFKFPETSGARVRLKDLL 191 >gi|281491829|ref|YP_003353809.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp. lactis KF147] gi|281375540|gb|ADA65046.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp. lactis KF147] Length = 351 Score = 42.7 bits (99), Expect = 0.016, Method: Compositional matrix adjust. Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 8/80 (10%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFP---TPLGIKPRLGDILEEHIDDKSTIS 54 ++A ++G+PQ+RER++I+ LN F P +PL P L +L++ D+K S Sbjct: 159 LRAVEYGIPQKRERVFIVGIRNDLNKKFHFADPPIQSPLDYTP-LKKVLQKDFDEKYYFS 217 Query: 55 NKLWEGHQKRKENNKIAGKG 74 ++ EG K K +KI KG Sbjct: 218 DRAVEGMLKSKM-SKIMNKG 236 >gi|218248203|ref|YP_002373574.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] gi|257060473|ref|YP_003138361.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] gi|218168681|gb|ACK67418.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] gi|256590639|gb|ACV01526.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] Length = 460 Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 23/62 (37%), Positives = 37/62 (59%), Gaps = 3/62 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A DFG+PQ R+R++++ N S ++FP PL I P++ DIL++ + K KL Sbjct: 168 LNAYDFGLPQNRDRVFLVGIRNDIEGSQNYQFPDPLNIHPKVLDILDDLKNIKPIKKVKL 227 Query: 58 WE 59 E Sbjct: 228 SE 229 >gi|12229862|sp|Q59603|MTB1_NEIGO RecName: Full=Modification methylase NgoBI; Short=M.NgoBI; AltName: Full=Cytosine-specific methyltransferase NgoBI; Short=M.NgoI gi|5924404|gb|AAB03206.2| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae] Length = 317 Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE D Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 188 >gi|194099739|ref|YP_002002874.1| NgoIM [Neisseria gonorrhoeae NCCP11945] gi|240013125|ref|ZP_04720038.1| NgoIM [Neisseria gonorrhoeae DGI18] gi|240015568|ref|ZP_04722108.1| NgoIM [Neisseria gonorrhoeae FA6140] gi|240114103|ref|ZP_04728593.1| NgoIM [Neisseria gonorrhoeae MS11] gi|240114658|ref|ZP_04728720.1| NgoIM [Neisseria gonorrhoeae PID18] gi|240120196|ref|ZP_04733158.1| NgoIM [Neisseria gonorrhoeae PID24-1] gi|240122493|ref|ZP_04735449.1| NgoIM [Neisseria gonorrhoeae PID332] gi|240126658|ref|ZP_04739544.1| NgoIM [Neisseria gonorrhoeae SK-92-679] gi|254492718|ref|ZP_05105889.1| modification methylase NgoBI [Neisseria gonorrhoeae 1291] gi|260441536|ref|ZP_05795352.1| NgoIM [Neisseria gonorrhoeae DGI2] gi|268600171|ref|ZP_06134338.1| modification methylase NgoBI [Neisseria gonorrhoeae MS11] gi|268600304|ref|ZP_06134471.1| modification methylase NgoBI [Neisseria gonorrhoeae PID18] gi|268602536|ref|ZP_06136703.1| modification methylase NgoBI [Neisseria gonorrhoeae PID1] gi|268681085|ref|ZP_06147947.1| modification methylase NgoBI [Neisseria gonorrhoeae PID332] gi|268685237|ref|ZP_06152099.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-92-679] gi|268685565|ref|ZP_06152427.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-93-1035] gi|193935029|gb|ACF30853.1| NgoIM [Neisseria gonorrhoeae NCCP11945] gi|226511758|gb|EEH61103.1| modification methylase NgoBI [Neisseria gonorrhoeae 1291] gi|268584302|gb|EEZ48978.1| modification methylase NgoBI [Neisseria gonorrhoeae MS11] gi|268584435|gb|EEZ49111.1| modification methylase NgoBI [Neisseria gonorrhoeae PID18] gi|268586667|gb|EEZ51343.1| modification methylase NgoBI [Neisseria gonorrhoeae PID1] gi|268621369|gb|EEZ53769.1| modification methylase NgoBI [Neisseria gonorrhoeae PID332] gi|268625521|gb|EEZ57921.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-92-679] gi|268625849|gb|EEZ58249.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-93-1035] gi|317165226|gb|ADV08767.1| NgoIM [Neisseria gonorrhoeae TCDC-NG08107] Length = 315 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE D Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 188 >gi|59802299|ref|YP_209011.1| NgoIM [Neisseria gonorrhoeae FA 1090] gi|240081825|ref|ZP_04726368.1| NgoIM [Neisseria gonorrhoeae FA19] gi|59719194|gb|AAW90599.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA 1090] Length = 315 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE D Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 188 >gi|307152213|ref|YP_003887597.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822] gi|306982441|gb|ADN14322.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822] Length = 317 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 25/65 (38%), Positives = 40/65 (61%), Gaps = 9/65 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL-GIKPRLGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+RER++I+ L P + F++P P+ IKP L +ILE +T++ + Sbjct: 159 LNALDFGLPQKRERIFIVGCLEP-IPFEWPMPVRTIKP-LKEILE------TTVAASYYA 210 Query: 60 GHQKR 64 Q R Sbjct: 211 SEQIR 215 >gi|268597921|ref|ZP_06132088.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA19] gi|268551709|gb|EEZ46728.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA19] Length = 320 Score = 42.4 bits (98), Expect = 0.020, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE D Sbjct: 147 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 193 >gi|268595734|ref|ZP_06129901.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae 35/02] gi|291044897|ref|ZP_06570606.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|293397972|ref|ZP_06642178.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|268549123|gb|EEZ44541.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae 35/02] gi|291011791|gb|EFE03787.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|291611918|gb|EFF40987.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] Length = 320 Score = 42.4 bits (98), Expect = 0.020, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE D Sbjct: 147 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 193 >gi|239999928|ref|ZP_04719852.1| NgoIM [Neisseria gonorrhoeae 35/02] gi|240116859|ref|ZP_04730921.1| NgoIM [Neisseria gonorrhoeae PID1] gi|240127204|ref|ZP_04739865.1| NgoIM [Neisseria gonorrhoeae SK-93-1035] Length = 278 Score = 42.4 bits (98), Expect = 0.021, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE D Sbjct: 105 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 151 >gi|167747653|ref|ZP_02419780.1| hypothetical protein ANACAC_02374 [Anaerostipes caccae DSM 14662] gi|239625035|ref|ZP_04668066.1| modification methylase Rho11sI [Clostridiales bacterium 1_7_47_FAA] gi|167653015|gb|EDR97144.1| hypothetical protein ANACAC_02374 [Anaerostipes caccae DSM 14662] gi|239521421|gb|EEQ61287.1| modification methylase Rho11sI [Clostridiales bacterium 1_7_47FAA] Length = 504 Score = 42.4 bits (98), Expect = 0.021, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 36/57 (63%), Gaps = 2/57 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + A ++G+PQ RER+Y++ + +F FP P+ RL DILE+ +D+K +S+ Sbjct: 158 LNAKNYGIPQNRERVYLVLIKKECDNGKFVFPEPMENGRRLMDILEDEVDEKYYLSD 214 >gi|166367724|ref|YP_001659997.1| modification methylase NgoBI [Microcystis aeruginosa NIES-843] gi|166090097|dbj|BAG04805.1| modification methylase NgoBI [Microcystis aeruginosa NIES-843] Length = 330 Score = 42.0 bits (97), Expect = 0.028, Method: Compositional matrix adjust. Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 1/69 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +FG+PQ+RER++I+ F + F +P P + L +ILEE++ D S ++ + Sbjct: 156 LNALNFGLPQKRERIFIVGF-REARGFIWPKPALSRTTLTEILEENVSDFYYASARIQKS 214 Query: 61 HQKRKENNK 69 ++E K Sbjct: 215 RFLKREGKK 223 >gi|189096062|pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Score = 42.0 bits (97), Expect = 0.031, Method: Compositional matrix adjust. Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +N+ E + I GKG + TLSA Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGSGERIYSTRGIAITLSA 253 >gi|49476998|ref|YP_035184.1| modification methylase HpaII (cytosine-specific methyltransferase HpaII) [Bacillus thuringiensis serovar konkukian str. 97-27] gi|49328554|gb|AAT59200.1| modification methylase HpaII (Cytosine-specific methyltransferase HpaII) [Bacillus thuringiensis serovar konkukian str. 97-27] Length = 373 Score = 42.0 bits (97), Expect = 0.032, Method: Compositional matrix adjust. Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 11/90 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPR----------LGDILEEHIDD 49 + + +FGVPQ R R+YI+ F K + PL P+ + D+LE+++ + Sbjct: 164 LNSRNFGVPQNRPRIYIVGFNQRLYRDKIESMPLFTLPKSRSRKKIYDSVRDVLEDNVGE 223 Query: 50 KSTISNKLWEGHQKRKENNKIAGKGFGYGL 79 K +S E +K KE G GFGY + Sbjct: 224 KYYLSEGYLETLKKHKEAQGKKGNGFGYSI 253 >gi|319956919|ref|YP_004168182.1| DNA-cytosine methyltransferase [Nitratifractor salsuginis DSM 16511] gi|319419323|gb|ADV46433.1| DNA-cytosine methyltransferase [Nitratifractor salsuginis DSM 16511] Length = 394 Score = 41.6 bits (96), Expect = 0.034, Method: Compositional matrix adjust. Identities = 19/56 (33%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Query: 6 FGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 +G+PQ RER +++ F + + F+FP + +K L D+LE +D+K +++K E Sbjct: 150 YGLPQNRERYFLVGFKSKTAGERFRFPKKVPLKLILSDVLENKVDEKYYLTDKALE 205 >gi|50513617|pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna Methyltransferase: An Insight Into Protein-Protein Interactions gi|50513618|pdb|1SVU|B Chain B, Structure Of The Q237w Mutant Of Hhai Dna Methyltransferase: An Insight Into Protein-Protein Interactions Length = 327 Score = 41.6 bits (96), Expect = 0.037, Method: Compositional matrix adjust. Identities = 35/103 (33%), Positives = 51/103 (49%), Gaps = 12/103 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKGFGYG-LFFENSATTNTLSA 92 + +N+ E + I GKG G+G + TLSA Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKG-GWGERIYSTRGIAITLSA 253 >gi|118138268|pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances Sequence Discrimination Of Dna Methyltransferase M.Hhai Length = 327 Score = 41.2 bits (95), Expect = 0.044, Method: Compositional matrix adjust. Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +N+ E + I GKG + TLSA Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253 >gi|159795737|pdb|2Z6A|A Chain A, S-Adenosyl-L-Methionine-Dependent Methyl Transfer: Observable Precatalytic Intermediates During Dna Cytosine Methylation Length = 327 Score = 41.2 bits (95), Expect = 0.045, Method: Compositional matrix adjust. Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +N+ E + I GKG + TLSA Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253 >gi|160877870|pdb|2Z6U|A Chain A, Ternary Structure Of The Glu119ala M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 Score = 41.2 bits (95), Expect = 0.046, Method: Compositional matrix adjust. Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +N+ E + I GKG + TLSA Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253 >gi|127455|sp|P05102|MTH1_HAEPH RecName: Full=Modification methylase HhaI; Short=M.HhaI; AltName: Full=Cytosine-specific methyltransferase HhaI gi|1065144|pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna And S-Adenosyl-L-Homocysteine gi|1942412|pdb|3MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Unmodified Dna And Adohcy gi|1942415|pdb|4MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Native Dna And Adohcy gi|2392799|pdb|5MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Hemimethylated Dna And Adohcy gi|3660437|pdb|6MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Adohcy And Dna Containing 4'-Thio-2'deoxycytidine At The Target gi|4139672|pdb|7MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX gi|4139675|pdb|8MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX gi|4139680|pdb|9MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX gi|4558252|pdb|10MH|A Chain A, Ternary Structure Of Hhai Methyltransferase With Adohcy And Hemimethylated Dna Containing 5,6-Dihydro-5-Azacytosine At The Target gi|4699814|pdb|2HMY|B Chain B, Binary Complex Of Hhai Methyltransferase With Adomet Formed In The Presence Of A Short Nonpsecific Dna Oligonucleotide gi|24158912|pdb|1M0E|A Chain A, Zebularine: A Novel Dna Methylation Inhibitor That Forms A Covalent Complex With Dna Methyltransferase gi|52695513|pdb|1SKM|A Chain A, Hhai Methyltransferase In Complex With Dna Containing An Abasic South Carbocyclic Sugar At Its Target Site gi|85544385|pdb|2C7O|A Chain A, Hhai Dna Methyltransferase Complex With 13mer Oligonucleotide Containing 2-Aminopurine Adjacent To The Target Base (Pcgc:gmgc) And Sah gi|85544388|pdb|2C7P|A Chain A, Hhai Dna Methyltransferase Complex With Oligonucleotide Containing 2-Aminopurine Opposite To The Target Base ( Gcgc:gmpc) And Sah gi|85544391|pdb|2C7Q|A Chain A, Hhai Dna Methyltransferase Complex With Oligonucleotide Containing 2-Aminopurine Outside The Recognition Sequence (Paired With G) And Sah gi|116667789|pdb|2HR1|A Chain A, Ternary Structure Of Wt M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy gi|157831356|pdb|1HMY|A Chain A, Crystal Structure Of The Hhal Dna Methyltransferase Complexed With S-Adenosyl-L-Methionine gi|290560089|pdb|3EEO|A Chain A, M. Hhai Co-Crystallized With Synthetic Dsdna Containing A Propane Diol In Place Of The Deoxycytidine Residue Targeted For Methylation. gi|148949|gb|AAA24989.1| DNA methylase [Haemophilus haemolyticus] Length = 327 Score = 41.2 bits (95), Expect = 0.046, Method: Compositional matrix adjust. Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +N+ E + I GKG + TLSA Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253 >gi|161761159|pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 Score = 41.2 bits (95), Expect = 0.046, Method: Compositional matrix adjust. Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +N+ E + I GKG + TLSA Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253 >gi|2599488|gb|AAB84141.1| FauI DNA methyltransferase [Flavobacterium aquatile] Length = 343 Score = 41.2 bits (95), Expect = 0.046, Method: Compositional matrix adjust. Identities = 29/98 (29%), Positives = 50/98 (51%), Gaps = 4/98 (4%) Query: 1 MKACDFGVPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + + +FGVPQ+RER++I+ F + + FKFP P+ ++ +L+E ID K+ K W Sbjct: 165 LNSSEFGVPQKRERVFIVGFRDFDDYLNFKFPQPITLEGS-KIVLKEVIDKKADTEEK-W 222 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 QK + + G + + NT+S+ K Sbjct: 223 FFSQKAVDGMLRVREKMNKGRVQDLNQPCNTISSHLAK 260 >gi|148826164|ref|YP_001290917.1| modification methylase [Haemophilus influenzae PittEE] gi|148716324|gb|ABQ98534.1| modification methylase [Haemophilus influenzae PittEE] gi|162532590|gb|ABY16693.1| probable methylase [Haemophilus influenzae] gi|309973308|gb|ADO96509.1| Probable cytosine-specific DNA methyltransferase [Haemophilus influenzae R2846] Length = 409 Score = 41.2 bits (95), Expect = 0.048, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + ++G+PQ RER++++ F P F FP + ++ + D LE++ D K + K Sbjct: 181 MNSKNYGIPQHRERIFVVGFKTPPQGGFMFPAEIPLEHSMQDFLEDYTDSKYYLKEK 237 >gi|291530357|emb|CBK95942.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3] Length = 317 Score = 41.2 bits (95), Expect = 0.051, Method: Compositional matrix adjust. Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 7/75 (9%) Query: 3 ACDFGVPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEEHID-DKS----TISN 55 ACD+G+PQ R R YI+ F SV F FP ++ + D++++ DKS S Sbjct: 145 ACDYGIPQHRTRTYIVAFRDFAKSVLFDFPQKQQLQKHIFDVIDKRTKADKSFYLDCNSR 204 Query: 56 KLWEGHQKRKENNKI 70 + ++ Q +NN+I Sbjct: 205 QYYKMKQSIDDNNQI 219 >gi|237742049|ref|ZP_04572530.1| modification methylase HpaII [Fusobacterium sp. 4_1_13] gi|229429697|gb|EEO39909.1| modification methylase HpaII [Fusobacterium sp. 4_1_13] Length = 385 Score = 40.8 bits (94), Expect = 0.056, Method: Compositional matrix adjust. Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 9/84 (10%) Query: 3 ACDFGVPQRRERLYII----DFLNPSVEFKFPTP-----LGIKPRLGDILEEHIDDKSTI 53 A DFG+PQRR R YII D L + P P L I L D+LE D K + Sbjct: 170 AKDFGIPQRRLRTYIIGFRKDLLQDNNFILEPLPKNRTDLKIYKNLNDLLEFQNDIKYYV 229 Query: 54 SNKLWEGHQKRKENNKIAGKGFGY 77 ++ + ++ K + + G GFG+ Sbjct: 230 ASGYLKTLERHKLKHSLKGNGFGF 253 >gi|323650448|gb|ADX97301.1| M.Fnu4HI [Fusobacterium nucleatum] Length = 351 Score = 40.8 bits (94), Expect = 0.059, Method: Compositional matrix adjust. Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 7/74 (9%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEE-HIDDKSTIS-- 54 + A D+G +PQ RER+YI+ F N F+FP PL + + D+LE+ +ID+K S Sbjct: 145 LNAKDYGNIPQNRERIYIVGFKNEEHFKNFEFPFPLELTRNIEDMLEKNNIDEKYYYSKE 204 Query: 55 -NKLWEGHQKRKEN 67 NK ++ +K N Sbjct: 205 KNKFYDTLEKEITN 218 >gi|170757755|ref|YP_001781752.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str. Okra] gi|169122967|gb|ACA46803.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str. Okra] Length = 561 Score = 40.8 bits (94), Expect = 0.060, Method: Compositional matrix adjust. Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 4/63 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A D+G+PQ RER++I+ ++ + F FP RL D LE +D+K IS K Sbjct: 149 LNAKDYGIPQNRERVFIVSIRKDIDTGI-FSFPKGFDNGLRLKDFLENEVDEKYYISEKA 207 Query: 58 WEG 60 +G Sbjct: 208 TQG 210 >gi|126660265|ref|ZP_01731380.1| putative DNA modification methylase (N.MgoV) [Cyanothece sp. CCY0110] gi|126618440|gb|EAZ89194.1| putative DNA modification methylase (N.MgoV) [Cyanothece sp. CCY0110] Length = 458 Score = 40.8 bits (94), Expect = 0.062, Method: Compositional matrix adjust. Identities = 19/48 (39%), Positives = 30/48 (62%), Gaps = 3/48 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEE 45 + + DFGVPQ RER++I+ ++FP PL ++ RL D+L+E Sbjct: 173 INSYDFGVPQNRERVFIVGIRKDRKNCHHYQFPKPLKVQIRLLDVLDE 220 >gi|326798326|ref|YP_004316145.1| DNA-cytosine methyltransferase [Sphingobacterium sp. 21] gi|326549090|gb|ADZ77475.1| DNA-cytosine methyltransferase [Sphingobacterium sp. 21] Length = 409 Score = 40.8 bits (94), Expect = 0.064, Method: Compositional matrix adjust. Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 3/80 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-EEHIDDKSTISNKL 57 + A +FGVPQ RER++I+ + F++P PL + DI EE + K +S + Sbjct: 229 VNAKNFGVPQNRERIFIVGYRKDLGIDRFEYPEPLDEPVAIEDIFEEEEVSVKYYLSTQY 288 Query: 58 WEGHQKRKENNKIAGKGFGY 77 + ++ K ++ G GFG+ Sbjct: 289 LKTLKEHKARHESKGNGFGF 308 >gi|308185227|ref|YP_003929360.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori SJM180] gi|308061147|gb|ADO03043.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori SJM180] Length = 317 Score = 40.4 bits (93), Expect = 0.075, Method: Compositional matrix adjust. Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 16/102 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + DFG+PQ+R R++I+ S +EF FP + K D+L++ ++ K IS K+ Sbjct: 141 LNTLDFGIPQQRNRVFIVALRKNSFTNLEFVFPAKIPCKISTLDLLDKQVELKYFISQKM 200 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATT---NTLSARYYK 96 + I GKG G E S T TL+A +K Sbjct: 201 IK---------TILGKG-TKGYIVEPSIDTPIAKTLTATMHK 232 >gi|296126993|ref|YP_003634245.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563] gi|296018809|gb|ADG72046.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563] Length = 324 Score = 40.4 bits (93), Expect = 0.079, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 4/48 (8%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE 45 + A D+G+PQ+RER+YI+ F LN +F FP P+ + L D L E Sbjct: 152 LNASDYGIPQKRERIYIVCFRKDLNIK-KFDFPKPIELIKHLEDFLLE 198 >gi|268607976|ref|ZP_06141707.1| cytosine-specific DNA-methyltransferase Sau96I [Ruminococcus flavefaciens FD-1] Length = 407 Score = 40.4 bits (93), Expect = 0.083, Method: Compositional matrix adjust. Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43 + A D+GV Q+RERL I L ++F FPTP KP L D+L Sbjct: 224 LNAWDYGVAQKRERLITIGIRNDLTNQIKFTFPTPHEYKPVLRDVL 269 >gi|12084381|pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase Mutant (T250g) In Complex With Dna And Adohcy gi|85544394|pdb|2C7R|A Chain A, Hhai Dna Methyltransferase (T250g Mutant) Complex With Oligonucleotide Containing 2-Aminopurine As A Target Base (Gpgc:gmgc) And Sah Length = 327 Score = 40.4 bits (93), Expect = 0.092, Method: Compositional matrix adjust. Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 10/84 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKG 74 + +N+ E + I GKG Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKG 235 >gi|317057160|ref|YP_004105627.1| XRE family transcriptional regulator [Ruminococcus albus 7] gi|315449429|gb|ADU22993.1| transcriptional regulator, XRE family [Ruminococcus albus 7] Length = 407 Score = 40.0 bits (92), Expect = 0.097, Method: Compositional matrix adjust. Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43 + A D+GV Q+RERL I L + F FPTP KP L D+L Sbjct: 224 LNAWDYGVAQKRERLITIGIRNNLTDKISFSFPTPHEYKPVLRDVL 269 >gi|54297036|ref|YP_123405.1| hypothetical protein lpp1078 [Legionella pneumophila str. Paris] gi|53750821|emb|CAH12229.1| hypothetical protein lpp1078 [Legionella pneumophila str. Paris] Length = 320 Score = 40.0 bits (92), Expect = 0.10, Method: Compositional matrix adjust. Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 6/66 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + + DFGVPQ+RER YI+ F++ +V F+FP G+ L ILE+ + I NK + Sbjct: 146 LNSLDFGVPQKRERTYIVGFID-NVPFEFPKG-GVPFNLESILEK----EQQIPNKYYAS 199 Query: 61 HQKRKE 66 R++ Sbjct: 200 DYIRQK 205 >gi|219855710|ref|YP_002472832.1| hypothetical protein CKR_2367 [Clostridium kluyveri NBRC 12016] gi|219569434|dbj|BAH07418.1| hypothetical protein [Clostridium kluyveri NBRC 12016] Length = 419 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 14/101 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFP--TPLGIKPRLGDILEEHIDDKSTISN 55 M A +FG+PQRRER+ I+ F +P + +F FP P P + IL EH +IS Sbjct: 245 MDAQNFGLPQRRERIVIVGF-HPDLGINDFSFPKGNPDNKVP-INAIL-EHNPTGYSISK 301 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 +L E + +K++ K + F+++ NTL A Y+K Sbjct: 302 RLQESYLFKKDDGK------PQIVDFDSTIQVNTLVASYHK 336 >gi|153955289|ref|YP_001396054.1| DNA methylase [Clostridium kluyveri DSM 555] gi|146348147|gb|EDK34683.1| Predicted DNA methylase [Clostridium kluyveri DSM 555] Length = 416 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 14/101 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFP--TPLGIKPRLGDILEEHIDDKSTISN 55 M A +FG+PQRRER+ I+ F +P + +F FP P P + IL EH +IS Sbjct: 242 MDAQNFGLPQRRERIVIVGF-HPDLGINDFSFPKGNPDNKVP-INAIL-EHNPTGYSISK 298 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 +L E + +K++ K + F+++ NTL A Y+K Sbjct: 299 RLQESYLFKKDDGK------PQIVDFDSTIQVNTLVASYHK 333 >gi|220930232|ref|YP_002507141.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10] gi|220000560|gb|ACL77161.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10] Length = 416 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 14/101 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFP--TPLGIKPRLGDILEEHIDDKSTISN 55 M A +FG+PQRRER+ I+ F +P + +F FP P P + IL EH +IS Sbjct: 242 MDAQNFGLPQRRERIVIVGF-HPDLGINDFSFPKGNPDNKVP-INAIL-EHNPTGYSISK 298 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 +L E + +K++ K + F+++ NTL A Y+K Sbjct: 299 RLQESYLFKKDDGK------PQIVDFDSTIQVNTLVASYHK 333 >gi|79835495|gb|ABB52098.1| Mod [Arthrospira platensis] Length = 412 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILE 44 + A DFG+PQ R+R++I+ +N F+FP PL P+L + +E Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206 >gi|284051619|ref|ZP_06381829.1| DNA-cytosine methyltransferase [Arthrospira platensis str. Paraca] Length = 443 Score = 40.0 bits (92), Expect = 0.12, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILE 44 + A DFG+PQ R+R++I+ +N F+FP PL P+L + +E Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206 >gi|315506801|ref|YP_004085688.1| DNA-cytosine methyltransferase [Micromonospora sp. L5] gi|315413420|gb|ADU11537.1| DNA-cytosine methyltransferase [Micromonospora sp. L5] Length = 412 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 8/73 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 ++A D+GVPQ R R ++ F +P P G P +GD L E + ++ W Sbjct: 148 LQASDYGVPQLRPRFILVALKTEDAPYFHWPEPQGAPPTVGDTLVELMAERG------WR 201 Query: 60 GHQKRKEN-NKIA 71 G Q E NK+A Sbjct: 202 GAQAWAERANKVA 214 >gi|269119458|ref|YP_003307635.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386] gi|268613336|gb|ACZ07704.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386] Length = 383 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 4/76 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK---STISNKL 57 + A D+ +PQRR+R++ + ++ FP P+ +K RL D+LE+ + +K I N Sbjct: 148 LNAKDYRIPQRRKRVFCVSIFGNE-KYVFPKPVELKLRLRDMLEKEVPEKYYLKDIDNNK 206 Query: 58 WEGHQKRKENNKIAGK 73 + + +K+ I+G+ Sbjct: 207 FHVNMNKKQGYFISGE 222 >gi|291570812|dbj|BAI93084.1| cytosine-specific DNA methyltransferase [Arthrospira platensis NIES-39] Length = 443 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILE 44 + A DFG+PQ R+R++I+ +N F+FP PL P+L + +E Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206 >gi|237739124|ref|ZP_04569605.1| C-5 cytosine-specific DNA methylase [Fusobacterium sp. 2_1_31] gi|229423724|gb|EEO38771.1| C-5 cytosine-specific DNA methylase [Fusobacterium sp. 2_1_31] Length = 361 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDIL 43 + A ++GV Q+RERL I+ D +N + F FPTP KP L DIL Sbjct: 179 LNAWNYGVAQKRERLIIVGIRNDLIN-KLNFLFPTPHKYKPVLRDIL 224 >gi|291549830|emb|CBL26092.1| DNA-methyltransferase (dcm) [Ruminococcus torques L2-14] Length = 410 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDIL 43 + A D+GVPQ+RERL I N VE F FP KP L DIL Sbjct: 227 LNAWDYGVPQKRERLITIGIRNDLVEKTSFTFPKEQEYKPVLRDIL 272 >gi|319779706|ref|YP_004130619.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9] gi|317109730|gb|ADU92476.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9] Length = 329 Score = 39.7 bits (91), Expect = 0.16, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDIL 43 + +CD+G+PQ R R++++ F EFKFP P + + DIL Sbjct: 152 LNSCDYGIPQSRARIFMVAFREDLKHQEFKFPAPKNLDKYVEDIL 196 >gi|320326214|gb|EFW82269.1| cytosine-specific DNA-methyltransferase [Pseudomonas syringae pv. glycinea str. B076] Length = 448 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 30/53 (56%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +FG+PQ RER+YI+ L P +F +P + +L++H D +S ++ Sbjct: 153 NFGIPQIRERVYIVGSLIPLEDFSWPKKTDAPTSIDTVLDDHPADAKKLSTQV 205 >gi|312281368|ref|YP_004022731.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii 177R1B] gi|312181897|gb|ADQ42066.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii 177R1B] Length = 319 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + + ++G VPQ RER+YI+ FL+ S+ FKFP P+ + + DI++ Sbjct: 146 LNSLEYGNVPQNRERVYIVGFLDKSMYEAFKFPEPVSLTVTIHDIIK 192 >gi|309379398|emb|CBX21965.1| unnamed protein product [Neisseria lactamica Y92-1009] Length = 223 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Query: 7 GVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 G PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 2 GFPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 52 >gi|167920593|ref|ZP_02507684.1| cytosine-specific DNA methylase [Burkholderia pseudomallei BCC215] Length = 454 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 31/53 (58%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 +FG+PQ RER+YI+ P F++P + + IL+++ DD +S ++ Sbjct: 153 NFGIPQIRERVYIVGSTEPLTSFQWPEMIDATTSIETILDKNPDDARQLSAQV 205 >gi|293596744|ref|ZP_05263998.2| DNA-methyltransferase [Listeria monocytogenes J2818] gi|293592003|gb|EFG00338.1| DNA-methyltransferase [Listeria monocytogenes J2818] Length = 327 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 28/48 (58%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + A DFG+PQ RER++++ L + F+FP + L D ++ +D Sbjct: 150 LNARDFGIPQNRERVFVVSVLGNNTGFQFPEKIESAMSLKDYIDFEVD 197 >gi|254901064|ref|ZP_05260988.1| DNA-methyltransferase (cytosine-specific) [Listeria monocytogenes J0161] Length = 320 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 28/48 (58%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + A DFG+PQ RER++++ L + F+FP + L D ++ +D Sbjct: 143 LNARDFGIPQNRERVFVVSVLGNNTGFQFPEKIESAMSLKDYIDFEVD 190 >gi|160934346|ref|ZP_02081733.1| hypothetical protein CLOLEP_03217 [Clostridium leptum DSM 753] gi|156867019|gb|EDO60391.1| hypothetical protein CLOLEP_03217 [Clostridium leptum DSM 753] Length = 433 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDIL 43 + A D+GV Q+RERL I N V+ F FP P KP L DIL Sbjct: 251 LNAWDYGVAQKRERLITIGIRNDLVQKIKFDFPAPHKYKPVLRDIL 296 >gi|317500279|ref|ZP_07958506.1| cytosine-specific methyltransferase [Lachnospiraceae bacterium 8_1_57FAA] gi|331087487|ref|ZP_08336423.1| hypothetical protein HMPREF1025_00006 [Lachnospiraceae bacterium 3_1_46FAA] gi|316898322|gb|EFV20366.1| cytosine-specific methyltransferase [Lachnospiraceae bacterium 8_1_57FAA] gi|330410467|gb|EGG89898.1| hypothetical protein HMPREF1025_00006 [Lachnospiraceae bacterium 3_1_46FAA] Length = 410 Score = 38.9 bits (89), Expect = 0.21, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A DFGVPQ+RERL + N V F FP KP L DIL Sbjct: 227 LNAWDFGVPQKRERLITVGIRNDLVGKVSFSFPKEHNYKPVLRDIL 272 >gi|167751358|ref|ZP_02423485.1| hypothetical protein EUBSIR_02344 [Eubacterium siraeum DSM 15702] gi|167655604|gb|EDR99733.1| hypothetical protein EUBSIR_02344 [Eubacterium siraeum DSM 15702] Length = 316 Score = 38.9 bits (89), Expect = 0.21, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK 50 ACD+G+PQ R R YI+ F + F+FP ++ L D++++ + K Sbjct: 145 ACDYGIPQHRTRTYIVAFKSQKACDSFRFPEKCELQKHLFDVIDKTVKGK 194 >gi|189339547|pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 10/102 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+RE +Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKRENIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +N+ E + I GKG + TLSA Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253 >gi|189096047|pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 10/102 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+ ER+Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKNERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +N+ E + I GKG + TLSA Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253 >gi|148380278|ref|YP_001254819.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum A str. ATCC 3502] gi|148289762|emb|CAL83870.1| putative C-5 cytosine-specific DNA methylase [Clostridium botulinum A str. ATCC 3502] Length = 340 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 5 DFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 D+G PQ RER++ I + FKFP P+ + IL+E++D K NK Sbjct: 156 DYGSPQSRERMFCISIRKDIDACLFKFPKPMDSIVPINTILDEYVDKKYYCINK 209 >gi|328947611|ref|YP_004364948.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] gi|328447935|gb|AEB13651.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] Length = 391 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 16/32 (50%), Positives = 21/32 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32 + A DFGVPQ R+R +I+ NP+ E PTP Sbjct: 158 LCATDFGVPQTRKRFFILASKNPTTELSAPTP 189 >gi|291551321|emb|CBL27583.1| DNA-methyltransferase (dcm) [Ruminococcus torques L2-14] Length = 595 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 15/46 (32%), Positives = 30/46 (65%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43 + + ++G+PQ RERL+++ F L + +F FP P+ ++ ++ D L Sbjct: 368 LNSKNYGIPQNRERLFVVGFREDLELAKKFSFPNPIPLRKKMKDFL 413 >gi|258511120|ref|YP_003184554.1| DNA-cytosine methyltransferase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|257477846|gb|ACV58165.1| DNA-cytosine methyltransferase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 395 Score = 38.9 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32 + A D+GVPQ+RER++I+ F + ++E+ FP P Sbjct: 178 LNAADYGVPQKRERVFIVGFRSDLNIEWSFPNP 210 >gi|158431504|pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy Length = 327 Score = 38.5 bits (88), Expect = 0.28, Method: Compositional matrix adjust. Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 10/102 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51 + A D+G+PQ+RE +Y+I F N F+FP P + + D+L EH ID K Sbjct: 152 LNALDYGIPQKREAIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 52 TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +N+ E + I GKG + TLSA Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253 >gi|291544225|emb|CBL17334.1| DNA-methyltransferase (dcm) [Ruminococcus sp. 18P13] Length = 407 Score = 38.5 bits (88), Expect = 0.28, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43 + A ++GV Q+RERL I L ++F FPTP KP L D+L Sbjct: 224 LNAWNYGVAQKRERLITIGIRNDLTNQIKFTFPTPHEYKPVLRDVL 269 >gi|320326171|gb|EFW82226.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea str. B076] Length = 404 Score = 38.5 bits (88), Expect = 0.28, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32 + A D+GVPQ+RER+++I F + VE+ FP P Sbjct: 181 VNAADYGVPQKRERVFLIGFRDDLEVEWSFPAP 213 >gi|254933776|ref|ZP_05267135.1| DNA-cytosine methyltransferase [Listeria monocytogenes HPB2262] gi|293585336|gb|EFF97368.1| DNA-cytosine methyltransferase [Listeria monocytogenes HPB2262] Length = 325 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 29/48 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + A D+G+PQ RER++++ L + EF+FP + L D ++ +D Sbjct: 143 LNARDYGIPQNRERVFVVSVLGNNKEFQFPEKVKPVKSLKDYIDFDVD 190 >gi|332310450|gb|EGJ23545.1| DNA-methyltransferase (Dcm) [Listeria monocytogenes str. Scott A] Length = 325 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 29/48 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + A D+G+PQ RER++++ L + EF+FP + L D ++ +D Sbjct: 143 LNARDYGIPQNRERVFVVSVLGNNKEFQFPEKVKPVKSLKDYIDFDVD 190 >gi|314055145|ref|YP_004063483.1| putative cytosine-specific methyltransferase [Ostreococcus tauri virus 2] gi|313575036|emb|CBI70049.1| putative cytosine-specific methyltransferase [Ostreococcus tauri virus 2] Length = 349 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 27/43 (62%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 +KA + GVPQ+RERL+I+ + F+FP P + L DIL Sbjct: 152 LKAHEHGVPQKRERLFIVGSRDADFTFEFPEPSNNEVGLKDIL 194 >gi|310657624|ref|YP_003935345.1| cytosine-specific methyltransferase [Clostridium sticklandii DSM 519] gi|308824402|emb|CBH20440.1| Cytosine-specific methyltransferase [Clostridium sticklandii] Length = 326 Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 5/70 (7%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISN 55 M + +FGVPQ+RER+ II F + +EF FP + L ++E + +K S Sbjct: 154 MNSVNFGVPQKRERVIIIGFRKDLELEFNFPEEIIANEWEFLNLSMVIESEVSEKYFFSE 213 Query: 56 KLWEGHQKRK 65 K +G K++ Sbjct: 214 KAVQGMLKKR 223 >gi|309776146|ref|ZP_07671137.1| CPG DNA methylase [Erysipelotrichaceae bacterium 3_1_53] gi|308916097|gb|EFP61846.1| CPG DNA methylase [Erysipelotrichaceae bacterium 3_1_53] Length = 456 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48 + A D G+PQ RER ++I L ++FP + ++ D+LEE +D Sbjct: 224 VDAADHGIPQHRERCFMISILG-EYSYRFPAGRKLHIQMKDLLEEKVD 270 >gi|325269502|ref|ZP_08136118.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] gi|324988121|gb|EGC20088.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] Length = 393 Score = 38.5 bits (88), Expect = 0.34, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 D+GVPQ R+R+Y I F +FK+P P+ + + D L++ + + + K Sbjct: 184 DYGVPQSRDRIYCIGF-KKETDFKYPAPIPLVKTVYDYLQKKFEKRYLLRQK 234 >gi|329769727|ref|ZP_08261128.1| hypothetical protein HMPREF0433_00892 [Gemella sanguinis M325] gi|328838089|gb|EGF87707.1| hypothetical protein HMPREF0433_00892 [Gemella sanguinis M325] Length = 406 Score = 38.5 bits (88), Expect = 0.34, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 32/49 (65%), Gaps = 3/49 (6%) Query: 5 DFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK 50 D+G +PQ RER+YI+ FL +F+FP + ++ +L DI++ I +K Sbjct: 159 DYGNIPQNRERIYIVGFLEKESYDKFEFPNEIKLETKLSDIIDFDIKEK 207 >gi|167630879|ref|YP_001681378.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1] gi|167593619|gb|ABZ85367.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1] Length = 319 Score = 38.5 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + A D+GVPQ R R+ + N + +F FPT + P +G+IL + + I K W Sbjct: 145 LNASDYGVPQLRPRVVFVAIRNDLAADFTFPTEIMHAPTVGEILGDLMGANGWIGVKQW 203 >gi|331091845|ref|ZP_08340677.1| hypothetical protein HMPREF9477_01320 [Lachnospiraceae bacterium 2_1_46FAA] gi|330402744|gb|EGG82311.1| hypothetical protein HMPREF9477_01320 [Lachnospiraceae bacterium 2_1_46FAA] Length = 410 Score = 38.1 bits (87), Expect = 0.35, Method: Compositional matrix adjust. Identities = 21/46 (45%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A DFGVPQ+RERL + N V F FP KP L D+L Sbjct: 227 LNAWDFGVPQKRERLITVGIRNDLVGKVSFSFPKEHDYKPVLRDVL 272 >gi|255018626|ref|ZP_05290752.1| DNA-methyltransferase (cytosine-specific) [Listeria monocytogenes FSL F2-515] Length = 172 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 27/44 (61%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE 44 + A DFG+PQ RER++++ L + EF+FP + L D ++ Sbjct: 110 LNARDFGIPQNRERVFVVSVLGNNKEFQFPEKVEPVKSLKDYID 153 >gi|329767116|ref|ZP_08258644.1| hypothetical protein HMPREF0428_00341 [Gemella haemolysans M341] gi|328837841|gb|EGF87466.1| hypothetical protein HMPREF0428_00341 [Gemella haemolysans M341] Length = 396 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 32/49 (65%), Gaps = 3/49 (6%) Query: 5 DFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK 50 D+G VPQ RER+YI+ FL +F+FP + ++ +L DI++ I +K Sbjct: 149 DYGNVPQNRERIYIVGFLEKESFDKFEFPKKIKLETKLSDIIDFDIKEK 197 >gi|288929280|ref|ZP_06423125.1| modification methylase HphIA (Cytosine-specific methyltransferase HphIA) [Prevotella sp. oral taxon 317 str. F0108] gi|288329382|gb|EFC67968.1| modification methylase HphIA (Cytosine-specific methyltransferase HphIA) [Prevotella sp. oral taxon 317 str. F0108] Length = 370 Score = 38.1 bits (87), Expect = 0.39, Method: Compositional matrix adjust. Identities = 15/28 (53%), Positives = 23/28 (82%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK 28 +KA +FGVP++RERL++I LN S+E + Sbjct: 159 VKAIEFGVPEKRERLFVIGTLNKSIELE 186 >gi|1709163|sp|P50188|MTN1_NOCAE RecName: Full=Modification methylase NaeI; Short=M.NaeI; AltName: Full=Cytosine-specific methyltransferase NaeI gi|775103|gb|AAC43325.1| NaeI modification methyltransferase [Lechevalieria aerocolonigenes] Length = 413 Score = 38.1 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 7/64 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A DFGVPQ R R ++ N + F +P P G P +G+ L K ++ WE Sbjct: 148 LHASDFGVPQLRPRFVLVALQNKFAPYFTWPEPTGAAPTVGETL------KDLMAADGWE 201 Query: 60 GHQK 63 G ++ Sbjct: 202 GAEE 205 >gi|34451619|gb|AAQ72366.1| TspRI methylase [Thermus sp. R] Length = 431 Score = 38.1 bits (87), Expect = 0.40, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32 + A DFGVPQ R+R++ + + P +EF++P P Sbjct: 215 LNAADFGVPQHRKRIFFVG-VRPGIEFRWPRP 245 >gi|218439646|ref|YP_002377975.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424] gi|218172374|gb|ACK71107.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424] Length = 320 Score = 38.1 bits (87), Expect = 0.40, Method: Compositional matrix adjust. Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 9/71 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ+RER++I+ L+P + F +P L +ILE + +S+ + Sbjct: 159 LNALDFGLPQKRERIFIVGCLDP-IPFIWPNSTRPFKPLQEILE------TQVSSSYYAS 211 Query: 61 HQKRKENNKIA 71 Q RK N++A Sbjct: 212 EQIRK--NRLA 220 >gi|218135211|ref|ZP_03464015.1| hypothetical protein BACPEC_03116 [Bacteroides pectinophilus ATCC 43243] gi|217990596|gb|EEC56607.1| hypothetical protein BACPEC_03116 [Bacteroides pectinophilus ATCC 43243] Length = 344 Score = 38.1 bits (87), Expect = 0.42, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHID 48 + A ++GVPQ+RERL I N V E++FP KP L D+L + D Sbjct: 152 LNAWNYGVPQKRERLITIGIRNDLVGKTEYRFPKAHSYKPVLRDVLLDCPD 202 >gi|291528318|emb|CBK93904.1| DNA-methyltransferase (dcm) [Eubacterium rectale M104/1] Length = 344 Score = 38.1 bits (87), Expect = 0.45, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHID 48 + A ++GVPQ+RERL I N V E++FP KP L D+L + D Sbjct: 152 LNAWNYGVPQKRERLITIGIRNDLVGKTEYRFPKAHSYKPVLRDVLLDCPD 202 >gi|291561285|emb|CBL40084.1| DNA-methyltransferase (dcm) [butyrate-producing bacterium SS3/4] Length = 247 Score = 37.7 bits (86), Expect = 0.49, Method: Compositional matrix adjust. Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 4/80 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + + D+GVPQ RER++I+ + F+FP + ++ +GD+L+E + + +S + Sbjct: 153 LNSADYGVPQGRERVFIVSIRKDVDDHSFRFPPVIPLEMCMGDLLDEEVPAEFYLSEEKT 212 Query: 59 EGHQKRKENN--KIAGKGFG 76 + + N+ IA +G G Sbjct: 213 QSVIRHDSNHPGHIADRGGG 232 >gi|127427|sp|P17044|MTBF_BACSU RecName: Full=Modification methylase BsuFI; Short=M.BsuFI; AltName: Full=Cytosine-specific methyltransferase BsuFI gi|39984|emb|CAA35888.1| unnamed protein product [Bacillus subtilis] Length = 409 Score = 37.7 bits (86), Expect = 0.50, Method: Compositional matrix adjust. Identities = 35/101 (34%), Positives = 52/101 (51%), Gaps = 14/101 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFP--TPLGIKPRLGDILEEHIDDKSTISN 55 M A +FG+PQRRER+ I+ F +P + +F FP P P + IL EH +IS Sbjct: 241 MDAQNFGLPQRRERIVIVGF-HPDLGINDFSFPKGNPDNKVP-INAIL-EHNPTGYSISK 297 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 +L E + +K++ K + F + NTL A Y+K Sbjct: 298 RLQESYLFKKDDGK------PQIVDFRCTYQVNTLVASYHK 332 >gi|220929948|ref|YP_002506857.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10] gi|220000276|gb|ACL76877.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10] Length = 338 Score = 37.7 bits (86), Expect = 0.52, Method: Compositional matrix adjust. Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 2/47 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVE-FKFPTPLGIKPRLGDILEE 45 + A ++G+PQ RER+Y++ F N ++E F FP P +K + D L E Sbjct: 152 LNAVNYGIPQNRERIYMVCFRNDLNIENFNFPKPFPLKRYVEDFLLE 198 >gi|307140960|ref|ZP_07500316.1| DNA-cytosine methyltransferase [Escherichia coli H736] gi|331645014|ref|ZP_08346131.1| DNA cytosine methyltransferase M.NgoMIII [Escherichia coli H736] gi|331035989|gb|EGI08227.1| DNA cytosine methyltransferase M.NgoMIII [Escherichia coli H736] Length = 413 Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32 + A D+GVPQ+RER++I+ F + +E+ FP P Sbjct: 192 VNAADYGVPQKRERVFIVGFRDDLEIEWSFPKP 224 >gi|269114810|ref|YP_003302573.1| Cytosine-specific DNA methyltransferase/Type II site-specific deoxyribonuclease [Mycoplasma hominis] gi|268322435|emb|CAX37170.1| Cytosine-specific DNA methyltransferase/Type II site-specific deoxyribonuclease [Mycoplasma hominis ATCC 23114] Length = 553 Score = 37.7 bits (86), Expect = 0.57, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 5/46 (10%) Query: 1 MKACDFGVPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDI 42 + A DFGVPQ+RERL I D L+ + F+FP KP + D+ Sbjct: 151 LNAWDFGVPQKRERLITIGVRQDLLS-KISFEFPMEHSYKPTMRDV 195 >gi|288928693|ref|ZP_06422539.1| modification methylase NgoBI (Cytosine-specific methyltransferase NgoBI) [Prevotella sp. oral taxon 317 str. F0108] gi|288329677|gb|EFC68262.1| modification methylase NgoBI (Cytosine-specific methyltransferase NgoBI) [Prevotella sp. oral taxon 317 str. F0108] Length = 309 Score = 37.7 bits (86), Expect = 0.58, Method: Compositional matrix adjust. Identities = 32/88 (36%), Positives = 41/88 (46%), Gaps = 7/88 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP-RLGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+RER+ I+ F + F KP L ILEE D I KL+ Sbjct: 142 LNAMDFGLPQKRERVIIVGFRDKMAYENFDFTFKKKPFNLATILEEEKD----IDPKLYA 197 Query: 60 GHQKR-KENNKIAGKGFGY-GLFFENSA 85 R K AGK Y ++ EN A Sbjct: 198 SKTIREKRKASTAGKEVFYPSIWHENKA 225 >gi|195867949|ref|ZP_03079946.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] gi|195660345|gb|EDX53605.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] Length = 319 Score = 37.7 bits (86), Expect = 0.58, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + D+G VPQ RER+YI+ FL+ FK+P P+ + + D+++ Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEAFKYPCPITLTNTIRDVID 192 >gi|323178455|gb|EFZ64033.1| modification methylase NgoMIV [Escherichia coli 1180] Length = 377 Score = 37.7 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 8/71 (11%) Query: 3 ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61 A D+GVPQ R R+ ++ S F++P+ I P +GD L + +S WEG Sbjct: 155 ASDYGVPQLRPRVLLVALRGKYSAHFRWPSETLIPPTVGDALFD------LMSQGGWEGA 208 Query: 62 QK-RKENNKIA 71 + RK N IA Sbjct: 209 EAWRKAANNIA 219 >gi|67922277|ref|ZP_00515790.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] gi|67855853|gb|EAM51099.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] Length = 226 Score = 37.7 bits (86), Expect = 0.59, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49 + A DFG+PQ+RER++II +P + F F P + L +I+E+ + + Sbjct: 167 LNALDFGLPQKRERIFIIGLRDP-LNFTFKKPNISRKPLSEIIEKSVSE 214 >gi|171920707|ref|ZP_02931926.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] gi|185179015|ref|ZP_02964765.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] gi|188024024|ref|ZP_02996783.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] gi|188518336|ref|ZP_03003849.1| cytosine-specific methyltransferase NlaX [Ureaplasma urealyticum serovar 11 str. ATCC 33695] gi|188524309|ref|ZP_03004347.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] gi|198273488|ref|ZP_03206024.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] gi|225550923|ref|ZP_03771872.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar 2 str. ATCC 27814] gi|225551062|ref|ZP_03772008.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar 8 str. ATCC 27618] gi|171903447|gb|EDT49736.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] gi|184209104|gb|EDU06147.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] gi|188019052|gb|EDU57092.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] gi|188997975|gb|EDU67072.1| cytosine-specific methyltransferase NlaX [Ureaplasma urealyticum serovar 11 str. ATCC 33695] gi|195660089|gb|EDX53469.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] gi|198250008|gb|EDY74788.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] gi|225378877|gb|EEH01242.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar 8 str. ATCC 27618] gi|225380077|gb|EEH02439.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar 2 str. ATCC 27814] Length = 319 Score = 37.4 bits (85), Expect = 0.61, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + D+G VPQ RER+YI+ FL+ FK+P P+ + + D+++ Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEAFKYPCPITLTNTIRDVID 192 >gi|328946253|gb|EGG40397.1| modification methylase Sau96I [Streptococcus sanguinis SK1087] Length = 333 Score = 37.4 bits (85), Expect = 0.62, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43 + A D+GV Q+RER+ ++ L + F++P P KP L DIL Sbjct: 151 LNAWDYGVAQKRERMIMVGIRNDLTDKITFEYPEPHDYKPVLKDIL 196 >gi|254303554|ref|ZP_04970912.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] gi|148323746|gb|EDK88996.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] Length = 492 Score = 37.4 bits (85), Expect = 0.62, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + + D+G+PQ RER++++ F L +F+FP P ++ + D L +++ K + K Sbjct: 265 LNSKDYGIPQNRERVFVVGFRKDLKLKKKFEFPRPFLLEKTMQDFLLDNVAGKYYLQEK 323 >gi|260866454|ref|YP_003232856.1| putative DNA modification methylase [Escherichia coli O111:H- str. 11128] gi|257762810|dbj|BAI34305.1| predicted DNA modification methylase [Escherichia coli O111:H- str. 11128] Length = 356 Score = 37.4 bits (85), Expect = 0.63, Method: Composition-based stats. Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 8/71 (11%) Query: 3 ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61 A D+GVPQ R R+ ++ S F++P+ I P +GD L + +S WEG Sbjct: 155 ASDYGVPQLRPRVLLVALRGKYSAHFRWPSETLIPPTVGDALFD------LMSQGGWEGA 208 Query: 62 QK-RKENNKIA 71 + RK N IA Sbjct: 209 EAWRKAANNIA 219 >gi|6272296|gb|AAF06073.1|AF072715_4 putative methylase [Mycoplasma mycoides subsp. capri] Length = 390 Score = 37.4 bits (85), Expect = 0.63, Method: Compositional matrix adjust. Identities = 17/50 (34%), Positives = 27/50 (54%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK 50 + + D+G Q RER++ I +L+ F FP PL K + I++ D K Sbjct: 229 VNSTDYGSCQNRERVFCISYLDKQKNFTFPKPLITKKEIDSIIKNDDDMK 278 >gi|210610944|ref|ZP_03288669.1| hypothetical protein CLONEX_00859 [Clostridium nexile DSM 1787] gi|210152244|gb|EEA83251.1| hypothetical protein CLONEX_00859 [Clostridium nexile DSM 1787] Length = 278 Score = 37.4 bits (85), Expect = 0.64, Method: Compositional matrix adjust. Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ+RERL I D +N ++F FP KP L D+L Sbjct: 95 LNAWDYGVPQKRERLITIGIRNDLVN-RIKFHFPEAHDYKPVLRDVL 140 >gi|77409601|ref|ZP_00786278.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae COH1] gi|77171795|gb|EAO74987.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae COH1] Length = 333 Score = 37.4 bits (85), Expect = 0.69, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDIL 43 + A D+GV Q+RER+ ++ N V F++P P KP L DIL Sbjct: 151 LNAWDYGVAQKRERMIMVGIRNDLVNMTSFEYPKPHDYKPVLRDIL 196 >gi|270686639|ref|ZP_06222860.1| modification methylase DsaV [Haemophilus influenzae HK1212] gi|270316163|gb|EFA28145.1| modification methylase DsaV [Haemophilus influenzae HK1212] Length = 225 Score = 37.4 bits (85), Expect = 0.70, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHID 48 +KA D+G+PQ R R ++I F + V F FP P+ +K + D+ + D Sbjct: 18 LKASDYGLPQLRPRAFMIGFRDDHVLGNFSFPEPIPLKFTMSDVWKGKCD 67 >gi|289167263|ref|YP_003445530.1| type II DNA modification enzyme (methyltransferase cytosine-specific) [Streptococcus mitis B6] gi|288906828|emb|CBJ21662.1| type II DNA modification enzyme (methyltransferase cytosine-specific) [Streptococcus mitis B6] Length = 387 Score = 37.4 bits (85), Expect = 0.73, Method: Compositional matrix adjust. Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 17/81 (20%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFP------TPLGIKPRLGDI--------L 43 + A D+GVPQ RER+++I LN E+ FP P ++ +GD+ Sbjct: 169 LNAKDYGVPQNRERVFLIGVRNDLNIEFEWSFPEKCTSENPFNLRDAIGDLPSLGNNDRA 228 Query: 44 EEHIDDKSTISNKLWEGHQKR 64 +++++D T L G+Q + Sbjct: 229 DQYVEDPQTDYQILMRGNQDQ 249 >gi|119484300|ref|ZP_01618917.1| modification methylase NlaIV [Lyngbya sp. PCC 8106] gi|119457774|gb|EAW38897.1| modification methylase NlaIV [Lyngbya sp. PCC 8106] Length = 449 Score = 37.4 bits (85), Expect = 0.73, Method: Compositional matrix adjust. Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 21/93 (22%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-------------------PRLGD 41 + + +FG+PQ R R+Y+I LN S +F + LG K P++ D Sbjct: 146 LNSVNFGLPQNRVRVYMIGVLNASPQFNLISDLGPKDSHSYNAVQLNLFSLQHFPPKVKD 205 Query: 42 ILEEHIDDKSTISNKLWEGHQKRKEN--NKIAG 72 ILEE+ D S + + K + NK+ G Sbjct: 206 ILEENPDSSFDCSPEFSQALNKVVQGDLNKLHG 238 >gi|290343528|ref|YP_003494895.1| hypothetical protein OTV1_055 [Ostreococcus tauri virus 1] gi|260160943|emb|CAY39643.1| hypothetical protein OTV1_055 [Ostreococcus tauri virus 1] Length = 351 Score = 37.4 bits (85), Expect = 0.75, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 26/44 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE 44 +KA + GVPQ+RERL+I+ + F FP P L DIL+ Sbjct: 154 LKAHEHGVPQKRERLFIVGSRDVDFTFDFPEPSANDVGLKDILK 197 >gi|154173655|ref|YP_001409100.1| cytosine-specific methyltransferase NlaX [Campylobacter curvus 525.92] gi|112802981|gb|EAU00325.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Campylobacter curvus 525.92] Length = 352 Score = 37.0 bits (84), Expect = 0.80, Method: Compositional matrix adjust. Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 12/80 (15%) Query: 5 DFGVPQRRERLYIIDFL--NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-------- 54 D+G+ Q RER+YI+ FL + + F F + + + D L++ +D+K ++ Sbjct: 156 DYGIAQNRERIYIVGFLDFDEYLNFDFAPRVPLTTAIRDYLDDEVDEKYYLNENAILSMV 215 Query: 55 --NKLWEGHQKRKENNKIAG 72 N + G KE ++ AG Sbjct: 216 DPNACFNGKFDPKETDECAG 235 >gi|239812977|ref|YP_002941924.1| DNA-cytosine methyltransferase [Geobacillus sp. WCH70] gi|239809042|gb|ACS26105.1| DNA-cytosine methyltransferase [Geobacillus sp. WCH70] Length = 370 Score = 37.0 bits (84), Expect = 0.82, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32 + A D+GVPQ+RER++II N +++++FP P Sbjct: 172 INAADYGVPQKRERVFIIGVRNDLNIQYEFPEP 204 >gi|309380076|emb|CBX21487.1| putative DNA cytosine methyltransferase [Neisseria lactamica Y92-1009] Length = 377 Score = 37.0 bits (84), Expect = 0.83, Method: Compositional matrix adjust. Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ+RER+ I+ + +++KFP + RL + + ++ + WE Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKETHSEDRL--------NWEKYVTGEYWE 221 Query: 60 GHQKRKENNKIAGKGFG--YGLF 80 H + K NK + YG+F Sbjct: 222 KHNEPKRFNKDIAEKLQKKYGIF 244 >gi|238025826|ref|YP_002910057.1| DNA cytosine methyltransferase M.NgoMIII [Burkholderia glumae BGR1] gi|237875020|gb|ACR27353.1| DNA cytosine methyltransferase M.NgoMIII [Burkholderia glumae BGR1] Length = 407 Score = 37.0 bits (84), Expect = 0.85, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32 + A D+GVPQ+RER++I+ F + V++ FP P Sbjct: 182 VNAADYGVPQKRERVFIVGFRSDLDVDWSFPRP 214 >gi|166163613|gb|ABY83631.1| DNA methyltransferase Cfr42I [Citrobacter freundii] Length = 402 Score = 37.0 bits (84), Expect = 0.86, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32 + A D+G+PQ+RER++I+ F + +E+ FP P Sbjct: 181 VNAADYGIPQKRERVFIVGFRDDLEIEWSFPKP 213 >gi|168335325|ref|ZP_02693422.1| DNA-cytosine methyltransferase [Epulopiscium sp. 'N.t. morphotype B'] Length = 324 Score = 37.0 bits (84), Expect = 0.91, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDD 49 + A D+GV Q R+R++ I F + +++F+FP P KP L DIL + D+ Sbjct: 143 LNANDYGVAQDRKRVFYIGFRKDLNIKFEFPKPQEYKPVLRDILWDLKDN 192 >gi|209554428|ref|YP_002284952.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 10 str. ATCC 33699] gi|209541929|gb|ACI60158.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 10 str. ATCC 33699] Length = 319 Score = 37.0 bits (84), Expect = 0.93, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + D+G VPQ RER+YI+ FL+ FK+P P+ + + D+++ Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEVFKYPCPITLTNTIRDVID 192 >gi|313668596|ref|YP_004048880.1| DNA cytosine methyltransferase [Neisseria lactamica ST-640] gi|313006058|emb|CBN87519.1| DNA cytosine methyltransferase [Neisseria lactamica 020-06] Length = 393 Score = 37.0 bits (84), Expect = 0.94, Method: Compositional matrix adjust. Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ+RER+ I+ + +++KFP + RL + + ++ + WE Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKETHSEDRL--------NWEKYVTGEYWE 221 Query: 60 GHQKRKENNKIAGKGFG--YGLF 80 H + K NK + YG+F Sbjct: 222 KHNEPKRFNKDIAEKLQKKYGIF 244 >gi|328947436|ref|YP_004364773.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] gi|328447760|gb|AEB13476.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] Length = 439 Score = 37.0 bits (84), Expect = 0.95, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51 + + DF +PQ+RER Y + FL+ + +F FP I L DI++ D+S Sbjct: 240 LSSLDFELPQKRERWYCVGFLSKT-DFVFPAGTKIHKNLRDIIDLDNQDES 289 >gi|309789600|ref|ZP_07684181.1| BsaWI methylase [Oscillochloris trichoides DG6] gi|308228336|gb|EFO81983.1| BsaWI methylase [Oscillochloris trichoides DG6] Length = 436 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 16/32 (50%), Positives = 22/32 (68%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32 + A ++GVPQ RERL+II + S+ FPTP Sbjct: 173 LNAANYGVPQFRERLFIIATSDSSLPIIFPTP 204 >gi|325270473|ref|ZP_08137075.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] gi|324987196|gb|EGC19177.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] Length = 365 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 6/75 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR---LGDILEEH--IDDKSTIS 54 +KA ++G+PQRRER+ I+ + + +++P P+ + L +++E D K S Sbjct: 158 LKAVEYGIPQRRERVIIVGIRDDLTFNYEYPAPVCTEAEATPLSAVIDELAITDSKYYFS 217 Query: 55 NKLWEGHQKRKENNK 69 + +G +K K N K Sbjct: 218 ERAVQGVKKAKNNMK 232 >gi|161870123|ref|YP_001599293.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442] gi|225075874|ref|ZP_03719073.1| hypothetical protein NEIFLAOT_00897 [Neisseria flavescens NRL30031/H210] gi|296313674|ref|ZP_06863615.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC 43768] gi|161595676|gb|ABX73336.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442] gi|224952820|gb|EEG34029.1| hypothetical protein NEIFLAOT_00897 [Neisseria flavescens NRL30031/H210] gi|296839734|gb|EFH23672.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC 43768] Length = 423 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T L P+L +ILE + +S+ Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLPTESS 207 >gi|15676920|ref|NP_274067.1| modification methylase NlaIV [Neisseria meningitidis MC58] gi|7226272|gb|AAF41432.1| modification methylase NlaIV [Neisseria meningitidis MC58] gi|325136241|gb|EGC58849.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579] gi|325202033|gb|ADY97487.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149] gi|325208214|gb|ADZ03666.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis NZ-05/33] Length = 423 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T L P+L +ILE + +S+ Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLPTESS 207 >gi|325130383|gb|EGC53149.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304] Length = 425 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T L P+L +ILE + +S+ Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLPTESS 207 >gi|197302809|ref|ZP_03167861.1| hypothetical protein RUMLAC_01538 [Ruminococcus lactaris ATCC 29176] gi|197298046|gb|EDY32594.1| hypothetical protein RUMLAC_01538 [Ruminococcus lactaris ATCC 29176] Length = 333 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + A D+G+PQ+RER+Y++ F N F +P P + + + L +DD+ + + Sbjct: 152 LNAVDYGIPQKRERIYMVCFRNDLGITGFSYPKPFKLTRHVENFL---LDDEEMVKDLYV 208 Query: 59 E 59 E Sbjct: 209 E 209 >gi|313667088|gb|ADR72987.1| M2.BsmFI [Geobacillus stearothermophilus] Length = 365 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 15/82 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-------------LGIKPRLGDILEEHI 47 + A D+GVPQRR+R++I+ V+F FP P + ++ LGD+ + Sbjct: 146 LNAADYGVPQRRKRIFIVG-TREGVKFNFPLPTHNEKGDDGKLKWISVEEALGDLPSPNT 204 Query: 48 DDKSTISNKLWEGHQ-KRKENN 68 D S + +Q K +ENN Sbjct: 205 DGIVKYSKEPLTPYQLKMRENN 226 >gi|59801568|ref|YP_208280.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae FA 1090] gi|194097887|ref|YP_002000932.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae NCCP11945] gi|239998362|ref|ZP_04718286.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae 35/02] gi|240113683|ref|ZP_04728173.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae MS11] gi|240116425|ref|ZP_04730487.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae PID18] gi|240117164|ref|ZP_04731226.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae PID1] gi|240125114|ref|ZP_04738000.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae SK-92-679] gi|254494438|ref|ZP_05107609.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae 1291] gi|260441646|ref|ZP_05795462.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae DGI2] gi|268594223|ref|ZP_06128390.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae 35/02] gi|268599750|ref|ZP_06133917.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae MS11] gi|268602094|ref|ZP_06136261.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID18] gi|268602852|ref|ZP_06137019.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID1] gi|268683710|ref|ZP_06150572.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae SK-92-679] gi|291045024|ref|ZP_06570732.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae DGI2] gi|10444408|gb|AAG17898.1|AF297971_2 DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae] gi|59718463|gb|AAW89868.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae FA 1090] gi|193933177|gb|ACF29001.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae NCCP11945] gi|226513478|gb|EEH62823.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae 1291] gi|268547612|gb|EEZ43030.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae 35/02] gi|268583881|gb|EEZ48557.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae MS11] gi|268586225|gb|EEZ50901.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID18] gi|268586983|gb|EEZ51659.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID1] gi|268623994|gb|EEZ56394.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae SK-92-679] gi|291011027|gb|EFE03024.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae DGI2] gi|317163651|gb|ADV07192.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae TCDC-NG08107] Length = 377 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ+RER+ I+ + +++KFP + RL + + ++ + WE Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKRTHSEDRL--------NWEKYVTGEYWE 221 Query: 60 GHQKRKENNKIAGKGFG--YGLF 80 H + K NK + YG+F Sbjct: 222 KHNEPKRFNKDIAEKLQKKYGIF 244 >gi|326571776|gb|EGE21785.1| DNA-cytosine methyltransferase [Moraxella catarrhalis BC7] Length = 458 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + + D+GVPQ RER Y + S F+FP +L DI+E +DKS I +K Sbjct: 261 LNSYDYGVPQFRERWYCVAIRKDSDNGRFEFPKNRDRTTKLRDIIESDNNDKSLILSKF 319 >gi|172038109|ref|YP_001804610.1| putative modification methylase [Cyanothece sp. ATCC 51142] gi|171699563|gb|ACB52544.1| putative modification methylase [Cyanothece sp. ATCC 51142] Length = 344 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +FG+PQ+RER++I+ F +P + F + P + L +I+E+ + + S ++ Sbjct: 167 LNALNFGLPQKRERVFIVGFRDP-LAFIWKQPNILMKPLSEIIEKSVSEFYYASEQIQRN 225 Query: 61 HQKRKENN 68 + + N Sbjct: 226 RLAKYQGN 233 >gi|5420107|emb|CAB46561.1| cytosine-specific methyltransferase [Streptococcus thermophilus] Length = 316 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 7/68 (10%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 M A D+G +PQ RER+YI+ F + +F P + ++ + D+ ID S + +K Sbjct: 145 MNAADYGNIPQNRERIYIVAFRDKEDYADFDLPKSIPLETSIKDV----IDFDSKVDDKF 200 Query: 58 WEGHQKRK 65 + +K K Sbjct: 201 YYTAEKNK 208 >gi|296114087|ref|YP_003628025.1| cytosine-specific methyltransferase [Moraxella catarrhalis RH4] gi|295921781|gb|ADG62132.1| cytosine-specific methyltransferase [Moraxella catarrhalis RH4] gi|326560672|gb|EGE11040.1| cytosine-specific methyltransferase [Moraxella catarrhalis 46P47B1] Length = 318 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 4/61 (6%) Query: 8 VPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKR 64 +PQ RER++II F + S+ F+FP + + + DIL+ D+S +K + HQK Sbjct: 155 IPQNRERIFIIAFDKNIFKSINFEFPNKIPLTKTIHDILDNKKQDESFYYHK-SKYHQKL 213 Query: 65 K 65 K Sbjct: 214 K 214 >gi|53804329|ref|YP_114062.1| C-5 cytosine-specific DNA methylase family protein [Methylococcus capsulatus str. Bath] gi|53758090|gb|AAU92381.1| C-5 cytosine-specific DNA methylase family protein [Methylococcus capsulatus str. Bath] Length = 345 Score = 36.6 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 8/82 (9%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-----NKL 57 A D+GVPQ RER+ I+ L F+ P P+ I P ++ IDD + + N + Sbjct: 196 AADYGVPQTRERVLIVGTLPGVKPFEPPKPI-ISPSRYITAKQAIDDLAALDEDEEINHV 254 Query: 58 WE--GHQKRKENNKIAGKGFGY 77 W G + N ++ GY Sbjct: 255 WSRAGKSPEQGNRRLIADRPGY 276 >gi|327399867|ref|YP_004346898.1| cytosine-specific methyltransferase [Lactobacillus amylovorus GRL 1112] gi|327182537|gb|AEA32972.1| cytosine-specific methyltransferase [Lactobacillus amylovorus GRL 1112] Length = 401 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Query: 5 DFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46 D+G +PQ RER+Y++ F N F FP P+ + L DI++ H Sbjct: 157 DYGNIPQNRERIYVVGFDNKEDYDRFDFPAPIKLTKTLHDIIDFH 201 >gi|257062089|ref|YP_003139977.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] gi|256592255|gb|ACV03142.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] Length = 456 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILE 44 + + DFG+ Q R+R++I+ + + +F FP PL + P+L + +E Sbjct: 173 LNSYDFGLSQDRDRVFIVGIHQQIENAAQFSFPEPLNLSPKLYEFIE 219 >gi|218249004|ref|YP_002374375.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] gi|218169482|gb|ACK68219.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] Length = 456 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILE 44 + + DFG+ Q R+R++I+ + + +F FP PL + P+L + +E Sbjct: 173 LNSYDFGLSQDRDRVFIVGIHQQIENAAQFSFPEPLNLSPKLYEFIE 219 >gi|257870038|ref|ZP_05649691.1| DNA methylase [Enterococcus gallinarum EG2] gi|257804202|gb|EEV33024.1| DNA methylase [Enterococcus gallinarum EG2] Length = 401 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + D+G VPQ RER+Y++ F N F FP+ + + +L D+++ Sbjct: 156 LNGKDYGNVPQNRERIYVVGFRNQQAFDNFHFPSKVELTTKLSDVID 202 >gi|269122857|ref|YP_003305434.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM 12112] gi|268314183|gb|ACZ00557.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM 12112] Length = 329 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 4/46 (8%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43 + + DFG+PQ+RER+Y++ F LN F FP P + + D+L Sbjct: 152 LNSLDFGIPQKRERIYMVCFRKDLNIK-NFIFPKPFKLSTFVEDLL 196 >gi|254825117|ref|ZP_05230118.1| DNA-cytosine methyltransferase [Listeria monocytogenes FSL J1-194] gi|293594360|gb|EFG02121.1| DNA-cytosine methyltransferase [Listeria monocytogenes FSL J1-194] Length = 326 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53 + DFG+PQ+RER+Y + L+ P +F ++P + + LE +DD TI Sbjct: 149 LNPMDFGIPQKRERIYTVSVLSGPQFDFSKLKKEPMRP-INEFLETDVDDIYTI 201 >gi|9622224|gb|AAF89681.1| cytosine-specific methyltransferase [Bacillus sp. LU11] Length = 365 Score = 36.2 bits (82), Expect = 1.3, Method: Compositional matrix adjust. Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 15/82 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-------------LGIKPRLGDILEEHI 47 + A D+GVPQRR+R++I+ ++F FP P + ++ LGD+ + Sbjct: 146 LNAADYGVPQRRKRIFIVG-TREGIKFNFPLPTHNEKGNDGKLKWISVEEALGDLPSPNT 204 Query: 48 DDKSTISNKLWEGHQ-KRKENN 68 D S + +Q K +ENN Sbjct: 205 DGIVKYSTEPLNPYQLKMRENN 226 >gi|85703012|ref|ZP_01034116.1| DNA cytosine methyltransferase M.NgoMIII [Roseovarius sp. 217] gi|85671940|gb|EAQ26797.1| DNA cytosine methyltransferase M.NgoMIII [Roseovarius sp. 217] Length = 387 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTP 32 + + ++GVPQRRER++++ F + +E+ FP P Sbjct: 180 LNSANYGVPQRRERVFLVGFRADTGIEWHFPKP 212 >gi|229824483|ref|ZP_04450552.1| hypothetical protein GCWU000282_01806 [Catonella morbi ATCC 51271] gi|229786084|gb|EEP22198.1| hypothetical protein GCWU000282_01806 [Catonella morbi ATCC 51271] Length = 406 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Query: 8 VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKS 51 +PQ RER+YI+ F + F+FP + + +L D+++ HI + + Sbjct: 164 IPQNRERIYIVGFRDKQAFDAFQFPESVDLTTKLDDVIDFHIAENA 209 >gi|254411906|ref|ZP_05025682.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196181628|gb|EDX76616.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 456 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDIL 43 + + DFG+PQ R+R++I+ N S F FP PLG +L D++ Sbjct: 173 LNSYDFGLPQDRDRVFIVGIRNDIEKSKSFDFPKPLGKPIKLYDVI 218 >gi|223937258|ref|ZP_03629164.1| DNA-cytosine methyltransferase [bacterium Ellin514] gi|223894043|gb|EEF60498.1| DNA-cytosine methyltransferase [bacterium Ellin514] Length = 408 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 8/54 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-------LGIKPRLGDILEEH 46 + A D+GVPQ RER++I+ F + +E+ FP P + K GD E+H Sbjct: 186 LNAADYGVPQFRERVFIVGFRHDLGIEWSFPKPTHSYDALVKAKWVTGDYWEQH 239 >gi|315604954|ref|ZP_07880010.1| modification methylase [Actinomyces sp. oral taxon 180 str. F0310] gi|315313349|gb|EFU61410.1| modification methylase [Actinomyces sp. oral taxon 180 str. F0310] Length = 322 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 2/74 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPL-GIKPRLGDILEEHIDDKSTISNKLW 58 + A DFGVPQ R R+ + F + + F++P+P P +G+ L + + ++ W Sbjct: 147 LNASDFGVPQLRPRVIAVGFRHDTAPSFEYPSPFQNAAPTVGETLADLMAERGWEGASAW 206 Query: 59 EGHQKRKENNKIAG 72 R + G Sbjct: 207 AAQANRIAPTLVGG 220 >gi|308185228|ref|YP_003929361.1| DNA-cytosine methyltransferase [Helicobacter pylori SJM180] gi|308061148|gb|ADO03044.1| DNA-cytosine methyltransferase [Helicobacter pylori SJM180] Length = 368 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Query: 1 MKACDFGVPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + A ++G+PQ R RL+++ F F FP+P + + D+L+++I + + +S Sbjct: 187 LDARNYGIPQGRRRLFLVGFKEQEKCANFTFPSPKELTITMQDLLQDNIKEGNLLS 242 >gi|302873652|ref|YP_003842285.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] gi|307686624|ref|ZP_07629070.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] gi|302576509|gb|ADL50521.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] Length = 445 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 12/80 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-------LGIKPRLGDILEEHIDDKSTI 53 M A ++GVPQRR R+ I + + V ++P P L I+ + D++ E + Sbjct: 182 MDAANYGVPQRRNRVIFIAYRDDVVAPQYPEPTVTEETKLTIEDAITDLIRER-----RV 236 Query: 54 SNKLWEGHQKRKENNKIAGK 73 N+++ G + + + I G+ Sbjct: 237 RNRIFNGRLSQFQQDSINGR 256 >gi|10954474|ref|NP_039765.1| DNA cytosine-5 methylase subunit A [Methanothermobacter thermautotrophicus] gi|266583|sp|P29567|MTHT_METTF RecName: Full=Modification methylase MthTI; Short=M.MthTI; AltName: Full=Cytosine-specific methyltransferase MthTI gi|44641|emb|CAA48436.1| TIM [Methanothermobacter thermautotrophicus] gi|149743|gb|AAA73370.1| TIM [Methanothermobacter thermautotrophicus] Length = 330 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 6/93 (6%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ R+R++I+ + + +++F+FP PL K L D + + + K + E Sbjct: 144 LNAKDYGVPQDRKRVFIVGYREDLNLKFEFPKPLNKKVTLRDAIGDLPEPKPAL-----E 198 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 ++ EN ++ + G F + N + + Sbjct: 199 KNRSNGENLEVPNHEYMTGTFSSRYMSRNRVRS 231 >gi|323487872|ref|ZP_08093130.1| cytosine-specific methyltransferase [Planococcus donghaensis MPA1U2] gi|323398606|gb|EGA91394.1| cytosine-specific methyltransferase [Planococcus donghaensis MPA1U2] Length = 367 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 20/26 (76%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + + DFGVPQ+RER++ I FLN ++ Sbjct: 149 LNSADFGVPQKRERVFFIGFLNKDID 174 >gi|57506196|ref|ZP_00372116.1| C-5 cytosine-specific DNA methylase [Campylobacter upsaliensis RM3195] gi|57015523|gb|EAL52317.1| C-5 cytosine-specific DNA methylase [Campylobacter upsaliensis RM3195] Length = 315 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Query: 8 VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHID 48 +PQ RER+YII FL+ F FP + + ++ +LE+ +D Sbjct: 150 IPQNRERIYIIGFLDFHTYESFHFPAKIKLTQKIQHLLEKGVD 192 >gi|313677762|ref|YP_004055758.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] gi|312944460|gb|ADR23650.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] Length = 378 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 8/75 (10%) Query: 3 ACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGI---KPRLGDILEEHI--DDKSTISN 55 A ++GVPQ+RER++II F N F FP P + K +L +++++ D+K S Sbjct: 167 ASEYGVPQKRERVFIIGFKNYEDFAYFNFPQPTTLNDSKVKLKEVIDKKANKDEKWFFSQ 226 Query: 56 KLWEGHQK-RKENNK 69 + +G + +K+ NK Sbjct: 227 RAVDGMMRVQKKMNK 241 >gi|303231468|ref|ZP_07318199.1| modification methylase HhaI family protein [Veillonella atypica ACS-049-V-Sch6] gi|302513905|gb|EFL55916.1| modification methylase HhaI family protein [Veillonella atypica ACS-049-V-Sch6] Length = 411 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + D+G +PQ RER+YI+ FL S F FP + + L DI++ Sbjct: 154 LNGKDYGNIPQNRERIYIVGFLEKSAYDAFIFPDEIPLTTSLSDIID 200 >gi|157265308|ref|YP_001467867.1| C5 cytosine-specific DNA methylase [Thermus phage P23-45] gi|157265426|ref|YP_001467984.1| C5 cytosine-specific DNA methylase [Thermus phage P74-26] gi|156905203|gb|ABU96847.1| C5 cytosine-specific DNA methylase [Thermus phage P23-45] gi|156905321|gb|ABU96964.1| C5 cytosine-specific DNA methylase [Thermus phage P74-26] Length = 368 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLG 40 + A D+GVPQ+RER++I+ + P +F FP P P++ Sbjct: 162 LNAADYGVPQKRERVFIVGVRSDLPG-DFAFPLPTHANPQVA 202 >gi|296393765|ref|YP_003658649.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985] gi|296180912|gb|ADG97818.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985] Length = 393 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 7/51 (13%) Query: 3 ACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRL----GDILEEH 46 A D+GVPQRR R++I+ F + F PT G RL GD E H Sbjct: 183 AADYGVPQRRHRVFIVGFRSDVRAGWAFPSPTHSGEALRLAQVRGDYFERH 233 >gi|325912423|ref|ZP_08174818.1| modification methylase HhaI [Lactobacillus iners UPII 143-D] gi|325475765|gb|EGC78936.1| modification methylase HhaI [Lactobacillus iners UPII 143-D] Length = 314 Score = 35.8 bits (81), Expect = 2.1, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + D+GVPQ+RER+Y++ F +N V F FP P + + D L + S I ++ Sbjct: 131 LNPVDYGVPQKRERIYMLCFRNDINREV-FTFPRPFKLNKFVEDFLISDYEVNSLIVDR 188 >gi|251811836|ref|ZP_04826309.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis BCM-HMP0060] gi|282875124|ref|ZP_06283997.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis SK135] gi|251804633|gb|EES57290.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis BCM-HMP0060] gi|281295889|gb|EFA88410.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis SK135] Length = 329 Score = 35.8 bits (81), Expect = 2.1, Method: Compositional matrix adjust. Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 6/67 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNK 56 ++ D+ +PQ+R+R++I+ + N +EF +P L IK + D+ +KS I N Sbjct: 153 LQTSDYNIPQKRQRVFIVGYKN--IEFNYPEKLKRKVTIKEAISDLPPLKNGEKSKIPNH 210 Query: 57 LWEGHQK 63 H + Sbjct: 211 FAMNHSQ 217 >gi|256822924|ref|YP_003146887.1| DNA-cytosine methyltransferase [Kangiella koreensis DSM 16069] gi|256796463|gb|ACV27119.1| DNA-cytosine methyltransferase [Kangiella koreensis DSM 16069] Length = 419 Score = 35.8 bits (81), Expect = 2.1, Method: Compositional matrix adjust. Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 12/61 (19%) Query: 1 MKACDFG-VPQRRERLYIIDFLNP-----------SVEFKFPTPLGIKPRLGDILEEHID 48 + + DFG VPQ RER+YII F + + EF +P P+ + + D+L++ + Sbjct: 239 LNSMDFGDVPQNRERIYIIGFKDEANWQNNKGATRTSEFSWPEPIRLSKSVRDLLDKQVS 298 Query: 49 D 49 + Sbjct: 299 E 299 >gi|254671396|emb|CBA08870.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha153] Length = 157 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + +S+ Sbjct: 42 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 91 >gi|312902257|ref|ZP_07761465.1| helix-turn-helix protein [Enterococcus faecalis TX0635] gi|283466064|emb|CBG92839.1| hypothetical protein [Enterococcus casseliflavus] gi|310634316|gb|EFQ17599.1| helix-turn-helix protein [Enterococcus faecalis TX0635] Length = 470 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 5/50 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEE 45 + A ++GV Q+RER+ II N E FKFP +P L D+L++ Sbjct: 286 LNAWNYGVAQKRERIVIIGIRNDLFEQQQYSFKFPKEYTYQPVLRDVLKD 335 >gi|254442311|ref|ZP_05055787.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae bacterium DG1235] gi|198256619|gb|EDY80927.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae bacterium DG1235] Length = 338 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 4/34 (11%) Query: 1 MKACDFGVPQRRERLYII----DFLNPSVEFKFP 30 + + DFGVPQ RER+Y + D +N + +F FP Sbjct: 154 VSSVDFGVPQMRERVYFVGVRKDLVNSNFDFTFP 187 >gi|257867246|ref|ZP_05646899.1| DNA methyltransferase [Enterococcus casseliflavus EC30] gi|257873580|ref|ZP_05653233.1| DNA methyltransferase [Enterococcus casseliflavus EC10] gi|257801302|gb|EEV30232.1| DNA methyltransferase [Enterococcus casseliflavus EC30] gi|257807744|gb|EEV36566.1| DNA methyltransferase [Enterococcus casseliflavus EC10] Length = 470 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 5/50 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEE 45 + A ++GV Q+RER+ II N E FKFP +P L D+L++ Sbjct: 286 LNAWNYGVAQKRERIVIIGIRNDLFEQQQYSFKFPKEYTYQPVLRDVLKD 335 >gi|119512301|ref|ZP_01631388.1| DNA modification methylase [Nodularia spumigena CCY9414] gi|119463081|gb|EAW44031.1| DNA modification methylase [Nodularia spumigena CCY9414] Length = 502 Score = 35.4 bits (80), Expect = 2.3, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 6/56 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDIL----EEHIDDK 50 + + D+GVPQ R R+YII F +F P K +LGDIL E+ ID++ Sbjct: 147 INSFDYGVPQNRIRVYIIGFHKQEYLEKFALPKQTDKKRKLGDILGITSEQKIDNQ 202 >gi|316984658|gb|EFV63622.1| modification methylase NlaIV [Neisseria meningitidis H44/76] Length = 171 Score = 35.4 bits (80), Expect = 2.5, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + +S+ Sbjct: 56 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 105 >gi|289167787|ref|YP_003446056.1| site-specific DNA methylase [Streptococcus mitis B6] gi|288907354|emb|CBJ22191.1| site-specific DNA methylase [Streptococcus mitis B6] Length = 346 Score = 35.4 bits (80), Expect = 2.5, Method: Compositional matrix adjust. Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 22/105 (20%) Query: 3 ACDFGVPQRRERLYIIDFL-NPSVEFKFP----------TPLGIKPRLGDILEEHIDDKS 51 A +GVPQ+RER++I+ + + F+FP TPL + IL++ ID+K Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNVEDYTPLKV------ILQQDIDEKY 214 Query: 52 TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 S + +G K +GK G + +NT+S+ K Sbjct: 215 YFSERAVQGMLNSK-----SGKKMNKGRAQDIEQPSNTVSSHLAK 254 >gi|331677320|ref|ZP_08377999.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591] gi|331075055|gb|EGI46371.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591] Length = 415 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 19/36 (52%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + +FGVPQ R R+YII L V P LG K Sbjct: 146 LNTSNFGVPQNRVRIYIIASLEKEVTLTIPNDLGAK 181 >gi|197303495|ref|ZP_03168534.1| hypothetical protein RUMLAC_02217 [Ruminococcus lactaris ATCC 29176] gi|197297493|gb|EDY32054.1| hypothetical protein RUMLAC_02217 [Ruminococcus lactaris ATCC 29176] Length = 496 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 9/82 (10%) Query: 5 DFGVPQRRERLYIIDFL-----NPSVEFKFPTPLG----IKPRLGDILEEHIDDKSTISN 55 +FG+PQ R R+YI+ F N P+ I + ++L+ ++DDK ++ Sbjct: 168 EFGLPQNRPRVYIMAFSKKIYGNAIKLLNAQLPISRDETIFRDVTEVLDTNVDDKYYMAE 227 Query: 56 KLWEGHQKRKENNKIAGKGFGY 77 E ++ K K G GFGY Sbjct: 228 GYLETLKRHKARQKKNGYGFGY 249 >gi|148988377|ref|ZP_01819824.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pneumoniae SP6-BS73] gi|147926058|gb|EDK77132.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pneumoniae SP6-BS73] Length = 343 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 22/105 (20%) Query: 3 ACDFGVPQRRERLYIIDFL-NPSVEFKFP----------TPLGIKPRLGDILEEHIDDKS 51 A +GVPQ+RER++I+ + + F+FP TPL + IL++ ID+K Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNVEDYTPLKV------ILQQDIDEKY 214 Query: 52 TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 S + +G K +GK G + +NT+S+ K Sbjct: 215 YFSERAVQGMLNSK-----SGKKMNKGRAQDIEQPSNTVSSHLAK 254 >gi|328912201|gb|AEB63797.1| Modification methylase Rho11sI [Bacillus amyloliquefaciens LL3] Length = 503 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 37/130 (28%) Query: 6 FGVPQRRERLYII-------------------DFLNP-----------SVEFKFPTPLGI 35 F VPQ RER+YII D L+ S FK+ + Sbjct: 154 FNVPQNRERIYIIGVREDLIENDEWVLEKGRNDVLSKGKKRLKELNIKSFNFKWSAQDIV 213 Query: 36 KPRLGDILEEHIDDKSTIS----NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91 RL +ILEE++D+K +S +KL E +K KE + + G G + N+ T Sbjct: 214 GQRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEKDVVFVGGINVGKRWLNNGKT---Y 270 Query: 92 ARYYKDGSEI 101 +R +K G+ + Sbjct: 271 SRNFKQGNRV 280 >gi|331270912|ref|YP_004385623.1| putative cytosine-specific DNA methylotransferase [Clostridium botulinum BKT015925] gi|329127304|gb|AEB77248.1| putative cytosine-specific DNA methylotransferase [Clostridium botulinum BKT015925] Length = 349 Score = 35.4 bits (80), Expect = 2.9, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 4/58 (6%) Query: 1 MKACDFGVPQRRERLYII---DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + A +FG+PQ RER+++I ++++ + KF RL DIL+ +D++ I N Sbjct: 149 LNAKNFGIPQNRERIFVIGIREYIDNK-QMKFNEGKDYGYRLKDILQNQVDERFYIDN 205 >gi|901818|gb|AAA69959.1| 5C-DNA methyltransferase [Bacillus phage H2] Length = 503 Score = 35.4 bits (80), Expect = 2.9, Method: Compositional matrix adjust. Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 37/130 (28%) Query: 6 FGVPQRRERLYII-------------------DFLNP-----------SVEFKFPTPLGI 35 F VPQ RER+YII D L+ S FK+ + Sbjct: 154 FNVPQNRERIYIIGVREDLIENDEWIVEKGRYDVLSKGKKRLKELNIKSFNFKWSAQDIV 213 Query: 36 KPRLGDILEEHIDDKSTIS----NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91 RL +ILEE++D+K +S +KL E +K KE + + G G + N+ T Sbjct: 214 GKRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEKDVVFVGGINVGKRWLNNGKT---Y 270 Query: 92 ARYYKDGSEI 101 +R +K G+ + Sbjct: 271 SRNFKQGNRV 280 >gi|328553026|gb|AEB23518.1| SP-beta prophage DNA (cytosine-5-)-methyltransferase [Bacillus amyloliquefaciens TA208] Length = 503 Score = 35.0 bits (79), Expect = 3.0, Method: Compositional matrix adjust. Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 37/130 (28%) Query: 6 FGVPQRRERLYII-------------------DFLNP-----------SVEFKFPTPLGI 35 F VPQ RER+YII D L+ S FK+ + Sbjct: 154 FNVPQNRERIYIIGVREDLIENDEWIVEKGRNDVLSKGKKRLKELNIKSFNFKWSAQDIV 213 Query: 36 KPRLGDILEEHIDDKSTIS----NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91 RL +ILEE++D+K +S +KL E +K KE + + G G + N+ T Sbjct: 214 GKRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEKDVVFVGGINVGKRWLNNGKT---Y 270 Query: 92 ARYYKDGSEI 101 +R +K G+ + Sbjct: 271 SRNFKQGNRV 280 >gi|91215328|ref|ZP_01252299.1| modification methylase (Eco47II, Sau96I) [Psychroflexus torquis ATCC 700755] gi|91186280|gb|EAS72652.1| modification methylase (Eco47II, Sau96I) [Psychroflexus torquis ATCC 700755] Length = 412 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKL 57 +KA ++ VPQ+RERL ++ + +E+ +P+P L D L+ E D K IS Sbjct: 221 LKAINYNVPQKRERLILVGVRKDIDLEYVYPSPYEKVYNLSDALKKGELYDSKVPISKGT 280 Query: 58 WEGHQKRKENNKIAGKGF 75 K+K + I KG+ Sbjct: 281 QYPENKKKVLDLIPPKGY 298 >gi|309789605|ref|ZP_07684186.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6] gi|308228341|gb|EFO81988.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6] Length = 342 Score = 35.0 bits (79), Expect = 3.3, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI 47 + A +GVPQ RERL ++ F FP PL K +G+ L E + Sbjct: 157 LNAVHYGVPQNRERLIVVGHKG---GFSFPKPLSTKVTVGEALGEMV 200 >gi|227874220|ref|ZP_03992420.1| DNA (cytosine-5-)-methyltransferase [Oribacterium sinus F0268] gi|227839928|gb|EEJ50358.1| DNA (cytosine-5-)-methyltransferase [Oribacterium sinus F0268] Length = 336 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43 + A D+GV Q+RERL I L ++++FP KP L DIL Sbjct: 152 LNAWDYGVAQKRERLITIGIRKDLEDKIKYEFPKVYEYKPLLKDIL 197 >gi|1171044|sp|P43420|MTB6_BACSF RecName: Full=Modification methylase Bsp6I; Short=M.Bsp6I; AltName: Full=Cytosine-specific methyltransferase Bsp6I gi|547481|emb|CAA57293.1| site-specific DNA-methyltransferase (cytosine-specific) [Bacillus sp.] gi|1098125|prf||2115268B methyltransferase Bsp6IM Length = 315 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 5/55 (9%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDI--LEEHIDDK 50 + A DFG +PQ RER+YI+ F N F FP P + + D+ L + +DD+ Sbjct: 145 LNAKDFGNIPQNRERIYIVGFRNIEHYKNFNFPMPQPLTLTIKDMINLSDKLDDR 199 >gi|303236368|ref|ZP_07322958.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN] gi|302483426|gb|EFL46431.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN] Length = 357 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 20/31 (64%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 A D+GVPQ R+RL + N +F+FP PL Sbjct: 157 AADYGVPQIRKRLVFVGLKNNKEKFEFPEPL 187 >gi|332970702|gb|EGK09683.1| DNA (cytosine-5-)-methyltransferase [Kingella kingae ATCC 23330] Length = 197 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 15/32 (46%), Positives = 22/32 (68%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32 + A +FGVPQ+RER++I+ F + FKF P Sbjct: 144 LNASEFGVPQKRERVFIVGFRDDEDFFKFQFP 175 >gi|313677760|ref|YP_004055756.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] gi|312944458|gb|ADR23648.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] Length = 346 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49 + A DF VPQ R R + + N S+EF+FP P+ ++ EE I D Sbjct: 152 LLASDFAVPQNRRRAFFVGLKN-SLEFEFPKPITTDNKITS--EEAISD 197 >gi|163938820|ref|YP_001643704.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4] gi|163861017|gb|ABY42076.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4] Length = 350 Score = 35.0 bits (79), Expect = 3.6, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL 43 + + ++G VPQ RER+YI+ FL + +F FP P+ + L ++ Sbjct: 153 LNSMEYGNVPQNRERIYIVGFLENELTAKFDFPAPIPLTNTLNTVI 198 >gi|311064356|ref|YP_003971081.1| cytosine methyl transferase Dcm [Bifidobacterium bifidum PRL2010] gi|310866675|gb|ADP36044.1| Dcm Cytosine methyl transferase [Bifidobacterium bifidum PRL2010] Length = 326 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 + A D+GVPQ R+R+ I+ N VEF +P P K Sbjct: 154 LNAADYGVPQTRQRVIIVGVRNDLDVEFTYPQPTNSK 190 >gi|225571452|ref|ZP_03780448.1| hypothetical protein CLOHYLEM_07550 [Clostridium hylemonae DSM 15053] gi|225159928|gb|EEG72547.1| hypothetical protein CLOHYLEM_07550 [Clostridium hylemonae DSM 15053] Length = 377 Score = 35.0 bits (79), Expect = 3.9, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A DFG+PQ+RER+ II P + + + K L DILE+ ID K S ++ Sbjct: 222 LNALDFGLPQKRERIIIIGSKKPFL-MDWTFNVEKKKTLDDILEKDIDKKHYASPEI 277 >gi|328766176|gb|EGF76234.1| hypothetical protein BATDEDRAFT_28720 [Batrachochytrium dendrobatidis JAM81] Length = 373 Score = 34.7 bits (78), Expect = 3.9, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32 + A D+GVPQ+RER++II N E+ FP P Sbjct: 181 VNARDYGVPQQRERVFIIGIRNDIEFEYDFPAP 213 >gi|18700048|gb|AAL03949.1| DNA methyltransferase Bse634IM [Geobacillus stearothermophilus] Length = 387 Score = 34.7 bits (78), Expect = 3.9, Method: Compositional matrix adjust. Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 9/42 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---------FKFPTPL 33 + A +FG+PQ R R++II F N +E F++PTP+ Sbjct: 172 LNALEFGIPQDRARVFIIGFKNSIIETLQENYMDAFQWPTPI 213 >gi|169823657|ref|YP_001691160.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328] gi|167832277|dbj|BAG09192.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328] Length = 332 Score = 34.7 bits (78), Expect = 4.0, Method: Compositional matrix adjust. Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + A +FG +PQ RER+YI+ F + + F+FP P+ + + D ++ Sbjct: 147 LNATEFGNIPQNRERIYIVAFRDKNCLDNFEFPKPIELTTTIRDFID 193 >gi|317483873|ref|ZP_07942812.1| C-5 cytosine-specific DNA methylase [Bilophila wadsworthia 3_1_6] gi|316924890|gb|EFV46037.1| C-5 cytosine-specific DNA methylase [Bilophila wadsworthia 3_1_6] Length = 401 Score = 34.7 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFP 30 + A D+G+PQRRER++I+ F + V + FP Sbjct: 178 VNAADYGIPQRRERVFIVGFRHDLGVRWSFP 208 >gi|291618717|ref|YP_003521459.1| HsdRM [Pantoea ananatis LMG 20103] gi|291153747|gb|ADD78331.1| HsdRM [Pantoea ananatis LMG 20103] Length = 313 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTP 32 + A D+GVPQ R+R++I+ N +VE+ FP P Sbjct: 141 LNAMDYGVPQERKRIFIVGIKDNINVEYSFPEP 173 >gi|325979448|ref|YP_004289164.1| DNA (cytosine-5-)-methyltransferase [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] gi|325179376|emb|CBZ49420.1| DNA (cytosine-5-)-methyltransferase [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] Length = 333 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A DFGV Q+RER+ ++ N F++P KP L D+L Sbjct: 151 LNAWDFGVAQKRERMIMVGIRNDLANKTSFEYPEAHAYKPVLRDVL 196 >gi|218902126|ref|YP_002449960.1| cytosine-specific methyltransferase NlaX [Bacillus cereus AH820] gi|218538919|gb|ACK91317.1| cytosine-specific methyltransferase NlaX [Bacillus cereus AH820] Length = 350 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL 43 + + ++G VPQ RER+YI+ FL + +F FP P+ + L ++ Sbjct: 153 LNSMEYGNVPQNRERIYIVGFLENELTAKFDFPAPIPLTNTLNTVI 198 >gi|319639604|ref|ZP_07994351.1| cytosine-specific methyltransferase [Neisseria mucosa C102] gi|317399175|gb|EFV79849.1| cytosine-specific methyltransferase [Neisseria mucosa C102] Length = 348 Score = 34.7 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 6/54 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-----LGIKPRLGDILEEHIDD 49 + A D+GVPQ R+R + + F N ++ F+FP + +K + D+ + +DD Sbjct: 155 LMASDYGVPQNRKRAFFVGFKNGTI-FEFPKQTVNQYVTVKQAISDLPDYSVDD 207 >gi|113477918|ref|YP_723979.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101] gi|110168966|gb|ABG53506.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101] Length = 337 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + DFGVPQ R+R+ +I EF FP L K +G+ LEE Sbjct: 155 LNTVDFGVPQNRQRVIVIGHKG---EFTFPQVLDKKVTVGEALEE 196 >gi|237742048|ref|ZP_04572529.1| site-specific DNA-methyltransferase [Fusobacterium sp. 4_1_13] gi|229429696|gb|EEO39908.1| site-specific DNA-methyltransferase [Fusobacterium sp. 4_1_13] Length = 440 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP----TPLGIKPRLGDILEEHIDDK 50 + A ++GVPQ R RL +I F N E K+P + ++ L D+ +D+K Sbjct: 189 LNASNYGVPQNRHRLILIGFRNDMKEPKYPKEFKQKVTLREALSDLTNYELDNK 242 >gi|254673505|emb|CBA08927.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha275] Length = 273 Score = 34.7 bits (78), Expect = 5.1, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + +S+ Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 207 >gi|304387455|ref|ZP_07369646.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC 13091] gi|304338548|gb|EFM04667.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC 13091] Length = 273 Score = 34.3 bits (77), Expect = 5.1, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + +S+ Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 207 >gi|261840146|gb|ACX99911.1| cytosine-specific methyltransferase [Helicobacter pylori 52] Length = 343 Score = 34.3 bits (77), Expect = 5.1, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 27/46 (58%), Gaps = 5/46 (10%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43 + A + GV Q+RERL+I+ LN S F FP PL K L DIL Sbjct: 151 LNASNHGVAQKRERLFIVGIRKDLNRS--FNFPKPLKNKKVLKDIL 194 >gi|321310707|ref|YP_004193036.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str. Langford 1] gi|319802551|emb|CBY93197.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str. Langford 1] Length = 340 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 5/49 (10%) Query: 1 MKACDFGVPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDILEE 45 + + D+GV Q+RERL +I DF + FK+P KP L D+L + Sbjct: 156 LNSWDYGVAQKRERLILIGIRSDF-REKISFKYPKKHRYKPVLSDVLND 203 >gi|281491831|ref|YP_003353811.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp. lactis KF147] gi|281375542|gb|ADA65048.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp. lactis KF147] Length = 347 Score = 34.3 bits (77), Expect = 5.4, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 5/68 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDI--LEEHI-DDKSTISN 55 + A DFGVPQ+R R+ + N +F FP + + L D+ LE+ + ++S SN Sbjct: 153 LVASDFGVPQKRRRIVFVGLQNDVFDFNFPEFGMVTTEMALSDLPSLEDELGTEESEYSN 212 Query: 56 KLWEGHQK 63 K +QK Sbjct: 213 KPQNSYQK 220 >gi|270293678|ref|ZP_06199880.1| cytosine-specific methyltransferase [Bacteroides sp. D20] gi|270275145|gb|EFA21005.1| cytosine-specific methyltransferase [Bacteroides sp. D20] Length = 361 Score = 34.3 bits (77), Expect = 5.8, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 A ++GVPQRR R++++ N ++F+FP P K +EE I D + N Sbjct: 154 ADEYGVPQRRMRMFMVGN-NQGIDFEFPKPFDYKVS----VEEAIGDLPVLHN 201 >gi|149060302|gb|EDM11016.1| coproporphyrinogen oxidase [Rattus norvegicus] Length = 233 Score = 34.3 bits (77), Expect = 5.8, Method: Compositional matrix adjust. Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 13/104 (12%) Query: 2 KACD--FGVPQRRER-----LYIIDFLNPSVE--FKFPTPLG--IKPRLGDILEEHIDDK 50 K CD F + R ER ++ D +PS E F+F + P I+++H DD Sbjct: 96 KWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEAFRFVKTCAEAVVPSYVPIVKKHCDDS 155 Query: 51 STISNKLWEGHQKRK--ENNKIAGKGFGYGLFFENSATTNTLSA 92 T +KLW+ ++ + E N + +G +GLF S + L + Sbjct: 156 YTPQDKLWQQLRRGRYVEFNLVYDRGTKFGLFTPGSRIESILMS 199 >gi|240128365|ref|ZP_04741026.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae SK-93-1035] gi|268686763|ref|ZP_06153625.1| DNA modification methylase [Neisseria gonorrhoeae SK-93-1035] gi|268627047|gb|EEZ59447.1| DNA modification methylase [Neisseria gonorrhoeae SK-93-1035] Length = 423 Score = 34.3 bits (77), Expect = 6.5, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + +S+ Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 207 >gi|59801103|ref|YP_207815.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae FA 1090] gi|121634967|ref|YP_975212.1| DNA modification methylase [Neisseria meningitidis FAM18] gi|194098793|ref|YP_002001855.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae NCCP11945] gi|239999085|ref|ZP_04719009.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae 35/02] gi|240014008|ref|ZP_04720921.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae DGI18] gi|240016449|ref|ZP_04722989.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae FA6140] gi|240080568|ref|ZP_04725111.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae FA19] gi|240113063|ref|ZP_04727553.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae MS11] gi|240115818|ref|ZP_04729880.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae PID18] gi|240118116|ref|ZP_04732178.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae PID1] gi|240121574|ref|ZP_04734536.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae PID24-1] gi|240123666|ref|ZP_04736622.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae PID332] gi|240125856|ref|ZP_04738742.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae SK-92-679] gi|254493863|ref|ZP_05107034.1| DNA modification methylase [Neisseria gonorrhoeae 1291] gi|260440365|ref|ZP_05794181.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae DGI2] gi|268594923|ref|ZP_06129090.1| DNA modification methylase [Neisseria gonorrhoeae 35/02] gi|268596698|ref|ZP_06130865.1| DNA modification methylase [Neisseria gonorrhoeae FA19] gi|268599147|ref|ZP_06133314.1| DNA modification methylase [Neisseria gonorrhoeae MS11] gi|268601493|ref|ZP_06135660.1| DNA modification methylase [Neisseria gonorrhoeae PID18] gi|268603831|ref|ZP_06137998.1| DNA modification methylase [Neisseria gonorrhoeae PID1] gi|268682295|ref|ZP_06149157.1| DNA modification methylase [Neisseria gonorrhoeae PID332] gi|268684453|ref|ZP_06151315.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679] gi|291043662|ref|ZP_06569378.1| DNA modification methylase [Neisseria gonorrhoeae DGI2] gi|293398965|ref|ZP_06643130.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|59717998|gb|AAW89403.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae FA 1090] gi|120866673|emb|CAM10425.1| DNA modification methylase [Neisseria meningitidis FAM18] gi|193934083|gb|ACF29907.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae NCCP11945] gi|226512903|gb|EEH62248.1| DNA modification methylase [Neisseria gonorrhoeae 1291] gi|268548312|gb|EEZ43730.1| DNA modification methylase [Neisseria gonorrhoeae 35/02] gi|268550486|gb|EEZ45505.1| DNA modification methylase [Neisseria gonorrhoeae FA19] gi|268583278|gb|EEZ47954.1| DNA modification methylase [Neisseria gonorrhoeae MS11] gi|268585624|gb|EEZ50300.1| DNA modification methylase [Neisseria gonorrhoeae PID18] gi|268587962|gb|EEZ52638.1| DNA modification methylase [Neisseria gonorrhoeae PID1] gi|268622579|gb|EEZ54979.1| DNA modification methylase [Neisseria gonorrhoeae PID332] gi|268624737|gb|EEZ57137.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679] gi|291012125|gb|EFE04114.1| DNA modification methylase [Neisseria gonorrhoeae DGI2] gi|291610379|gb|EFF39489.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|317164377|gb|ADV07918.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae TCDC-NG08107] Length = 423 Score = 34.3 bits (77), Expect = 6.5, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + +S+ Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 207 >gi|218768275|ref|YP_002342787.1| DNA modification methylase [Neisseria meningitidis Z2491] gi|121052283|emb|CAM08611.1| DNA modification methylase [Neisseria meningitidis Z2491] Length = 423 Score = 33.9 bits (76), Expect = 6.7, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + +S+ Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 207 >gi|126658057|ref|ZP_01729209.1| DNA cytosine methylase [Cyanothece sp. CCY0110] gi|126620695|gb|EAZ91412.1| DNA cytosine methylase [Cyanothece sp. CCY0110] Length = 358 Score = 33.9 bits (76), Expect = 7.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A F +PQ RER+YI+ D+L VEF FP + +E +++ S IS Sbjct: 181 LDAALFNLPQVRERIYIVGFCRDYLKERVEFNFPVGRKNNVFIDQFIETNVEGYS-ISKH 239 Query: 57 LWEGHQKRKENNK 69 L + + +K++ + Sbjct: 240 LQKTYLFKKDDGR 252 >gi|314055098|ref|YP_004063436.1| cytosine-specific methyltransferase [Ostreococcus tauri virus 2] gi|313574989|emb|CBI70002.1| cytosine-specific methyltransferase [Ostreococcus tauri virus 2] Length = 315 Score = 33.9 bits (76), Expect = 7.1, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 8 VPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 VPQ RER+YI+ F + + F F G K L D +E + DK S+K Sbjct: 153 VPQHRERIYIVGFRDKELHDNFNFDFVEGDKGNLCDFMESCVPDKYYYSDK 203 >gi|79749365|ref|NP_001032172.1| coproporphyrinogen-III oxidase, mitochondrial precursor [Rattus norvegicus] gi|123780327|sp|Q3B7D0|HEM6_RAT RecName: Full=Coproporphyrinogen-III oxidase, mitochondrial; Short=COX; Short=Coprogen oxidase; Short=Coproporphyrinogenase; Flags: Precursor gi|78070754|gb|AAI07665.1| Coproporphyrinogen oxidase [Rattus norvegicus] Length = 443 Score = 33.9 bits (76), Expect = 7.6, Method: Composition-based stats. Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 13/102 (12%) Query: 2 KACD--FGVPQRRER-----LYIIDFLNPSVE--FKFPTPLG--IKPRLGDILEEHIDDK 50 K CD F + R ER ++ D +PS E F+F + P I+++H DD Sbjct: 306 KWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEAFRFVKTCAEAVVPSYVPIVKKHCDDS 365 Query: 51 STISNKLWEGHQKRK--ENNKIAGKGFGYGLFFENSATTNTL 90 T +KLW+ ++ + E N + +G +GLF S + L Sbjct: 366 YTPQDKLWQQLRRGRYVEFNLVYDRGTKFGLFTPGSRIESIL 407 >gi|326567346|gb|EGE17461.1| type II DNA modification enzyme [Moraxella catarrhalis BC1] Length = 327 Score = 33.9 bits (76), Expect = 7.9, Method: Compositional matrix adjust. Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Query: 6 FGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 +GVPQ R+R+Y + + FKFP P+ KP + D L + D + ++N ++ + Sbjct: 149 YGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTFQKYLA 207 Query: 64 RKEN 67 K N Sbjct: 208 SKYN 211 >gi|297621903|ref|YP_003710040.1| C-5 cytosine-specific DNA methylase [Waddlia chondrophila WSU 86-1044] gi|297377204|gb|ADI39034.1| C-5 cytosine-specific DNA methylase [Waddlia chondrophila WSU 86-1044] Length = 410 Score = 33.9 bits (76), Expect = 8.1, Method: Compositional matrix adjust. Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEE 45 +K+ + VPQ+RERL+I+ N V +FK+P+P L D L++ Sbjct: 220 LKSIFYQVPQKRERLFIVGVRNDLVKKAKFKWPSPFKKVLTLKDALKQ 267 >gi|326560963|gb|EGE11328.1| type II DNA modification enzyme [Moraxella catarrhalis 7169] gi|326575187|gb|EGE25115.1| type II DNA modification enzyme [Moraxella catarrhalis CO72] Length = 322 Score = 33.9 bits (76), Expect = 8.1, Method: Compositional matrix adjust. Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Query: 6 FGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 +GVPQ R+R+Y + + FKFP P+ KP + D L + D + ++N ++ + Sbjct: 144 YGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTFQKYLA 202 Query: 64 RKEN 67 K N Sbjct: 203 SKYN 206 >gi|261400634|ref|ZP_05986759.1| DNA (cytosine-5-)-methyltransferase [Neisseria lactamica ATCC 23970] gi|313668389|ref|YP_004048673.1| DNA modification methylase [Neisseria lactamica ST-640] gi|1709164|sp|P50182|MTN4_NEILA RecName: Full=Modification methylase NlaIV; Short=M.NlaIV; AltName: Full=Cytosine-specific methyltransferase NlaIV gi|476227|gb|AAA53237.1| M.NlaIV [Neisseria lactamica] gi|269209540|gb|EEZ75995.1| DNA (cytosine-5-)-methyltransferase [Neisseria lactamica ATCC 23970] gi|313005851|emb|CBN87307.1| DNA modification methylase [Neisseria lactamica 020-06] Length = 423 Score = 33.9 bits (76), Expect = 8.3, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + +S+ Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTPS--PKLKNILESGLPTESS 207 >gi|268610192|ref|ZP_06143919.1| cytosine-specific DNA methylase [Ruminococcus flavefaciens FD-1] Length = 475 Score = 33.9 bits (76), Expect = 8.5, Method: Compositional matrix adjust. Identities = 38/123 (30%), Positives = 54/123 (43%), Gaps = 31/123 (25%) Query: 1 MKACDFGVPQRRERLYII----DFLNPSV---EFKFPTPLGI-----KPRLGD---ILEE 45 + DFG+PQ RER+YI+ D N + F L + K ++GD ILE+ Sbjct: 204 LSPSDFGIPQIRERVYILGIRRDIRNQQILTNGFIHIEDLQLDKHFKKCKMGDAWSILED 263 Query: 46 HIDDKSTISNK------LWEGHQKRKENNKIAG-----KGFGYGLFFENSATTNTLSARY 94 +DD IS + WE +K N K+ G FG G N T + S++ Sbjct: 264 EVDDSYIISEEKEQMILAWEEFRK-ATNIKVIGFPIWIDSFGVG----NDDTDDVYSSQG 318 Query: 95 YKD 97 Y D Sbjct: 319 YDD 321 >gi|326563801|gb|EGE14052.1| type II DNA modification enzyme [Moraxella catarrhalis 46P47B1] gi|326566814|gb|EGE16953.1| type II DNA modification enzyme [Moraxella catarrhalis 103P14B1] gi|326576727|gb|EGE26634.1| type II DNA modification enzyme [Moraxella catarrhalis 101P30B1] Length = 327 Score = 33.5 bits (75), Expect = 8.7, Method: Compositional matrix adjust. Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Query: 6 FGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 +GVPQ R+R+Y + + FKFP P+ KP + D L + D + ++N ++ + Sbjct: 149 YGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTFQKYLA 207 Query: 64 RKEN 67 K N Sbjct: 208 SKYN 211 >gi|309378580|emb|CBX22758.1| DNA cytosine methyltransferase M.NlaIV [Neisseria lactamica Y92-1009] Length = 380 Score = 33.5 bits (75), Expect = 8.8, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + +S+ Sbjct: 115 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--TPSPKLKNILESGLPTESS 164 >gi|317181803|dbj|BAJ59587.1| Type II DNA modification enzyme [Helicobacter pylori F57] Length = 351 Score = 33.5 bits (75), Expect = 9.6, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDI 42 + A D+GVPQ RER+ ++ L +F FP P+ +K LGD+ Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDALGDL 191 Searching..................................................done Results from round 2 >gi|78777762|ref|YP_394077.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM 1251] gi|78498302|gb|ABB44842.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM 1251] Length = 328 Score = 190 bits (485), Expect = 4e-47, Method: Composition-based stats. Identities = 60/101 (59%), Positives = 78/101 (77%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A D+GVPQ RER+YI+ FL+ VEF+FP P+ ++GDILE+ +D+K TIS+KLW G Sbjct: 163 LNAKDYGVPQNRERIYIVGFLDNEVEFEFPKPIEKYVKVGDILEDKVDEKYTISDKLWAG 222 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK +K G GFGY +F ENS T+T+SARYYKDGSEI Sbjct: 223 HQRRKIEHKAKGNGFGYSMFNENSIYTSTISARYYKDGSEI 263 >gi|313667524|ref|YP_004047808.1| cytosine-specific methyltransferase [Neisseria lactamica ST-640] gi|309378245|emb|CBX23130.1| DNA cytosine methyltransferase M.NlaX [Neisseria lactamica Y92-1009] gi|313004986|emb|CBN86414.1| cytosine-specific methyltransferase [Neisseria lactamica 020-06] Length = 313 Score = 190 bits (483), Expect = 7e-47, Method: Composition-based stats. Identities = 65/101 (64%), Positives = 81/101 (80%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA DFG+PQ RER+Y++ FLN V+F+FP P+G +GDILE + D+K TIS+KLW+G Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK N+ AGKGFGYGLF SA TNT+SARYYKDGSEI Sbjct: 205 HQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245 >gi|127471|sp|P24581|MTNX_NEILA RecName: Full=Cytosine-specific methyltransferase NlaX; Short=M.NlaX gi|45004|emb|CAA38357.1| cytosine-specific methyltransferase of NlaIII [Neisseria lactamica] Length = 313 Score = 187 bits (477), Expect = 3e-46, Method: Composition-based stats. Identities = 64/101 (63%), Positives = 81/101 (80%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA DFG+PQ RER+Y++ FLN V+F+FP P+G +GDILE + D+K TIS+KLW+G Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +Q+RK N+ AGKGFGYGLF SA TNT+SARYYKDGSEI Sbjct: 205 YQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245 >gi|315637499|ref|ZP_07892709.1| modification methylase EcoRII [Arcobacter butzleri JV22] gi|315478217|gb|EFU68940.1| modification methylase EcoRII [Arcobacter butzleri JV22] Length = 326 Score = 187 bits (477), Expect = 4e-46, Method: Composition-based stats. Identities = 65/101 (64%), Positives = 81/101 (80%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFGVPQ RER+YII FL+ S++FK+P PL K RLGDIL++++DDK TIS+KLW G Sbjct: 163 LNAKDFGVPQNRERIYIIAFLDHSIDFKYPKPLNKKNRLGDILDDNVDDKYTISDKLWAG 222 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK+ +K G GFGY LF NS T+T+SARYYKDGSEI Sbjct: 223 HQRRKKEHKEKGNGFGYSLFTHNSEYTSTISARYYKDGSEI 263 >gi|261400948|ref|ZP_05987073.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970] gi|269209191|gb|EEZ75646.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970] Length = 313 Score = 187 bits (477), Expect = 4e-46, Method: Composition-based stats. Identities = 64/101 (63%), Positives = 81/101 (80%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA DFG+PQ RER+Y++ FLN V+F+FP P+G +GDILE + D+K TIS+KLW+G Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +Q+RK N+ AGKGFGYGLF SA TNT+SARYYKDGSEI Sbjct: 205 YQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245 >gi|150026187|ref|YP_001297013.1| type II modification methyltransferase [Flavobacterium psychrophilum JIP02/86] gi|149772728|emb|CAL44211.1| Probable type II modification methyltransferase [Flavobacterium psychrophilum JIP02/86] Length = 335 Score = 186 bits (474), Expect = 8e-46, Method: Composition-based stats. Identities = 63/101 (62%), Positives = 83/101 (82%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA +FG+PQ RER+YI+ FL+ S++FKFPTP + ++GDILE+ +D+K TIS++LWEG Sbjct: 152 LKAKEFGLPQNRERIYIVGFLDNSIKFKFPTPTKLPTKVGDILEQKVDEKYTISDRLWEG 211 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK NK GKGFG+G+ ENS TNT+SARYYKDGSEI Sbjct: 212 HQRRKIANKEKGKGFGFGIVNENSEYTNTISARYYKDGSEI 252 >gi|319407456|emb|CBI81106.1| Cytosine-specific methyltransferase NlaX [Bartonella sp. 1-1C] Length = 307 Score = 183 bits (467), Expect = 4e-45, Method: Composition-based stats. Identities = 68/101 (67%), Positives = 80/101 (79%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA DFGVPQ RER+YI+ FL+ S FKFP+P+ IK R+GDIL+ +D+K TISN LW G Sbjct: 147 LKARDFGVPQNRERIYIVGFLDHSTNFKFPSPMNIKTRVGDILDNDVDEKYTISNTLWHG 206 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK NK+ GKGFGYGLF S TNTLSARYYKDGSEI Sbjct: 207 HQRRKAQNKLNGKGFGYGLFNMESPYTNTLSARYYKDGSEI 247 >gi|119026301|ref|YP_910146.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC 15703] gi|118765885|dbj|BAF40064.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC 15703] Length = 383 Score = 183 bits (467), Expect = 5e-45, Method: Composition-based stats. Identities = 66/105 (62%), Positives = 79/105 (75%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A DFGVPQ RER+YI+ F V +FK+P P I RLGDILE+++DDK TIS+ Sbjct: 214 LAAKDFGVPQNRERIYIVGFDKEQVPNWADFKYPEPPCIPTRLGDILEKNVDDKYTISDA 273 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW GHQ+RK+ NK AGKGFGYGLF E+S NT+SARYYKDGSEI Sbjct: 274 LWAGHQRRKQENKKAGKGFGYGLFDEDSPYANTISARYYKDGSEI 318 >gi|50914506|ref|YP_060478.1| Type II restriction-modification system methylation subunit [Streptococcus pyogenes MGAS10394] gi|40218542|gb|AAR83196.1| type II modification methylase [Streptococcus pyogenes] gi|50261587|gb|AAT72355.1| methylase [Streptococcus pyogenes] gi|50903580|gb|AAT87295.1| Type II restriction-modification system methylation subunit [Streptococcus pyogenes MGAS10394] gi|114386439|gb|ABI74454.1| DNA methyltransferase [Streptococcus pyogenes] Length = 408 Score = 183 bits (466), Expect = 6e-45, Method: Composition-based stats. Identities = 62/104 (59%), Positives = 76/104 (73%), Gaps = 4/104 (3%) Query: 2 KACDFGVPQRRERLYIIDFL----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 KA DFGVPQ RER+YI+ F N EF+FP P ++ +LG+IL+ +D+K TIS+KL Sbjct: 243 KARDFGVPQNRERIYIVGFDKTCVNNFSEFRFPEPFHLETKLGNILQTDVDEKYTISDKL 302 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 WEGHQ+RK +K G GFGY LF +S TNTLSARYYKDGSEI Sbjct: 303 WEGHQRRKAEHKTKGNGFGYSLFNADSPYTNTLSARYYKDGSEI 346 >gi|224418923|ref|ZP_03656929.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT 98-5491] gi|253827874|ref|ZP_04870759.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT 98-5491] gi|313142438|ref|ZP_07804631.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT 98-5491] gi|253511280|gb|EES89939.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT 98-5491] gi|313131469|gb|EFR49086.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT 98-5491] Length = 328 Score = 182 bits (462), Expect = 2e-44, Method: Composition-based stats. Identities = 60/101 (59%), Positives = 73/101 (72%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A D+GVPQ RER+ I+ F + +V F FP P +LGDILE+ D+K TISN+LWE Sbjct: 164 LNARDYGVPQNRERIIIVGFKDHNVHFDFPKPYNYSVKLGDILEKTPDEKYTISNRLWES 223 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RKE K G GFGY LF ENS T+T+SARYYKDGSEI Sbjct: 224 HQQRKELQKAKGNGFGYRLFDENSPYTSTISARYYKDGSEI 264 >gi|283471715|emb|CAQ50926.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Staphylococcus aureus subsp. aureus ST398] Length = 397 Score = 182 bits (462), Expect = 2e-44, Method: Composition-based stats. Identities = 59/105 (56%), Positives = 73/105 (69%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 ++A DFG PQ RER+YI+ F + F FP PL I+ LG ILE +++DK TIS++ Sbjct: 227 LRARDFGCPQNRERIYIVGFDKQQIKNAENFSFPEPLPIETSLGSILESNVNDKYTISDR 286 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW GHQ+RK +K G GFGY +F E S TNTLSARYYKDGSEI Sbjct: 287 LWYGHQRRKREHKAKGNGFGYSIFNETSPYTNTLSARYYKDGSEI 331 >gi|157737722|ref|YP_001490405.1| DNA (cytosine-5-)-methyltransferase [Arcobacter butzleri RM4018] gi|157699576|gb|ABV67736.1| DNA (Cytosine-5-)-methyltransferase [Arcobacter butzleri RM4018] Length = 326 Score = 180 bits (458), Expect = 6e-44, Method: Composition-based stats. Identities = 62/101 (61%), Positives = 78/101 (77%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +FGVPQ RER+YII FL+ S++FK+P L K RLGDIL+ ++DDK TIS+KLW G Sbjct: 163 LNARNFGVPQNRERIYIIAFLDHSIDFKYPKSLNKKNRLGDILDNNVDDKYTISDKLWAG 222 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQ+RK+ +K G GFGY LF S T+T+SARYYKDGSEI Sbjct: 223 HQRRKKEHKEKGNGFGYSLFTHESEYTSTISARYYKDGSEI 263 >gi|1657420|gb|AAC45971.1| DNA cytosine methyltransferase M.SenPI [Salmonella enterica subsp. enterica serovar Enteritidis] Length = 379 Score = 178 bits (454), Expect = 2e-43, Method: Composition-based stats. Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 A DFGVPQ RER+YI+ F V F FPTPL K R+GDILE+ +D+K T+S+ LW Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GHQ+RK N AGKGFGYGLF ENS TNT+SARYYKDGSEI Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317 >gi|1871451|dbj|BAA11167.1| C5-cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi] gi|3421011|emb|CAA76526.1| M.Ecl18kI (DNA-methyltransferase) [Enterobacter cloacae] Length = 379 Score = 178 bits (454), Expect = 2e-43, Method: Composition-based stats. Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 A DFGVPQ RER+YI+ F V F FPTPL K R+GDILE+ +D+K T+S+ LW Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GHQ+RK N AGKGFGYGLF ENS TNT+SARYYKDGSEI Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317 >gi|32470131|ref|NP_863573.1| DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae] gi|462656|sp|P34879|MTS2_SHISO RecName: Full=Modification methylase SsoII; Short=M.SsoII; AltName: Full=Cytosine-specific methyltransferase SsoII gi|11559818|gb|AAG38101.1|AF300473_2 DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae] gi|294244|gb|AAA98279.1| C5-cytosine methylase [Plasmid P4] Length = 379 Score = 178 bits (453), Expect = 2e-43, Method: Composition-based stats. Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 A DFGVPQ RER+YI+ F V F FPTPL K R+GDILE+ +D+K T+S+ LW Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GHQ+RK N AGKGFGYGLF ENS TNT+SARYYKDGSEI Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317 >gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus str. psy62] gi|254547855|gb|ACT56990.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 177 bits (451), Expect = 4e-43, Method: Composition-based stats. Identities = 101/101 (100%), Positives = 101/101 (100%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG Sbjct: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI Sbjct: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 >gi|255066464|ref|ZP_05318319.1| modification methylase EcoRII [Neisseria sicca ATCC 29256] gi|298369378|ref|ZP_06980696.1| modification methylase EcoRII [Neisseria sp. oral taxon 014 str. F0314] gi|255049344|gb|EET44808.1| modification methylase EcoRII [Neisseria sicca ATCC 29256] gi|298283381|gb|EFI24868.1| modification methylase EcoRII [Neisseria sp. oral taxon 014 str. F0314] Length = 357 Score = 177 bits (450), Expect = 4e-43, Method: Composition-based stats. Identities = 57/103 (55%), Positives = 71/103 (68%), Gaps = 2/103 (1%) Query: 1 MKACDFGVPQRRERLYIIDFL--NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 M A DF +PQ RER+YI+ F + +F+FP PL ++GDILE D K TIS++LW Sbjct: 190 MAAKDFNLPQNRERIYIVGFRSAKDAAQFEFPHPLPKTVKVGDILESFPDAKYTISDRLW 249 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +GH +RK +K G GFGYGLF S TNT+SARYYKDGSEI Sbjct: 250 QGHLRRKAEHKQKGNGFGYGLFNAQSEYTNTISARYYKDGSEI 292 >gi|323968851|gb|EGB64187.1| DNA-cytosine methyltransferase [Escherichia coli TA007] Length = 282 Score = 177 bits (450), Expect = 5e-43, Method: Composition-based stats. Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 A DFGVPQ RER+YI+ F V F FPTPL K R+GDILE+ +D+K T+S+ LW Sbjct: 118 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 177 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GHQ+RK N AGKGFGYGLF ENS TNT+SARYYKDGSEI Sbjct: 178 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 220 >gi|256760956|ref|ZP_05501536.1| type II restriction-modification system methylation subunit [Enterococcus faecalis T3] gi|256682207|gb|EEU21902.1| type II restriction-modification system methylation subunit [Enterococcus faecalis T3] Length = 405 Score = 175 bits (445), Expect = 2e-42, Method: Composition-based stats. Identities = 58/104 (55%), Positives = 74/104 (71%), Gaps = 4/104 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 KA DFG PQ RER+YI+ F S++ F+FPT K +GDILE+ +D+K TIS+ L Sbjct: 237 KARDFGAPQNRERIYIVGFDKLSLKNIDLFEFPTAPKPKTCVGDILEDSVDEKYTISDTL 296 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 WEGH++RK +K G GFG+ LF +S TNT+SARYYKDGSEI Sbjct: 297 WEGHKRRKLEHKEKGNGFGFSLFNSSSPYTNTISARYYKDGSEI 340 >gi|299536257|ref|ZP_07049570.1| DNA-methyltransferase MKpn2kI [Lysinibacillus fusiformis ZC1] gi|298728243|gb|EFI68805.1| DNA-methyltransferase MKpn2kI [Lysinibacillus fusiformis ZC1] Length = 403 Score = 175 bits (444), Expect = 3e-42, Method: Composition-based stats. Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS----VEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 ++A DFGVPQ RER++++ F V FKFP PL LGDIL + +D+K TIS+K Sbjct: 212 LRAADFGVPQNRERVFMVGFNKRIGGELVPFKFPKPLSTPTNLGDILFKKVDEKYTISDK 271 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 L+EGH +RKE +K G GFG+ LF ENS+ TNTLSARYYKDGSEI Sbjct: 272 LYEGHLRRKEMHKQKGNGFGFSLFDENSSYTNTLSARYYKDGSEI 316 >gi|1709152|sp|P50185|MTD5_DACSA RecName: Full=Modification methylase DsaV; Short=M.DsaV; AltName: Full=Cytosine-specific methyltransferase DsaV gi|505694|gb|AAA86046.1| DsaV methyltransferase [Dactylococcopsis salina] Length = 351 Score = 174 bits (442), Expect = 4e-42, Method: Composition-based stats. Identities = 48/104 (46%), Positives = 76/104 (73%), Gaps = 3/104 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A DF +PQ+RER++I+ F + + + F FP P+ + ++GD+LE+ +D+K TI++++ Sbjct: 146 ISATDFNLPQKRERIFIVGFQDKNNKNLIFDFPKPIELTAKVGDLLEKEVDEKYTITDRM 205 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 WEGHQ RK+ ++ G GFG+ L NS+ T T+SARYYKDGSE+ Sbjct: 206 WEGHQNRKKAHRKRGNGFGFSLVNRNSSYTRTISARYYKDGSEV 249 >gi|462657|sp|P34877|MTSA_LACLC RecName: Full=Modification methylase ScrFIA; Short=M.ScrFI-A; Short=M.ScrFIA; AltName: Full=Cytosine-specific methyltransferase ScrFIA gi|149493|gb|AAA25220.1| SCRFI methylase [Lactococcus lactis] gi|2327034|gb|AAB66696.1| 5-methyl-cytosine methyltransferase [Lactococcus lactis subsp. cremoris] Length = 389 Score = 172 bits (438), Expect = 1e-41, Method: Composition-based stats. Identities = 65/104 (62%), Positives = 79/104 (75%), Gaps = 4/104 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 KA DFG+PQ RER+YI+ F S+ +F+ PTPL K R+G+ILE +DDK TIS+KL Sbjct: 221 KARDFGLPQNRERIYIVGFDRKSISNYSDFQMPTPLQEKTRVGNILESVVDDKYTISDKL 280 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 W+GHQ+RK NK GKGFGY LF ++S TNTLSARYYKDGSEI Sbjct: 281 WDGHQRRKTENKKNGKGFGYTLFNQDSEYTNTLSARYYKDGSEI 324 >gi|319893523|ref|YP_004150398.1| DNA-cytosine methyltransferase [Staphylococcus pseudintermedius HKU10-03] gi|317163219|gb|ADV06762.1| DNA-cytosine methyltransferase [Staphylococcus pseudintermedius HKU10-03] Length = 394 Score = 172 bits (438), Expect = 1e-41, Method: Composition-based stats. Identities = 55/105 (52%), Positives = 73/105 (69%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 +KA DFGVPQ RER+YI+ F + ++ P P + LG ILE+++D+K TIS+K Sbjct: 227 LKAKDFGVPQNRERIYIVGFDKRRIKKWRDYIPPKPPKSQTLLGKILEKNVDEKYTISDK 286 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW GH++RK +K+ G GFG+ L+ S TNTLSARYYKDGSEI Sbjct: 287 LWSGHKRRKAEHKLKGNGFGFTLYNGESPYTNTLSARYYKDGSEI 331 >gi|321310755|ref|YP_004193084.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str. Langford 1] gi|319802599|emb|CBY93245.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str. Langford 1] Length = 362 Score = 172 bits (438), Expect = 1e-41, Method: Composition-based stats. Identities = 62/105 (59%), Positives = 71/105 (67%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 ++A DFGVPQ RER+YI+ F +V FKFP LGDILE +DDK TISN Sbjct: 196 LRARDFGVPQNRERIYIVGFDKDAVQGYRNFKFPEATHKNTCLGDILESEVDDKYTISNT 255 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LWEGH++RK NK GKGFGY LF S NTLSARYYKDGSE+ Sbjct: 256 LWEGHKRRKVENKKKGKGFGYSLFNFESPYANTLSARYYKDGSEV 300 >gi|325989685|ref|YP_004249384.1| cytosine-specific methyltransferase [Mycoplasma suis KI3806] gi|323574770|emb|CBZ40430.1| Cytosine-specific methyltransferase [Mycoplasma suis] Length = 326 Score = 170 bits (432), Expect = 5e-41, Method: Composition-based stats. Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 +K+ DFG+PQ RER+YI+ F VE F P+P +GDILE+ +++K TIS+ Sbjct: 160 LKSRDFGIPQNRERIYIVGFNKDLVESYENFSMPSPTLKATCVGDILEKEVNNKYTISDL 219 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LWEGH++RKE +K+ G+GFG+ LF ENS+ TNT+SARYYKDGSEI Sbjct: 220 LWEGHKRRKEEHKLKGRGFGFSLFSENSSYTNTISARYYKDGSEI 264 >gi|325973250|ref|YP_004250314.1| cytosine-specific DNA modification methylase, HpaII-like protein [Mycoplasma suis str. Illinois] gi|323651852|gb|ADX97934.1| cytosine-specific DNA modification methylase, HpaII-like protein [Mycoplasma suis str. Illinois] Length = 326 Score = 170 bits (432), Expect = 7e-41, Method: Composition-based stats. Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 4/105 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 +K+ DFG+PQ RER+YI+ F VE F P+P +GDILE+ +++K TIS+ Sbjct: 160 LKSRDFGIPQNRERIYIVGFNKDLVESYENFSMPSPTLKATCVGDILEKEVNNKYTISDL 219 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LWEGH++RKE +K+ G+GFG+ LF ENS+ TNT+SARYYKDGSEI Sbjct: 220 LWEGHKRRKEEHKLKGRGFGFSLFSENSSYTNTISARYYKDGSEI 264 >gi|262402975|ref|ZP_06079535.1| DNA-methyltransferase MKpn2kI [Vibrio sp. RC586] gi|262350474|gb|EEY99607.1| DNA-methyltransferase MKpn2kI [Vibrio sp. RC586] Length = 410 Score = 170 bits (431), Expect = 8e-41, Method: Composition-based stats. Identities = 58/118 (49%), Positives = 72/118 (61%), Gaps = 17/118 (14%) Query: 1 MKACDFGVPQRRERLYIIDFL-------NPSVEFKFPTPLGIKPRLGDILEEH------- 46 ++A DFGVPQ RER++I+ F N F +P R+GDILE Sbjct: 216 LRAADFGVPQNRERIFIVGFDKNYFRGVNFDSLFSWPEAPKTPTRVGDILEPQHVLDEEK 275 Query: 47 ---IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 D+ TIS+KLW+GH+KRKE +KI G GFGY LF +S TNT+SARYYKDGSEI Sbjct: 276 QALGKDRYTISDKLWDGHKKRKEEHKIKGNGFGYSLFNADSEYTNTISARYYKDGSEI 333 >gi|315931535|gb|EFV10502.1| DNA (cytosine-5) methyltransferase [Campylobacter jejuni subsp. jejuni 327] Length = 284 Score = 169 bits (430), Expect = 9e-41, Method: Composition-based stats. Identities = 58/106 (54%), Positives = 76/106 (71%), Gaps = 5/106 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKF--PTPLGIKPRLGDILEEHIDDKSTISN 55 + A +FG+PQ RER+YI+ FL ++ F F + IK +LGDILE+++D+K TIS+ Sbjct: 151 LNARNFGIPQNRERIYIVAFLKNKFKNISFNFNELKNIEIKSKLGDILEKNVDEKYTISD 210 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 KLW GHQ+RK +K G GFGY LF NS T+T+SARYYKDGSEI Sbjct: 211 KLWAGHQRRKLEHKKKGNGFGYSLFNHNSDYTSTISARYYKDGSEI 256 >gi|157414453|ref|YP_001481709.1| hypothetical protein C8J_0133 [Campylobacter jejuni subsp. jejuni 81116] gi|283955585|ref|ZP_06373079.1| hypothetical protein C1336_000030018 [Campylobacter jejuni subsp. jejuni 1336] gi|157385417|gb|ABV51732.1| hypothetical protein C8J_0133 [Campylobacter jejuni subsp. jejuni 81116] gi|283792928|gb|EFC31703.1| hypothetical protein C1336_000030018 [Campylobacter jejuni subsp. jejuni 1336] Length = 321 Score = 169 bits (429), Expect = 1e-40, Method: Composition-based stats. Identities = 58/106 (54%), Positives = 76/106 (71%), Gaps = 5/106 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKF--PTPLGIKPRLGDILEEHIDDKSTISN 55 + A +FG+PQ RER+YI+ FL ++ F F + IK +LGDILE+++D+K TIS+ Sbjct: 151 LNARNFGIPQNRERIYIVAFLKNKFKNISFNFNELKNIEIKSKLGDILEKNVDEKYTISD 210 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 KLW GHQ+RK +K G GFGY LF NS T+T+SARYYKDGSEI Sbjct: 211 KLWAGHQRRKLEHKKKGNGFGYSLFNHNSDYTSTISARYYKDGSEI 256 >gi|15677157|ref|NP_274310.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis MC58] gi|161870164|ref|YP_001599334.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis 053442] gi|218768314|ref|YP_002342826.1| putative modification methylase [Neisseria meningitidis Z2491] gi|7226530|gb|AAF41666.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis MC58] gi|121052322|emb|CAM08652.1| putative modification methylase [Neisseria meningitidis Z2491] gi|161595717|gb|ABX73377.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis 053442] gi|254670478|emb|CBA06174.1| putative DNA modification methylase [Neisseria meningitidis alpha153] gi|308389411|gb|ADO31731.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis alpha710] gi|316984080|gb|EFV63058.1| modification methylase SsoII [Neisseria meningitidis H44/76] gi|319410559|emb|CBY90927.1| putative type II restriction-modification system enzyme Mod [Neisseria meningitidis WUE 2594] gi|325134466|gb|EGC57111.1| modification methylase EcoRII [Neisseria meningitidis M13399] gi|325136204|gb|EGC58812.1| modification methylase EcoRII [Neisseria meningitidis M0579] gi|325140483|gb|EGC63004.1| modification methylase EcoRII [Neisseria meningitidis CU385] gi|325144567|gb|EGC66866.1| modification methylase EcoRII [Neisseria meningitidis M01-240013] gi|325200082|gb|ADY95537.1| modification methylase EcoRII [Neisseria meningitidis H44/76] gi|325201996|gb|ADY97450.1| modification methylase EcoRII [Neisseria meningitidis M01-240149] gi|325205934|gb|ADZ01387.1| modification methylase EcoRII [Neisseria meningitidis M04-240196] gi|325208252|gb|ADZ03704.1| modification methylase EcoRII [Neisseria meningitidis NZ-05/33] Length = 337 Score = 167 bits (424), Expect = 5e-40, Method: Composition-based stats. Identities = 46/105 (43%), Positives = 63/105 (60%), Gaps = 6/105 (5%) Query: 1 MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M A + VPQ RER++I+ F N + F FP+P +P+L ILE+ +D+ T+S+ Sbjct: 171 MNAKYY-VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDN 229 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW Q + +K G GFG+GL + TLSARYYKDGSEI Sbjct: 230 LWLYLQNYAKKHKAKGNGFGFGLVD-LDGISRTLSARYYKDGSEI 273 >gi|325130344|gb|EGC53110.1| modification methylase EcoRII [Neisseria meningitidis OX99.30304] Length = 337 Score = 167 bits (424), Expect = 5e-40, Method: Composition-based stats. Identities = 46/105 (43%), Positives = 63/105 (60%), Gaps = 6/105 (5%) Query: 1 MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M A + VPQ RER++I+ F N + F FP+P +P+L ILE+ +D+ T+S+ Sbjct: 171 MNAKYY-VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDN 229 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW Q + +K G GFG+GL + TLSARYYKDGSEI Sbjct: 230 LWLYLQNYAKKHKAKGNGFGFGLVD-LDGISRTLSARYYKDGSEI 273 >gi|304387412|ref|ZP_07369603.1| modification methylase EcoRII [Neisseria meningitidis ATCC 13091] gi|304338505|gb|EFM04624.1| modification methylase EcoRII [Neisseria meningitidis ATCC 13091] Length = 336 Score = 167 bits (423), Expect = 6e-40, Method: Composition-based stats. Identities = 46/105 (43%), Positives = 63/105 (60%), Gaps = 6/105 (5%) Query: 1 MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M A + VPQ RER++I+ F N + F FP+P +P+L ILE+ +D+ T+S+ Sbjct: 171 MNAKYY-VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDN 229 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW Q + +K G GFG+GL + TLSARYYKDGSEI Sbjct: 230 LWLYLQNYAKKHKAKGNGFGFGLVD-LDGISRTLSARYYKDGSEI 273 >gi|260554958|ref|ZP_05827179.1| DNA-methyltransferase MKpn2kI [Acinetobacter baumannii ATCC 19606] gi|260411500|gb|EEX04797.1| DNA-methyltransferase MKpn2kI [Acinetobacter baumannii ATCC 19606] Length = 413 Score = 166 bits (422), Expect = 9e-40, Method: Composition-based stats. Identities = 57/114 (50%), Positives = 74/114 (64%), Gaps = 13/114 (11%) Query: 1 MKACDFGVPQRRERLYIIDFL--------NPSVEFKFPTPLGIKPRLGDILEE-----HI 47 ++A DFGVPQ RER++++ F N F +P P + RLGDILE+ Sbjct: 222 LRAADFGVPQNRERIFLVGFDKNYFGEECNFDQLFSWPVPPKKQTRLGDILEDVSKLKKS 281 Query: 48 DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +D TIS++LW+GHQ+RKE + I G GFGY L+ +S TNTLSARYYKDGSEI Sbjct: 282 EDVYTISDRLWQGHQRRKEEHGIKGNGFGYTLYTGDSPYTNTLSARYYKDGSEI 335 >gi|294788070|ref|ZP_06753314.1| modification methylase EcoRII [Simonsiella muelleri ATCC 29453] gi|294484363|gb|EFG32046.1| modification methylase EcoRII [Simonsiella muelleri ATCC 29453] Length = 355 Score = 166 bits (421), Expect = 1e-39, Method: Composition-based stats. Identities = 51/106 (48%), Positives = 69/106 (65%), Gaps = 5/106 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-----SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + A +FGVPQ RER+YI+ N +++F + ++GDIL+ +D+K TIS+ Sbjct: 184 LNAKNFGVPQNRERIYIVAIRNDFNPTFNLDFDKLKNTKVNCQVGDILQNQVDEKYTISD 243 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 KLW GHQ+RK + G GFGY LF S T+T+SARYYKDGSEI Sbjct: 244 KLWAGHQRRKAEHIEKGNGFGYSLFNAQSPYTSTISARYYKDGSEI 289 >gi|323495143|ref|ZP_08100228.1| DNA-methyltransferase MKpn2kI [Vibrio brasiliensis LMG 20546] gi|323310583|gb|EGA63762.1| DNA-methyltransferase MKpn2kI [Vibrio brasiliensis LMG 20546] Length = 443 Score = 165 bits (419), Expect = 2e-39, Method: Composition-based stats. Identities = 56/118 (47%), Positives = 70/118 (59%), Gaps = 17/118 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-------SVEFKFPTPLGIKPRLGDILEEHID----- 48 ++A DFGVPQ RER++II F F +P P ++GDIL+ + Sbjct: 248 LRAADFGVPQNRERIFIIGFDKDYYTGVDFDQVFNWPEPPKTPTKVGDILQSDQELEAEA 307 Query: 49 -----DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 D TIS++LWEGHQKRKE +K G GFGY L+ S TNT+SARYYKDGSEI Sbjct: 308 KVIGKDCYTISDRLWEGHQKRKEGHKTKGNGFGYTLYNAESEYTNTISARYYKDGSEI 365 >gi|152998369|ref|YP_001343204.1| DNA-cytosine methyltransferase [Marinomonas sp. MWYL1] gi|150839293|gb|ABR73269.1| DNA-cytosine methyltransferase [Marinomonas sp. MWYL1] Length = 417 Score = 164 bits (416), Expect = 4e-39, Method: Composition-based stats. Identities = 57/102 (55%), Positives = 79/102 (77%), Gaps = 1/102 (0%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 +K+ DFGVPQ R+R+YI+ + + ++ F +P +G+ R+GDILE + + K TIS++LWE Sbjct: 255 LKSVDFGVPQNRQRIYIVLWKDGEIDKFDYPESMGLDTRVGDILEANPNPKLTISDRLWE 314 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GHQ+RK NKI GKGFGYG+ E+S TNT+SARYYKDGSE+ Sbjct: 315 GHQRRKMQNKINGKGFGYGIVTEDSPYTNTISARYYKDGSEV 356 >gi|170729237|ref|YP_001763263.1| DNA-cytosine methyltransferase [Shewanella woodyi ATCC 51908] gi|169814584|gb|ACA89168.1| DNA-cytosine methyltransferase [Shewanella woodyi ATCC 51908] Length = 416 Score = 164 bits (416), Expect = 4e-39, Method: Composition-based stats. Identities = 57/102 (55%), Positives = 73/102 (71%), Gaps = 1/102 (0%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 M++ DFGVPQ R+R+YII + + +E F++P P G ++ DILE +K TIS+KLW Sbjct: 255 MRSVDFGVPQNRQRIYIILWKDGLIEQFQYPKPSGKDTKVADILESEPCEKLTISDKLWA 314 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 GH++RK NK GKGFGYGL S TNT+SARYYKDGSEI Sbjct: 315 GHKRRKIENKAKGKGFGYGLVSPESEYTNTISARYYKDGSEI 356 >gi|166368844|ref|YP_001661117.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa NIES-843] gi|166091217|dbj|BAG05925.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa NIES-843] Length = 338 Score = 162 bits (410), Expect = 2e-38, Method: Composition-based stats. Identities = 46/94 (48%), Positives = 59/94 (62%), Gaps = 2/94 (2%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67 VPQ R+R++I+ F PS F FP I P++ DILE +D K T+++ LW+ QK + Sbjct: 158 VPQNRKRIFIVGFEKPS-RFMFPEIPDIHPKIKDILEGEVDSKYTLTDHLWDYLQKYADK 216 Query: 68 NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +K G GFGYGL TLSARYYKDGSEI Sbjct: 217 HKEKGNGFGYGLVNLE-GIARTLSARYYKDGSEI 249 >gi|124024750|ref|YP_001013866.1| site-specific DNA methylase [Prochlorococcus marinus str. NATL1A] gi|123959818|gb|ABM74601.1| Site-specific DNA methylase [Prochlorococcus marinus str. NATL1A] Length = 305 Score = 161 bits (409), Expect = 3e-38, Method: Composition-based stats. Identities = 50/101 (49%), Positives = 76/101 (75%), Gaps = 1/101 (0%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFGVPQ RER++I +++ + F+FP P ++ ++GDIL++++ DK T+S+K+W Sbjct: 146 LNAKDFGVPQNRERIFIFGYID-FIFFEFPEPSKVQTKVGDILDDNVPDKFTLSDKMWTN 204 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +RKENN+ G GFG+ LF ++S T+T+SARYYKDGSEI Sbjct: 205 AIRRKENNRKRGYGFGFSLFDKDSEYTSTISARYYKDGSEI 245 >gi|296103580|ref|YP_003613726.1| DNA cytosine methylase [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295058039|gb|ADF62777.1| DNA cytosine methylase [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 471 Score = 161 bits (408), Expect = 3e-38, Method: Composition-based stats. Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 9/105 (8%) Query: 6 FGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLW 58 + +PQ RER+ ++ F N +F + +P + D+LE +D K ++ LW Sbjct: 269 YFLPQHRERIVLVGFRRDLNLKGDFTLRDIPSLYPARRPSVADLLEPAVDAKFILTPVLW 328 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + + ++ G GFG+GL N T TLSARYYKDG+EI Sbjct: 329 KYLYRYAKKHQAKGNGFGFGLVNPNDPHCVTRTLSARYYKDGAEI 373 >gi|229530048|ref|ZP_04419438.1| type II restriction-modification system methylation subunit [Vibrio cholerae 12129(1)] gi|229333822|gb|EEN99308.1| type II restriction-modification system methylation subunit [Vibrio cholerae 12129(1)] Length = 270 Score = 161 bits (408), Expect = 4e-38, Method: Composition-based stats. Identities = 57/118 (48%), Positives = 69/118 (58%), Gaps = 17/118 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-------FKFPTPLGIKPRLGDILEE-------- 45 ++A DFG PQ RER++II F F +P R+GDIL+ Sbjct: 76 LRAADFGSPQNRERIFIIGFNKDEFPNIDFDKLFSWPKAPKTPTRVGDILQTQQELELDK 135 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 H D+ TIS+KLWEGHQKRK +K G GFGY LF +S TNT+SARYYKDGSEI Sbjct: 136 KLHGKDRFTISDKLWEGHQKRKAEHKTKGNGFGYSLFNADSEYTNTISARYYKDGSEI 193 >gi|37524351|ref|NP_927695.1| DNA cytosine methylase [Photorhabdus luminescens subsp. laumondii TTO1] gi|36783775|emb|CAE12633.1| DNA-cytosine methyltransferase [Photorhabdus luminescens subsp. laumondii TTO1] Length = 478 Score = 160 bits (407), Expect = 4e-38, Method: Composition-based stats. Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 9/105 (8%) Query: 6 FGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58 + +PQ RER+ ++ F N F +P L D+LE +D K ++ LW Sbjct: 279 YFLPQHRERIVLVGFRKDLNIHQGFTLRDISRYFPKERPTLADLLEPEVDSKYILTPNLW 338 Query: 59 EGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 + ++ G GFG+GL N + T TLSARY+KDGSEI Sbjct: 339 KYLYNYARKHQAKGNGFGFGLIDPNNKDSVTRTLSARYHKDGSEI 383 >gi|17863973|gb|AAL46998.1|AF448250_2 putative C-5 cytosine-specific DNA methylase [Bacteroides coprosuis DSM 18011] Length = 401 Score = 160 bits (407), Expect = 5e-38, Method: Composition-based stats. Identities = 53/110 (48%), Positives = 67/110 (60%), Gaps = 10/110 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--------FKFPTPLGIKPRLGDILEEHI--DDK 50 + A DFG PQ RER+YI+ F F+FP P K + D+LE+ D Sbjct: 237 LNAKDFGSPQNRERIYIVGFNKNHFTKIDDFNEIFQFPEPSKEKVSVKDVLEKIPANDTI 296 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 TIS ++W+GHQKRK ++ G GFG+ LF ENS TNT+SARYYKDGSE Sbjct: 297 YTISERIWQGHQKRKLKHQNKGNGFGFSLFNENSEYTNTISARYYKDGSE 346 >gi|317497297|ref|ZP_07955620.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium 5_1_63FAA] gi|316895366|gb|EFV17525.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium 5_1_63FAA] Length = 385 Score = 160 bits (405), Expect = 9e-38, Method: Composition-based stats. Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 6/106 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-----SVEFKFPT-PLGIKPRLGDILEEHIDDKSTIS 54 + A FG+PQ RER+ I+ F +FK+P + K +GDILE+ + ++ TIS Sbjct: 213 LNAYHFGIPQNRERIIIVGFNKDYLPKKFKDFKYPVGKIDKKVCVGDILEKEVGERFTIS 272 Query: 55 NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 +KLWEGHQ RK +K G GFG+ LF ++S T+T+SARYYKDGSE Sbjct: 273 DKLWEGHQARKRMHKKKGNGFGFCLFNKDSKYTSTISARYYKDGSE 318 >gi|238922589|ref|YP_002936102.1| modification methylase [Eubacterium rectale ATCC 33656] gi|238874261|gb|ACR73968.1| modification methylase [Eubacterium rectale ATCC 33656] Length = 392 Score = 159 bits (404), Expect = 1e-37, Method: Composition-based stats. Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 7/106 (6%) Query: 1 MKACDFGVPQRRERLYIIDF----LNPSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISN 55 + +F VPQ RER+ I+ F +EF F TP+ KP + DILE+ +DDK T+S+ Sbjct: 214 LDGQNF-VPQHRERIIIVGFDMERYGDDIEFDFDITPVNPKPVMRDILEKKVDDKYTLSD 272 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 LW Q ++ AG GFGYG+ + T+SARY+KDGSEI Sbjct: 273 NLWTYLQNYAAKHRAAGNGFGYGI-APLDGVSRTISARYHKDGSEI 317 >gi|237713924|ref|ZP_04544405.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. D1] gi|262409168|ref|ZP_06085712.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. 2_1_22] gi|229446080|gb|EEO51871.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. D1] gi|262352915|gb|EEZ02011.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. 2_1_22] Length = 361 Score = 159 bits (404), Expect = 1e-37, Method: Composition-based stats. Identities = 44/98 (44%), Positives = 55/98 (56%), Gaps = 5/98 (5%) Query: 8 VPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 VPQ RER+ I+ F F FP + +ILE IDDK T+S+KLW Q Sbjct: 186 VPQHRERIMIVGFNREIFHGEEQFCFPEQKQSTRGIREILESDIDDKYTLSDKLWSYLQN 245 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 E ++ G GFG+G+ N + TLSARYYKDGSEI Sbjct: 246 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 282 >gi|294646710|ref|ZP_06724334.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a] gi|294807186|ref|ZP_06766001.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD CC 1b] gi|292637950|gb|EFF56344.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a] gi|294445609|gb|EFG14261.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD CC 1b] Length = 445 Score = 159 bits (404), Expect = 1e-37, Method: Composition-based stats. Identities = 44/98 (44%), Positives = 55/98 (56%), Gaps = 5/98 (5%) Query: 8 VPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 VPQ RER+ I+ F F FP + +ILE IDDK T+S+KLW Q Sbjct: 270 VPQHRERIMIVGFNREIFHGEEQFCFPEQKQSTRGIREILESDIDDKYTLSDKLWSYLQN 329 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 E ++ G GFG+G+ N + TLSARYYKDGSEI Sbjct: 330 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 366 >gi|312898460|ref|ZP_07757850.1| DNA (cytosine-5-)-methyltransferase [Megasphaera micronuciformis F0359] gi|310620379|gb|EFQ03949.1| DNA (cytosine-5-)-methyltransferase [Megasphaera micronuciformis F0359] Length = 400 Score = 159 bits (403), Expect = 1e-37, Method: Composition-based stats. Identities = 45/99 (45%), Positives = 59/99 (59%), Gaps = 6/99 (6%) Query: 8 VPQRRERLYIIDFLN----PSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62 VPQ RER+ I+ F + F+F P+ KP + ILE +DDK T+++KLW Q Sbjct: 208 VPQHRERILIVGFDRKRYGRDIGFRFSIAPVNPKPAIKAILETKVDDKYTLTDKLWTYLQ 267 Query: 63 KRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 ++ AG GFGYG+ N + TLSARYYKDGSEI Sbjct: 268 NYAAKHRAAGNGFGYGIADPN-GVSRTLSARYYKDGSEI 305 >gi|313158099|gb|EFR57504.1| putative DNA (cytosine-5-)-methyltransferase [Alistipes sp. HGB5] Length = 431 Score = 159 bits (403), Expect = 1e-37, Method: Composition-based stats. Identities = 42/100 (42%), Positives = 58/100 (58%), Gaps = 5/100 (5%) Query: 6 FGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61 + VPQ RER+ I+ F N FKFP + ++ +ILE +D K T+++KLW Sbjct: 265 YFVPQHRERIMIVGFRNNLFHGVEKFKFPELKDVSHKIRNILEPEVDPKYTLTDKLWVYL 324 Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q + ++ +G GFG+GL TLSARYYKDGSEI Sbjct: 325 QNYAKKHQDSGNGFGFGLVD-LDGIARTLSARYYKDGSEI 363 >gi|238783073|ref|ZP_04627100.1| Modification methylase EcoRII [Yersinia bercovieri ATCC 43970] gi|238716074|gb|EEQ08059.1| Modification methylase EcoRII [Yersinia bercovieri ATCC 43970] Length = 475 Score = 158 bits (402), Expect = 2e-37, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 +F +PQ RER+ ++ F N +F +P G++LE +DDK ++ Sbjct: 278 KNF-LPQHRERIVLVGFRKDLNIDKDFTLKDIHKFFPEKRPTFGELLEPVVDDKYILTPH 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 LW+ + ++ G GFG+GL + + TLSARY+KDGSEI Sbjct: 337 LWKYLYNYAKKHQAKGNGFGFGLVDPTNSDSVARTLSARYHKDGSEI 383 >gi|261340425|ref|ZP_05968283.1| DNA (cytosine-5-)-methyltransferase [Enterobacter cancerogenus ATCC 35316] gi|288317516|gb|EFC56454.1| DNA (cytosine-5-)-methyltransferase [Enterobacter cancerogenus ATCC 35316] Length = 477 Score = 157 bits (399), Expect = 3e-37, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + +P + D+LE +D K ++ Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLMGDFTLRNLPALYPARRPTIADLLEPAVDAKFILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFG+G+ N T TLSARYYKDG+EI Sbjct: 333 LWKYLYRYAKKHQAKGNGFGFGMVNPNDPHSVTRTLSARYYKDGAEI 379 >gi|295098276|emb|CBK87366.1| DNA-methyltransferase (dcm) [Enterobacter cloacae subsp. cloacae NCTC 9394] Length = 477 Score = 157 bits (399), Expect = 4e-37, Method: Composition-based stats. Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + +P + D+LE +D K ++ Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKGDFTLRDLPSLYPARRPTVADLLEPAVDAKFILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 LW+ + + ++ G GFG+G+ + T TLSARYYKDG+EI Sbjct: 333 LWKYLYRYAKKHQAKGNGFGFGMVNPLNPDSVTRTLSARYYKDGAEI 379 >gi|308126237|ref|ZP_05908633.2| DNA (cytosine-5-)-methyltransferase [Vibrio parahaemolyticus AQ4037] gi|308107574|gb|EFO45114.1| DNA (cytosine-5-)-methyltransferase [Vibrio parahaemolyticus AQ4037] Length = 426 Score = 157 bits (399), Expect = 4e-37, Method: Composition-based stats. Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 8/108 (7%) Query: 1 MKACDFGVPQRRERLYIIDF-------LNPSVEFKFPTPLGIKPRLGDILE-EHIDDKST 52 ++A DFG PQ RER+Y++ F L+ + F+FP P ++GDILE D T Sbjct: 248 LRAADFGAPQNRERIYLVGFDKDYFGDLDFNSIFQFPEPTMKPTKVGDILETSDYVDSFT 307 Query: 53 ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 IS+K+W HQKRK +K G GFG+ L + TNT+SARYYKDGSE Sbjct: 308 ISDKIWASHQKRKAGHKNKGNGFGFTLVNSETKYTNTISARYYKDGSE 355 >gi|133756232|ref|YP_001096382.1| DNA cytosine methylase [Escherichia coli] gi|110084067|gb|ABG49221.1| hypothetical protein [Escherichia coli] Length = 566 Score = 157 bits (399), Expect = 4e-37, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 367 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 425 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 426 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 472 >gi|53714966|ref|YP_100958.1| C-5 cytosine-specific DNA-methylase [Bacteroides fragilis YCH46] gi|52217831|dbj|BAD50424.1| C-5 cytosine-specific DNA-methylase [Bacteroides fragilis YCH46] Length = 431 Score = 157 bits (398), Expect = 5e-37, Method: Composition-based stats. Identities = 42/98 (42%), Positives = 55/98 (56%), Gaps = 5/98 (5%) Query: 8 VPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 VPQ RER+ I+ F +F FP + +IL+ ID K T+S+KLW Q Sbjct: 270 VPQHRERIMIVGFNQDVFHGKEQFAFPEQKQSTRSIKEILDPDIDGKYTLSDKLWSYLQN 329 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 E ++ G GFG+G+ N + TLSARYYKDGSEI Sbjct: 330 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 366 >gi|311279100|ref|YP_003941331.1| DNA-cytosine methyltransferase [Enterobacter cloacae SCF1] gi|308748295|gb|ADO48047.1| DNA-cytosine methyltransferase [Enterobacter cloacae SCF1] Length = 492 Score = 156 bits (396), Expect = 8e-37, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F G+ +P G++LE +D K ++ Sbjct: 290 RHF-LPQHRERIVLVGFRRDLNLHQGFSLRALPGLYPAQRPTFGELLEPTVDAKFILTPV 348 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 349 LWKYLYRYAKKHQARGNGFGYGLVDPTNPDSVARTLSARYYKDGAEI 395 >gi|297622183|ref|YP_003675732.1| EcoRII cytosine-methyltransferase [Klebsiella oxytoca KOX105] gi|296492002|gb|ADH29504.1| EcoRII cytosine-methyltransferase [Klebsiella oxytoca KOX105] Length = 491 Score = 156 bits (395), Expect = 1e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 292 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 350 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 351 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397 >gi|165938005|ref|ZP_02226565.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Yersinia pestis biovar Orientalis str. IP275] gi|165914028|gb|EDR32645.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Yersinia pestis biovar Orientalis str. IP275] Length = 282 Score = 156 bits (395), Expect = 1e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 83 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 141 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 142 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 188 >gi|323486195|ref|ZP_08091524.1| cytosine-specific methyltransferase [Clostridium symbiosum WAL-14163] gi|323400521|gb|EGA92890.1| cytosine-specific methyltransferase [Clostridium symbiosum WAL-14163] Length = 382 Score = 155 bits (394), Expect = 1e-36, Method: Composition-based stats. Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 7/106 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP----SVEFKFP-TPLGIKPRLGDILEEHIDDKSTISN 55 + +F VPQ RER+ I+ F ++F F TP KP + DIL++ +D+K T+S+ Sbjct: 204 LDGQNF-VPQHRERIIIVGFDRERYGQDIKFDFEITPAIPKPVMKDILDKKVDEKYTLSD 262 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 KLW Q +K AG GFGYG+ + T+SARYYKDGSEI Sbjct: 263 KLWIYLQSYAAKHKAAGNGFGYGI-APLDGVSRTISARYYKDGSEI 307 >gi|296538000|gb|ADH30019.1| EcoRII cytosine methylase [Escherichia coli O25b:H4 str. EC958] Length = 477 Score = 155 bits (394), Expect = 1e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383 >gi|160431610|ref|YP_001551777.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Dublin] gi|298206539|ref|YP_003717476.1| EcoRII modification enzyme [Escherichia coli] gi|159885479|dbj|BAF93082.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Dublin] gi|296537944|gb|ADH29964.1| EcoRII modification enzyme [Escherichia coli O25b:H4 str. EC958] Length = 477 Score = 155 bits (394), Expect = 1e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383 >gi|113706802|ref|YP_724464.1| DNA cytosine methylase [Escherichia coli] gi|190576899|ref|YP_001966231.1| M.EcoRII DNA methylase [Klebsiella pneumoniae] gi|194433606|ref|ZP_03065883.1| modification methylase EcoRII [Shigella dysenteriae 1012] gi|209901141|ref|YP_002286923.1| DNA cytosine methylase [Klebsiella pneumoniae] gi|209901236|ref|YP_002287017.1| DNA cytosine methylase [Klebsiella pneumoniae] gi|215528089|ref|YP_002332862.1| EcoRII cytosine methylase [Klebsiella pneumoniae] gi|302141639|ref|YP_003813098.1| EcoRII methylase [Klebsiella pneumoniae] gi|127448|sp|P05101|MTE2_ECOLX RecName: Full=Modification methylase EcoRII; Short=M.EcoRII; AltName: Full=Cytosine-specific methyltransferase EcoRII gi|41317|emb|CAA28725.1| unnamed protein product [Escherichia coli HB101] gi|109390538|gb|ABG33840.1| EcoRII modification enzyme [Escherichia coli] gi|110264483|gb|ABG56846.1| M.EcoRII DNA methylase [Klebsiella pneumoniae] gi|165928612|gb|ABY74380.1| EcoRII cytosine methylase [Klebsiella pneumoniae] gi|194418198|gb|EDX34290.1| modification methylase EcoRII [Shigella dysenteriae 1012] gi|197092209|gb|ACH42172.1| EcoRII cytosine methylase [Klebsiella pneumoniae] gi|209574187|gb|ACI63075.1| modification methylase [Klebsiella pneumoniae] gi|209574298|gb|ACI63184.1| modification methylase [Klebsiella pneumoniae] gi|296033904|gb|ADG84867.1| EcoRII methylase [Klebsiella pneumoniae] Length = 477 Score = 155 bits (394), Expect = 1e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383 >gi|283785730|ref|YP_003365595.1| DNA-cytosine methyltransferase [Citrobacter rodentium ICC168] gi|282949184|emb|CBG88792.1| DNA-cytosine methyltransferase [Citrobacter rodentium ICC168] Length = 477 Score = 155 bits (394), Expect = 1e-36, Method: Composition-based stats. Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 9/105 (8%) Query: 6 FGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58 + +PQ RER+ ++ F N +F + L ++LE ++ K ++ LW Sbjct: 275 YFLPQHRERIVLVGFRRDLNLKGDFTLRDISTRYPQRRTTLAELLEPVVEAKYVLTPVLW 334 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + + ++ G GFGYG+ + T TLSARYYKDG+EI Sbjct: 335 KYLYRYAKKHQAKGNGFGYGMVSPSDPNSVTRTLSARYYKDGAEI 379 >gi|134044844|ref|YP_001102126.1| cytosine-specific methyltransferase [Yersinia pestis biovar Orientalis str. IP275] gi|133905378|gb|ABO42140.1| cytosine-specific methyltransferase [Yersinia pestis biovar Orientalis str. IP275] Length = 274 Score = 155 bits (394), Expect = 2e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 75 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 133 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 134 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 180 >gi|62180565|ref|YP_216982.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|62128198|gb|AAX65901.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|322715041|gb|EFZ06612.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] Length = 476 Score = 155 bits (394), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|218695565|ref|YP_002403232.1| DNA cytosine methylase [Escherichia coli 55989] gi|256022383|ref|ZP_05436248.1| DNA cytosine methylase [Escherichia sp. 4_1_40B] gi|218352297|emb|CAU98056.1| DNA cytosine methylase [Escherichia coli 55989] gi|323972739|gb|EGB67939.1| DNA-cytosine methyltransferase [Escherichia coli TA007] gi|332343686|gb|AEE57020.1| DNA-cytosine methyltransferase [Escherichia coli UMNK88] Length = 472 Score = 155 bits (394), Expect = 2e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F G P L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|238787820|ref|ZP_04631617.1| Modification methylase EcoRII [Yersinia frederiksenii ATCC 33641] gi|238724163|gb|EEQ15806.1| Modification methylase EcoRII [Yersinia frederiksenii ATCC 33641] Length = 475 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 +F +PQ RER+ ++ F N +F +P G++LE + DK ++ Sbjct: 278 KNF-LPQHRERIVLVGFRKDLNIDKDFTLKDINKFFPEKRPEFGELLESVVADKYILTPH 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LW+ + ++ G GFG+GL + + TLSARY+KDGSEI Sbjct: 337 LWKYLYNYAKKHQAKGNGFGFGLVDPTNSESVARTLSARYHKDGSEI 383 >gi|301029418|ref|ZP_07192512.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1] gi|299877722|gb|EFI85933.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F G P L +L+ ++ K ++ Sbjct: 273 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 331 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 332 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378 >gi|161505003|ref|YP_001572115.1| DNA cytosine methylase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|160866350|gb|ABX22973.1| hypothetical protein SARI_03133 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 474 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 +F +PQ RER+ ++ F N F +P G +L+ +D K +S K Sbjct: 278 KNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIHKFYPEKRPTFGQLLDPAVDSKYILSPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383 >gi|168462467|ref|ZP_02696398.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|194443436|ref|YP_002041256.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|238912436|ref|ZP_04656273.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] gi|194402099|gb|ACF62321.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|195634356|gb|EDX52708.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Newport str. SL317] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|200390041|ref|ZP_03216652.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|199602486|gb|EDZ01032.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Virchow str. SL491] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|168239231|ref|ZP_02664289.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|194734985|ref|YP_002115026.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|204931362|ref|ZP_03222061.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|194710487|gb|ACF89708.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197288080|gb|EDY27467.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|204319845|gb|EDZ05054.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|167552776|ref|ZP_02346527.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205322616|gb|EDZ10455.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|322616984|gb|EFY13892.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322618223|gb|EFY15115.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322625894|gb|EFY22713.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322626346|gb|EFY23156.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322632761|gb|EFY29506.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322639103|gb|EFY35796.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322640419|gb|EFY37075.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322647220|gb|EFY43719.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322648528|gb|EFY44979.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] gi|322655540|gb|EFY51848.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322660318|gb|EFY56556.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322662999|gb|EFY59206.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322668184|gb|EFY64343.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322674057|gb|EFY70151.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322675591|gb|EFY71665.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322682998|gb|EFY79014.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322686692|gb|EFY82670.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|323195420|gb|EFZ80600.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323198052|gb|EFZ83169.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323204476|gb|EFZ89482.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323207566|gb|EFZ92514.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323210995|gb|EFZ95855.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323217551|gb|EGA02270.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323226697|gb|EGA10894.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323231573|gb|EGA15686.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323236016|gb|EGA20095.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323240586|gb|EGA24629.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323245478|gb|EGA29478.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323247596|gb|EGA31547.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323254424|gb|EGA38240.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323257764|gb|EGA41444.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323262129|gb|EGA45692.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323266252|gb|EGA49742.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323270729|gb|EGA54168.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPGSVARTLSARYYKDGAEI 378 >gi|161613440|ref|YP_001587405.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|205352316|ref|YP_002226117.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|207856496|ref|YP_002243147.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|161362804|gb|ABX66572.1| hypothetical protein SPAB_01156 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|205272097|emb|CAR36949.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|206708299|emb|CAR32602.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|326627365|gb|EGE33708.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|168259722|ref|ZP_02681695.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|205351069|gb|EDZ37700.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNISRCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|198242597|ref|YP_002215094.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|197937113|gb|ACH74446.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|326622842|gb|EGE29187.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Dublin str. 3246] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNISRCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|259909642|ref|YP_002649998.1| DNA cytosine methylase [Erwinia pyrifoliae Ep1/96] gi|224965264|emb|CAX56796.1| Cytosine-specific methyltransferase [Erwinia pyrifoliae Ep1/96] gi|261863687|gb|ACY01298.1| unknown [Erwinia pyrifoliae] gi|283479721|emb|CAY75637.1| DNA cytosine methylase [Erwinia pyrifoliae DSM 12163] Length = 473 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 +F +PQ RER+ ++ F N F +P G +LE+ +D K ++ + Sbjct: 278 KNF-LPQHRERIVLVGFRRDLNIHQNFTLSNISRYFPDKRPEFGSLLEKTVDSKYILTPR 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPTNSGSVARTLSARYHKDGSEI 383 >gi|197251440|ref|YP_002146032.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197215143|gb|ACH52540.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Agona str. SL483] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|157147667|ref|YP_001454986.1| DNA cytosine methylase [Citrobacter koseri ATCC BAA-895] gi|157084872|gb|ABV14550.1| hypothetical protein CKO_03470 [Citrobacter koseri ATCC BAA-895] Length = 474 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 +F +PQ RER+ ++ F N F +P G +L+ +D K +S K Sbjct: 278 KNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIHKFYPEKRPTFGQLLDPAVDSKYILSPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383 >gi|167035739|ref|YP_001670970.1| DNA cytosine methylase [Pseudomonas putida GB-1] gi|166862227|gb|ABZ00635.1| DNA-cytosine methyltransferase [Pseudomonas putida GB-1] Length = 447 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 42/103 (40%), Positives = 56/103 (54%), Gaps = 8/103 (7%) Query: 6 FGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58 + PQ RER+ ++ F F +P LGDIL+E +DDK ++ KLW Sbjct: 259 YFTPQHRERIVLVGFRKDLGVHSGFTLKDIAELFPKKRPALGDILDEKVDDKYILTPKLW 318 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + +K G GFG+GL + S+ T TLSARYYKDGSEI Sbjct: 319 QYLFNYAIKHKAKGNGFGFGLVGK-SSVTRTLSARYYKDGSEI 360 >gi|56413096|ref|YP_150171.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197362022|ref|YP_002141659.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|56127353|gb|AAV76859.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|197093499|emb|CAR58960.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|16765328|ref|NP_460943.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|167993566|ref|ZP_02574660.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|16420526|gb|AAL20902.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|205328427|gb|EDZ15191.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. CVM23701] gi|261247157|emb|CBG24980.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] gi|267993981|gb|ACY88866.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301158505|emb|CBW18015.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312912981|dbj|BAJ36955.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|321224636|gb|EFX49699.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|323130270|gb|ADX17700.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] gi|332988880|gb|AEF07863.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|82776352|ref|YP_402701.1| DNA cytosine methylase [Shigella dysenteriae Sd197] gi|309789422|ref|ZP_07684012.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1617] gi|81240500|gb|ABB61210.1| DNA cytosine methylase [Shigella dysenteriae Sd197] gi|308922816|gb|EFP68333.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1617] Length = 472 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F G P L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|224583511|ref|YP_002637309.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|224468038|gb|ACN45868.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] Length = 476 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|118614638|ref|YP_908421.1| DNA methyltrasferase [Photobacterium damselae subsp. piscicida] gi|118596729|dbj|BAF38033.1| DNA methyltrasferase [Photobacterium damselae subsp. piscicida] Length = 266 Score = 155 bits (393), Expect = 2e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 67 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 125 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 126 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 172 >gi|168244842|ref|ZP_02669774.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|194449372|ref|YP_002046042.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194407676|gb|ACF67895.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|205336375|gb|EDZ23139.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] Length = 476 Score = 155 bits (392), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|168234164|ref|ZP_02659222.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|168821682|ref|ZP_02833682.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|194470868|ref|ZP_03076852.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|197263635|ref|ZP_03163709.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|194457232|gb|EDX46071.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|197241890|gb|EDY24510.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|205331847|gb|EDZ18611.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|205341769|gb|EDZ28533.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|320085391|emb|CBY95172.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] Length = 476 Score = 155 bits (392), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|16760934|ref|NP_456551.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|29141374|ref|NP_804716.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|213424982|ref|ZP_03357732.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] gi|289829483|ref|ZP_06547095.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] gi|25286126|pir||AH0754 site-specific DNA-methyltransferase (cytosine-specific) (EC 2.1.1.73) - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|16503231|emb|CAD05739.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Typhi] gi|29137001|gb|AAO68565.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] Length = 476 Score = 155 bits (392), Expect = 2e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|193071315|ref|ZP_03052233.1| DNA-cytosine methyltransferase [Escherichia coli E110019] gi|331683510|ref|ZP_08384111.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299] gi|192955357|gb|EDV85842.1| DNA-cytosine methyltransferase [Escherichia coli E110019] gi|331079725|gb|EGI50922.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299] Length = 472 Score = 155 bits (392), Expect = 2e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F G P L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|188494720|ref|ZP_03001990.1| DNA-cytosine methyltransferase [Escherichia coli 53638] gi|188489919|gb|EDU65022.1| DNA-cytosine methyltransferase [Escherichia coli 53638] Length = 472 Score = 155 bits (392), Expect = 2e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F G P L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDINLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|300899219|ref|ZP_07117494.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1] gi|300357175|gb|EFJ73045.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1] Length = 477 Score = 155 bits (392), Expect = 2e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F G P L +L+ ++ K ++ Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|323186716|gb|EFZ72038.1| DNA-cytosine methyltransferase [Escherichia coli RN587/1] Length = 472 Score = 155 bits (392), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|215487159|ref|YP_002329590.1| DNA cytosine methylase [Escherichia coli O127:H6 str. E2348/69] gi|312967158|ref|ZP_07781376.1| DNA-cytosine methyltransferase [Escherichia coli 2362-75] gi|215265231|emb|CAS09622.1| DNA cytosine methylase [Escherichia coli O127:H6 str. E2348/69] gi|312288622|gb|EFR16524.1| DNA-cytosine methyltransferase [Escherichia coli 2362-75] Length = 472 Score = 155 bits (392), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|152970972|ref|YP_001336081.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|150955821|gb|ABR77851.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 477 Score = 155 bits (392), Expect = 3e-36, Method: Composition-based stats. Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F F ++P G++LE +D K ++ Sbjct: 274 RHF-LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYPAVRPTFGELLEPTVDSKFILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 333 LWKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379 >gi|331643338|ref|ZP_08344469.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli H736] gi|331036809|gb|EGI09033.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli H736] Length = 491 Score = 155 bits (392), Expect = 3e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 292 KHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYILTPK 350 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 351 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397 >gi|288934555|ref|YP_003438614.1| DNA-cytosine methyltransferase [Klebsiella variicola At-22] gi|288889264|gb|ADC57582.1| DNA-cytosine methyltransferase [Klebsiella variicola At-22] Length = 466 Score = 155 bits (392), Expect = 3e-36, Method: Composition-based stats. Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F F ++P G++LE +D K ++ Sbjct: 263 RHF-LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTVDAKFILTPV 321 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 322 LWKYLYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 368 >gi|218701133|ref|YP_002408762.1| DNA cytosine methylase [Escherichia coli IAI39] gi|218371119|emb|CAR18947.1| Modification methylase EcoRII (M.EcoRII) (Cytosine-specific methyltransferase EcoRII) [Escherichia coli IAI39] Length = 491 Score = 155 bits (392), Expect = 3e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 292 KHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYILTPK 350 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 351 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397 >gi|206577074|ref|YP_002237693.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342] gi|206566132|gb|ACI07908.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342] Length = 477 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F F ++P G++LE +D K ++ Sbjct: 274 RHF-LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTVDAKFILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 333 LWKYLYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 379 >gi|194430436|ref|ZP_03062919.1| DNA-cytosine methyltransferase [Escherichia coli B171] gi|194411515|gb|EDX27854.1| DNA-cytosine methyltransferase [Escherichia coli B171] Length = 472 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQCVTRTLSARYYKDGAEI 374 >gi|238895488|ref|YP_002920223.1| DNA cytosine methylase [Klebsiella pneumoniae NTUH-K2044] gi|330000908|ref|ZP_08303852.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. MS 92-3] gi|238547805|dbj|BAH64156.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] gi|328537840|gb|EGF64032.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. MS 92-3] Length = 477 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F F ++P G++LE +D K ++ Sbjct: 274 RHF-LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYPAVRPTFGELLEPTVDAKFILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 333 LWKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379 >gi|323977859|gb|EGB72945.1| DNA-cytosine methyltransferase [Escherichia coli TW10509] Length = 472 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLREISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|323968376|gb|EGB63783.1| DNA-cytosine methyltransferase [Escherichia coli M863] gi|327253092|gb|EGE64746.1| DNA-cytosine methyltransferase [Escherichia coli STEC_7v] Length = 472 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLREISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|300931174|ref|ZP_07146520.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1] gi|300461007|gb|EFK24500.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1] Length = 477 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|301018179|ref|ZP_07182696.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1] gi|300399832|gb|EFJ83370.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1] Length = 472 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|309795932|ref|ZP_07690345.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7] gi|308120382|gb|EFO57644.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7] Length = 472 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|168234623|ref|ZP_02659681.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|194736513|ref|YP_002117411.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|194712015|gb|ACF91236.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197291717|gb|EDY31067.1| modification methylase EcoRII [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] Length = 474 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 +F +PQ RER+ ++ F N F +P G +L+ +D K +S K Sbjct: 278 KNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIDKFYPEKRPTFGQLLDSVVDSKYILSPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383 >gi|161617789|ref|YP_001591754.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|161367153|gb|ABX70921.1| hypothetical protein SPAB_05653 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] Length = 474 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 +F +PQ RER+ ++ F N F +P G +L+ +D K +S K Sbjct: 278 KNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIDKFYPEKRPTFGQLLDSVVDSKYILSPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383 >gi|323960520|gb|EGB56149.1| DNA-cytosine methyltransferase [Escherichia coli H489] Length = 477 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYILTPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383 >gi|307139342|ref|ZP_07498698.1| DNA cytosine methylase [Escherichia coli H736] Length = 477 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYILTPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383 >gi|291283137|ref|YP_003499955.1| DNA-cytosine methyltransferase [Escherichia coli O55:H7 str. CB9615] gi|209766674|gb|ACI81649.1| DNA cytosine methylase [Escherichia coli] gi|290763010|gb|ADD56971.1| DNA-cytosine methyltransferase [Escherichia coli O55:H7 str. CB9615] Length = 472 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|300994233|ref|ZP_07180788.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1] gi|300304943|gb|EFJ59463.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1] Length = 477 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|74312499|ref|YP_310918.1| DNA cytosine methylase [Shigella sonnei Ss046] gi|73855976|gb|AAZ88683.1| DNA cytosine methylase [Shigella sonnei Ss046] gi|323168918|gb|EFZ54598.1| DNA-cytosine methyltransferase [Shigella sonnei 53G] Length = 472 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|260855934|ref|YP_003229825.1| DNA cytosine methylase [Escherichia coli O26:H11 str. 11368] gi|300822269|ref|ZP_07102410.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7] gi|257754583|dbj|BAI26085.1| DNA cytosine methylase [Escherichia coli O26:H11 str. 11368] gi|300525152|gb|EFK46221.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7] gi|309702249|emb|CBJ01566.1| DNA-cytosine methyltransferase [Escherichia coli ETEC H10407] gi|323937230|gb|EGB33510.1| DNA-cytosine methyltransferase [Escherichia coli E1520] Length = 472 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|24113334|ref|NP_707844.1| DNA cytosine methylase [Shigella flexneri 2a str. 301] gi|30063396|ref|NP_837567.1| DNA cytosine methylase [Shigella flexneri 2a str. 2457T] gi|110805927|ref|YP_689447.1| DNA cytosine methylase [Shigella flexneri 5 str. 8401] gi|24052347|gb|AAN43551.1| DNA cytosine methylase [Shigella flexneri 2a str. 301] gi|30041648|gb|AAP17376.1| DNA cytosine methylase [Shigella flexneri 2a str. 2457T] gi|110615475|gb|ABF04142.1| DNA cytosine methylase [Shigella flexneri 5 str. 8401] gi|281601397|gb|ADA74381.1| Cytosine-specific methyltransferase [Shigella flexneri 2002017] gi|313650184|gb|EFS14597.1| DNA-cytosine methyltransferase [Shigella flexneri 2a str. 2457T] gi|332756118|gb|EGJ86471.1| DNA-cytosine methyltransferase [Shigella flexneri 4343-70] gi|332757312|gb|EGJ87649.1| DNA-cytosine methyltransferase [Shigella flexneri 2747-71] gi|332757528|gb|EGJ87863.1| DNA-cytosine methyltransferase [Shigella flexneri K-671] gi|332766700|gb|EGJ96904.1| cytosine-specific methyltransferase [Shigella flexneri 2930-71] gi|333003060|gb|EGK22614.1| DNA-cytosine methyltransferase [Shigella flexneri VA-6] gi|333003307|gb|EGK22853.1| DNA-cytosine methyltransferase [Shigella flexneri K-218] gi|333004068|gb|EGK23602.1| DNA-cytosine methyltransferase [Shigella flexneri K-272] gi|333017687|gb|EGK36999.1| DNA-cytosine methyltransferase [Shigella flexneri K-304] gi|333017841|gb|EGK37148.1| DNA-cytosine methyltransferase [Shigella flexneri K-227] Length = 472 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|237732007|ref|ZP_04562488.1| DNA cytosine methylase [Citrobacter sp. 30_2] gi|226907546|gb|EEH93464.1| DNA cytosine methylase [Citrobacter sp. 30_2] Length = 476 Score = 154 bits (391), Expect = 3e-36, Method: Composition-based stats. Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F + L ++LE +D K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLNLKSDFTLRDIVTRYPQRRTTLAELLEPTVDAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + + T TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPGNPDSVTRTLSARYYKDGAEI 378 >gi|330911766|gb|EGH40276.1| DNA-cytosine methyltransferase [Escherichia coli AA86] Length = 472 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|320641809|gb|EFX11197.1| DNA cytosine methylase [Escherichia coli O157:H7 str. G5101] Length = 472 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|91211180|ref|YP_541166.1| DNA cytosine methylase [Escherichia coli UTI89] gi|117624099|ref|YP_853012.1| DNA cytosine methylase [Escherichia coli APEC O1] gi|218558817|ref|YP_002391730.1| DNA cytosine methylase [Escherichia coli S88] gi|91072754|gb|ABE07635.1| DNA cytosine methylase [Escherichia coli UTI89] gi|115513223|gb|ABJ01298.1| DNA cytosine methylase [Escherichia coli APEC O1] gi|218365586|emb|CAR03313.1| DNA cytosine methylase [Escherichia coli S88] gi|294492656|gb|ADE91412.1| DNA-cytosine methyltransferase [Escherichia coli IHE3034] gi|307626564|gb|ADN70868.1| DNA cytosine methylase [Escherichia coli UM146] gi|323952452|gb|EGB48325.1| DNA-cytosine methyltransferase [Escherichia coli H252] Length = 472 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|15802395|ref|NP_288421.1| DNA cytosine methylase [Escherichia coli O157:H7 EDL933] gi|15831953|ref|NP_310726.1| DNA cytosine methylase [Escherichia coli O157:H7 str. Sakai] gi|16129907|ref|NP_416470.1| DNA cytosine methyltransferase [Escherichia coli str. K-12 substr. MG1655] gi|89108792|ref|AP_002572.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. W3110] gi|168752207|ref|ZP_02777229.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4113] gi|168758275|ref|ZP_02783282.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4401] gi|168771615|ref|ZP_02796622.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4486] gi|168777717|ref|ZP_02802724.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4196] gi|168783359|ref|ZP_02808366.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4076] gi|168789321|ref|ZP_02814328.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC869] gi|168801737|ref|ZP_02826744.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC508] gi|170081604|ref|YP_001730924.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. DH10B] gi|195939267|ref|ZP_03084649.1| DNA cytosine methylase [Escherichia coli O157:H7 str. EC4024] gi|208810340|ref|ZP_03252216.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4206] gi|208816602|ref|ZP_03257722.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4045] gi|208821263|ref|ZP_03261583.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4042] gi|209400193|ref|YP_002271076.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4115] gi|209919382|ref|YP_002293466.1| DNA cytosine methylase [Escherichia coli SE11] gi|217328629|ref|ZP_03444710.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. TW14588] gi|218689956|ref|YP_002398168.1| DNA cytosine methylase [Escherichia coli ED1a] gi|238901165|ref|YP_002926961.1| DNA cytosine methylase [Escherichia coli BW2952] gi|253773091|ref|YP_003035922.1| DNA cytosine methylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254793611|ref|YP_003078448.1| DNA cytosine methylase [Escherichia coli O157:H7 str. TW14359] gi|256017846|ref|ZP_05431711.1| DNA cytosine methylase [Shigella sp. D9] gi|261227545|ref|ZP_05941826.1| DNA cytosine methylase [Escherichia coli O157:H7 str. FRIK2000] gi|261254631|ref|ZP_05947164.1| DNA cytosine methylase [Escherichia coli O157:H7 str. FRIK966] gi|293415271|ref|ZP_06657914.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli B185] gi|300818618|ref|ZP_07098826.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1] gi|300920181|ref|ZP_07136630.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1] gi|301327749|ref|ZP_07220953.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1] gi|301644580|ref|ZP_07244570.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1] gi|307312454|ref|ZP_07592088.1| DNA-cytosine methyltransferase [Escherichia coli W] gi|312973821|ref|ZP_07787993.1| DNA-cytosine methyltransferase [Escherichia coli 1827-70] gi|332278872|ref|ZP_08391285.1| DNA cytosine methylase [Shigella sp. D9] gi|83305674|sp|P0AEE0|DCM_ECO57 RecName: Full=DNA-cytosine methyltransferase gi|83305675|sp|P0AED9|DCM_ECOLI RecName: Full=DNA-cytosine methyltransferase; AltName: Full=M.EcoDcm gi|12516070|gb|AAG56975.1|AE005418_3 DNA cytosine methylase [Escherichia coli O157:H7 str. EDL933] gi|41239|emb|CAA31705.1| unnamed protein product [Escherichia coli K-12] gi|145719|gb|AAA03723.1| DNA cytosine methylase [Escherichia coli] gi|1736630|dbj|BAA15788.1| DNA cytosine methylase [Escherichia coli str. K12 substr. W3110] gi|1788271|gb|AAC75027.1| DNA cytosine methyltransferase [Escherichia coli str. K-12 substr. MG1655] gi|13362167|dbj|BAB36122.1| DNA cytosine methylase [Escherichia coli O157:H7 str. Sakai] gi|169889439|gb|ACB03146.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. DH10B] gi|187767102|gb|EDU30946.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4196] gi|188013903|gb|EDU52025.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4113] gi|188999305|gb|EDU68291.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4076] gi|189354901|gb|EDU73320.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4401] gi|189359668|gb|EDU78087.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4486] gi|189371047|gb|EDU89463.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC869] gi|189376137|gb|EDU94553.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC508] gi|208724856|gb|EDZ74563.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4206] gi|208730945|gb|EDZ79634.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4045] gi|208741386|gb|EDZ89068.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4042] gi|209161593|gb|ACI39026.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC4115] gi|209766668|gb|ACI81646.1| DNA cytosine methylase [Escherichia coli] gi|209766670|gb|ACI81647.1| DNA cytosine methylase [Escherichia coli] gi|209766672|gb|ACI81648.1| DNA cytosine methylase [Escherichia coli] gi|209766676|gb|ACI81650.1| DNA cytosine methylase [Escherichia coli] gi|209912641|dbj|BAG77715.1| DNA cytosine methylase [Escherichia coli SE11] gi|217317976|gb|EEC26403.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. TW14588] gi|218427520|emb|CAR08415.2| DNA cytosine methylase [Escherichia coli ED1a] gi|238860813|gb|ACR62811.1| DNA cytosine methylase [Escherichia coli BW2952] gi|253324135|gb|ACT28737.1| DNA-cytosine methyltransferase [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254593011|gb|ACT72372.1| DNA cytosine methylase [Escherichia coli O157:H7 str. TW14359] gi|260448927|gb|ACX39349.1| DNA-cytosine methyltransferase [Escherichia coli DH1] gi|291432919|gb|EFF05898.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli B185] gi|300412803|gb|EFJ96113.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1] gi|300528790|gb|EFK49852.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1] gi|300845711|gb|EFK73471.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1] gi|301077088|gb|EFK91894.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1] gi|306907625|gb|EFN38128.1| DNA-cytosine methyltransferase [Escherichia coli W] gi|310332416|gb|EFP99651.1| DNA-cytosine methyltransferase [Escherichia coli 1827-70] gi|315061260|gb|ADT75587.1| DNA cytosine methylase [Escherichia coli W] gi|315136597|dbj|BAJ43756.1| DNA cytosine methylase [Escherichia coli DH1] gi|320191934|gb|EFW66581.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. EC1212] gi|320198651|gb|EFW73251.1| DNA-cytosine methyltransferase [Escherichia coli EC4100B] gi|320647167|gb|EFX16000.1| DNA cytosine methylase [Escherichia coli O157:H- str. 493-89] gi|320652452|gb|EFX20750.1| DNA cytosine methylase [Escherichia coli O157:H- str. H 2687] gi|320658054|gb|EFX25816.1| DNA cytosine methylase [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320658625|gb|EFX26319.1| DNA cytosine methylase [Escherichia coli O55:H7 str. USDA 5905] gi|320668523|gb|EFX35350.1| DNA cytosine methylase [Escherichia coli O157:H7 str. LSU-61] gi|323174657|gb|EFZ60277.1| DNA-cytosine methyltransferase [Escherichia coli LT-68] gi|323183944|gb|EFZ69331.1| DNA-cytosine methyltransferase [Escherichia coli 1357] gi|323378163|gb|ADX50431.1| DNA-cytosine methyltransferase [Escherichia coli KO11] gi|323948336|gb|EGB44323.1| DNA-cytosine methyltransferase [Escherichia coli H120] gi|326342371|gb|EGD66152.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. 1044] gi|326344875|gb|EGD68622.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. 1125] gi|332101224|gb|EGJ04570.1| DNA cytosine methylase [Shigella sp. D9] Length = 472 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|110642066|ref|YP_669796.1| DNA cytosine methylase [Escherichia coli 536] gi|191173268|ref|ZP_03034798.1| DNA-cytosine methyltransferase [Escherichia coli F11] gi|110343658|gb|ABG69895.1| DNA-cytosine methyltransferase [Escherichia coli 536] gi|190906385|gb|EDV65994.1| DNA-cytosine methyltransferase [Escherichia coli F11] gi|222033699|emb|CAP76440.1| DNA-cytosine methyltransferase [Escherichia coli LF82] gi|312946553|gb|ADR27380.1| DNA cytosine methylase [Escherichia coli O83:H1 str. NRG 857C] gi|324013473|gb|EGB82692.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 60-1] Length = 472 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|325499566|gb|EGC97425.1| DNA cytosine methylase [Escherichia fergusonii ECD227] Length = 473 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G +LE +D K +S K Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQRPLFGQLLESSVDSKYILSPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 LW+ + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 337 LWQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 383 >gi|324112381|gb|EGC06359.1| DNA-cytosine methyltransferase [Escherichia fergusonii B253] Length = 473 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G +LE +D K +S K Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQRPLFGQLLESSVDSKYILSPK 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 LW+ + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 337 LWQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 383 >gi|315296465|gb|EFU55762.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 16-3] Length = 476 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 273 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 331 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 332 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378 >gi|315286667|gb|EFU46100.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 110-3] Length = 475 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 272 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 330 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 331 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 377 >gi|170681403|ref|YP_001743285.1| DNA cytosine methylase [Escherichia coli SMS-3-5] gi|170519121|gb|ACB17299.1| DNA-cytosine methyltransferase [Escherichia coli SMS-3-5] gi|324119009|gb|EGC12898.1| DNA-cytosine methyltransferase [Escherichia coli E1167] Length = 472 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|191169235|ref|ZP_03030988.1| DNA-cytosine methyltransferase [Escherichia coli B7A] gi|190900713|gb|EDV60509.1| DNA-cytosine methyltransferase [Escherichia coli B7A] Length = 472 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|331668651|ref|ZP_08369499.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271] gi|331063845|gb|EGI35756.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271] Length = 458 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 255 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 313 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 314 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 360 >gi|300975476|ref|ZP_07173024.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1] gi|300410366|gb|EFJ93904.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1] Length = 472 Score = 154 bits (391), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|315290247|gb|EFU49625.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 153-1] Length = 478 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 275 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 333 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 334 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 380 >gi|300940416|ref|ZP_07155001.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1] gi|300454810|gb|EFK18303.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1] Length = 476 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 273 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 331 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 332 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378 >gi|300923873|ref|ZP_07139889.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1] gi|300419870|gb|EFK03181.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1] Length = 477 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|26248232|ref|NP_754272.1| DNA cytosine methylase [Escherichia coli CFT073] gi|227885611|ref|ZP_04003416.1| DNA cytosine methylase [Escherichia coli 83972] gi|237705920|ref|ZP_04536401.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA] gi|331647554|ref|ZP_08348646.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605] gi|26108636|gb|AAN80839.1|AE016762_92 DNA-cytosine methyltransferase [Escherichia coli CFT073] gi|226900677|gb|EEH86936.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA] gi|227837184|gb|EEJ47650.1| DNA cytosine methylase [Escherichia coli 83972] gi|281179022|dbj|BAI55352.1| DNA cytosine methylase [Escherichia coli SE15] gi|307553973|gb|ADN46748.1| DNA cytosine methylase [Escherichia coli ABU 83972] gi|320194327|gb|EFW68958.1| DNA-cytosine methyltransferase [Escherichia coli WV_060327] gi|323956356|gb|EGB52099.1| DNA-cytosine methyltransferase [Escherichia coli H263] gi|324005878|gb|EGB75097.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 57-2] gi|331043278|gb|EGI15416.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|323962004|gb|EGB57603.1| DNA-cytosine methyltransferase [Escherichia coli H489] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|284921868|emb|CBG34943.1| DNA-cytosine methyltransferase [Escherichia coli 042] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|323191533|gb|EFZ76794.1| modification methylase EcoRII [Escherichia coli RN587/1] Length = 474 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F +P G++L+ ++DDK ++ + Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHNVDDKYILTPR 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383 >gi|331663456|ref|ZP_08364366.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143] gi|331059255|gb|EGI31232.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|293410317|ref|ZP_06653893.1| conserved hypothetical protein [Escherichia coli B354] gi|291470785|gb|EFF13269.1| conserved hypothetical protein [Escherichia coli B354] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|218699478|ref|YP_002407107.1| DNA cytosine methylase [Escherichia coli IAI39] gi|218369464|emb|CAR17229.1| DNA cytosine methylase [Escherichia coli IAI39] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|218551294|ref|YP_002385086.1| DNA cytosine methylase [Escherichia fergusonii ATCC 35469] gi|218358836|emb|CAQ91493.1| DNA modification methylase [Escherichia fergusonii ATCC 35469] Length = 485 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G +LE +D K +S K Sbjct: 290 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQRPLFGQLLESSVDSKYILSPK 348 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 LW+ + + G GFG+GL N ++ TLSARY+KDGSEI Sbjct: 349 LWQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 395 >gi|170019707|ref|YP_001724661.1| DNA cytosine methylase [Escherichia coli ATCC 8739] gi|169754635|gb|ACA77334.1| DNA-cytosine methyltransferase [Escherichia coli ATCC 8739] gi|323940380|gb|EGB36571.1| DNA-cytosine methyltransferase [Escherichia coli E482] gi|332093084|gb|EGI98148.1| DNA-cytosine methyltransferase [Shigella boydii 5216-82] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|331653374|ref|ZP_08354379.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718] gi|331049472|gb|EGI21544.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|301050676|ref|ZP_07197538.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1] gi|300297633|gb|EFJ54018.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1] Length = 477 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|82543581|ref|YP_407528.1| DNA cytosine methylase [Shigella boydii Sb227] gi|81244992|gb|ABB65700.1| DNA cytosine methylase [Shigella boydii Sb227] gi|332096894|gb|EGJ01883.1| DNA-cytosine methyltransferase [Shigella boydii 3594-74] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|187732725|ref|YP_001879611.1| DNA cytosine methylase [Shigella boydii CDC 3083-94] gi|293446340|ref|ZP_06662762.1| DNA-cytosine methyltransferase [Escherichia coli B088] gi|187429717|gb|ACD08991.1| DNA-cytosine methyltransferase [Shigella boydii CDC 3083-94] gi|291323170|gb|EFE62598.1| DNA-cytosine methyltransferase [Escherichia coli B088] gi|320175451|gb|EFW50550.1| DNA-cytosine methyltransferase [Shigella dysenteriae CDC 74-1112] gi|320184499|gb|EFW59303.1| DNA-cytosine methyltransferase [Shigella flexneri CDC 796-83] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|331671799|ref|ZP_08372595.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli TA280] gi|331070788|gb|EGI42147.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli TA280] Length = 474 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F +P G++L+ +DDK ++ + Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHDVDDKYILTPR 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383 >gi|324018843|gb|EGB88062.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 117-3] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|307138628|ref|ZP_07497984.1| DNA cytosine methylase [Escherichia coli H736] gi|331642581|ref|ZP_08343716.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736] gi|331039379|gb|EGI11599.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|300956520|ref|ZP_07168803.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1] gi|300316661|gb|EFJ66445.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1] Length = 477 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379 >gi|218554541|ref|YP_002387454.1| DNA cytosine methylase [Escherichia coli IAI1] gi|260868553|ref|YP_003234955.1| DNA cytosine methylase [Escherichia coli O111:H- str. 11128] gi|218361309|emb|CAQ98893.1| DNA cytosine methylase [Escherichia coli IAI1] gi|257764909|dbj|BAI36404.1| DNA cytosine methylase [Escherichia coli O111:H- str. 11128] gi|323180787|gb|EFZ66327.1| DNA-cytosine methyltransferase [Escherichia coli 1180] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|193066646|ref|ZP_03047681.1| DNA-cytosine methyltransferase [Escherichia coli E22] gi|260844359|ref|YP_003222137.1| DNA cytosine methylase [Escherichia coli O103:H2 str. 12009] gi|192925721|gb|EDV80380.1| DNA-cytosine methyltransferase [Escherichia coli E22] gi|257759506|dbj|BAI31003.1| DNA cytosine methylase [Escherichia coli O103:H2 str. 12009] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|320182772|gb|EFW57655.1| DNA-cytosine methyltransferase [Shigella boydii ATCC 9905] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|218705454|ref|YP_002412973.1| DNA cytosine methylase [Escherichia coli UMN026] gi|293405443|ref|ZP_06649435.1| DNA cytosine methylase [Escherichia coli FVEC1412] gi|298381087|ref|ZP_06990686.1| DNA cytosine methylase [Escherichia coli FVEC1302] gi|218432551|emb|CAR13444.1| DNA cytosine methylase [Escherichia coli UMN026] gi|291427651|gb|EFF00678.1| DNA cytosine methylase [Escherichia coli FVEC1412] gi|298278529|gb|EFI20043.1| DNA cytosine methylase [Escherichia coli FVEC1302] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|323158561|gb|EFZ44575.1| DNA-cytosine methyltransferase [Escherichia coli E128010] Length = 472 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F P L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVMLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQCVTRTLSARYYKDGAEI 374 >gi|331645413|ref|ZP_08346517.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli M605] gi|331045575|gb|EGI17701.1| modification methylase EcoRII (Cytosine-specificmethyltransferase EcoRII) (M.EcoRII) [Escherichia coli M605] Length = 474 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F +P G++L+ ++DDK ++ + Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHNVDDKYILTPR 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383 >gi|300951590|ref|ZP_07165422.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1] gi|300449174|gb|EFK12794.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1] Length = 478 Score = 154 bits (390), Expect = 4e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 275 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 333 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 334 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 380 >gi|194433657|ref|ZP_03065933.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1012] gi|194418086|gb|EDX34179.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1012] gi|332095525|gb|EGJ00541.1| DNA-cytosine methyltransferase [Shigella dysenteriae 155-74] Length = 472 Score = 154 bits (390), Expect = 5e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDFNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|146312197|ref|YP_001177271.1| DNA cytosine methylase [Enterobacter sp. 638] gi|145319073|gb|ABP61220.1| DNA-cytosine methyltransferase [Enterobacter sp. 638] Length = 471 Score = 154 bits (390), Expect = 5e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + +P + ++LE D K ++ Sbjct: 268 KHF-LPQHRERIVLVGFRRDLNLKGDFTLRDIPSLYPAHRPSVAELLEPAFDAKFILTPV 326 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFG+G+ + T TLSARYYKDG+EI Sbjct: 327 LWKYLYRYAKKHQAKGNGFGFGMVDPRNPHSVTRTLSARYYKDGAEI 373 >gi|157158517|ref|YP_001463262.1| DNA cytosine methylase [Escherichia coli E24377A] gi|157080547|gb|ABV20255.1| DNA-cytosine methyltransferase [Escherichia coli E24377A] Length = 472 Score = 153 bits (389), Expect = 5e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDSMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|213581465|ref|ZP_03363291.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] Length = 295 Score = 153 bits (389), Expect = 5e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 108 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 167 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 168 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 210 >gi|327254549|gb|EGE66165.1| modification methylase EcoRII [Escherichia coli STEC_7v] Length = 474 Score = 153 bits (389), Expect = 5e-36, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F +P G++L+ +DDK ++ + Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHDVDDKYILTPR 336 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + TLSARY+KDGSEI Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383 >gi|48093754|gb|AAT40239.1| Eco128I DNA methylase [Escherichia coli] Length = 332 Score = 153 bits (388), Expect = 6e-36, Method: Composition-based stats. Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++LE +D K ++ K Sbjct: 197 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 255 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 256 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 302 >gi|291085206|ref|ZP_06352388.2| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC 29220] gi|291072321|gb|EFE10430.1| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC 29220] Length = 476 Score = 153 bits (388), Expect = 7e-36, Method: Composition-based stats. Identities = 35/103 (33%), Positives = 53/103 (51%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFLNP---SVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F +F PR L D+LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGFRRDLQLKSDFTLRNIATCYPRRRTTLADLLEPTVEAKYVLTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + T TLSARYYKDG+EI Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPGNPDCVTRTLSARYYKDGAEI 378 >gi|94501925|ref|ZP_01308434.1| DNA-cytosine methyltransferase [Oceanobacter sp. RED65] gi|94425919|gb|EAT10918.1| DNA-cytosine methyltransferase [Oceanobacter sp. RED65] Length = 287 Score = 153 bits (388), Expect = 7e-36, Method: Composition-based stats. Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 10/106 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKF---PTPLGIKPRLGDILEEHIDDKSTISNKL 57 +F +PQ RER+ ++ F N + F P P + P L +LE+ +D+K ++ +L Sbjct: 91 ANF-LPQHRERIVLVGFRKDLNLTNRFTLTNLPKPREV-PSLSSLLEKSVDEKYVLTPRL 148 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 WE + + ++ G GFGYGL SA TLSARY+KDGSEI Sbjct: 149 WEYLYEYAKKHQAKGNGFGYGLVDPKNSSAVCRTLSARYHKDGSEI 194 >gi|331673470|ref|ZP_08374238.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280] gi|331069668|gb|EGI41055.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280] Length = 472 Score = 153 bits (388), Expect = 7e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLG----IKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFSAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|306814216|ref|ZP_07448382.1| DNA cytosine methylase [Escherichia coli NC101] gi|305852375|gb|EFM52826.1| DNA cytosine methylase [Escherichia coli NC101] Length = 472 Score = 153 bits (388), Expect = 7e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISACFPAQRVTLAQLLDPIVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|238919389|ref|YP_002932904.1| DNA cytosine methylase [Edwardsiella ictaluri 93-146] gi|238868958|gb|ACR68669.1| modification methylase [Edwardsiella ictaluri 93-146] Length = 471 Score = 153 bits (388), Expect = 7e-36, Method: Composition-based stats. Identities = 39/107 (36%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F KP G++LE +D K +S K Sbjct: 276 KHF-LPQHRERIVLVGFRRDLNIHHDFTLQKIQQFYPEKKPTFGELLEPAVDSKYILSPK 334 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101 LWE + + G GFG+GL + + TLSARY+KDGSEI Sbjct: 335 LWEYLYNYAKKHAEKGNGFGFGLVDPKNKESIARTLSARYHKDGSEI 381 >gi|213622824|ref|ZP_03375607.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] Length = 324 Score = 153 bits (388), Expect = 8e-36, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 124 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 183 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 184 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 226 >gi|331658007|ref|ZP_08358969.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206] gi|331056255|gb|EGI28264.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206] Length = 472 Score = 153 bits (388), Expect = 8e-36, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPIVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|296282358|ref|ZP_06860356.1| DNA-cytosine methyltransferase [Citromicrobium bathyomarinum JL354] Length = 439 Score = 153 bits (387), Expect = 9e-36, Method: Composition-based stats. Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 8/100 (8%) Query: 8 VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLWEGH 61 VPQ+RER++I+ F S + P + P+LG ILE H +D K T++ +LWE Sbjct: 250 VPQKRERIFIVGFREKSAFNLAGLEIPA-VADGPKLGSILEPHDQVDPKYTLTPRLWEYL 308 Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q+ ++ ++ G GFGY LF TLSARY+KDGSEI Sbjct: 309 QEYRKKHEAKGNGFGYSLFGPGD-VARTLSARYHKDGSEI 347 >gi|163732386|ref|ZP_02139832.1| hypothetical protein RLO149_03007 [Roseobacter litoralis Och 149] gi|161394684|gb|EDQ19007.1| hypothetical protein RLO149_03007 [Roseobacter litoralis Och 149] Length = 410 Score = 153 bits (387), Expect = 9e-36, Method: Composition-based stats. Identities = 46/121 (38%), Positives = 58/121 (47%), Gaps = 23/121 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEH----------- 46 + A F VPQ RER+ I+ F V F F P + R+ DIL Sbjct: 216 IDAAHF-VPQHRERIVIVGFR-EDVPFSFDDVILPPHRERRMRDILHPENGNENPESHFT 273 Query: 47 ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 + K T+S+KLW+ Q +K G GFG+GL +S TLSARYYKDGSE Sbjct: 274 LGNDAAVSGKYTLSDKLWKYLQDYAAKHKAKGNGFGFGLVDGDS-IARTLSARYYKDGSE 332 Query: 101 I 101 I Sbjct: 333 I 333 >gi|213650730|ref|ZP_03380783.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. J185] Length = 405 Score = 153 bits (387), Expect = 1e-35, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 205 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 264 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 265 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 307 >gi|260598469|ref|YP_003211040.1| DNA cytosine methylase [Cronobacter turicensis z3032] gi|260217646|emb|CBA31957.1| DNA-cytosine methyltransferase [Cronobacter turicensis z3032] Length = 450 Score = 152 bits (386), Expect = 1e-35, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F + +P G++L+ +D + ++ Sbjct: 249 KHF-LPQHRERIVLVGFRRDLNLHDGFTLRALPELYPARRPAFGELLDPTVDARYVLTPT 307 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 308 LWKYLYRYAQKHQAKGNGFGYGLVDPQNPASVARTLSARYYKDGAEI 354 >gi|156933419|ref|YP_001437335.1| DNA cytosine methylase [Cronobacter sakazakii ATCC BAA-894] gi|156531673|gb|ABU76499.1| hypothetical protein ESA_01237 [Cronobacter sakazakii ATCC BAA-894] Length = 481 Score = 152 bits (386), Expect = 1e-35, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 53/107 (49%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLG----IKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F +P G++L+ +D + ++ Sbjct: 280 KHF-LPQHRERIVLVGFRRSLNLHDGFTLRALPEFYPARRPAFGELLDPTVDARYVLTPT 338 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 339 LWKYLYRYAQKHQAKGNGFGYGLVDPQNPASVARTLSARYYKDGAEI 385 >gi|300904853|ref|ZP_07122678.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1] gi|301304244|ref|ZP_07210359.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1] gi|300403236|gb|EFJ86774.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1] gi|300840501|gb|EFK68261.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1] gi|315257206|gb|EFU37174.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 85-1] Length = 472 Score = 152 bits (386), Expect = 1e-35, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + +++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQVRGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|262043463|ref|ZP_06016586.1| DNA (cytosine-5-)-methyltransferase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|259039205|gb|EEW40353.1| DNA (cytosine-5-)-methyltransferase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 477 Score = 152 bits (386), Expect = 1e-35, Method: Composition-based stats. Identities = 35/107 (32%), Positives = 51/107 (47%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F F + P G++LE +D K ++ Sbjct: 274 RHF-LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYPAVWPTFGELLEPTVDAKFILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 333 LWKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379 >gi|157161430|ref|YP_001458748.1| DNA cytosine methylase [Escherichia coli HS] gi|157067110|gb|ABV06365.1| DNA-cytosine methyltransferase [Escherichia coli HS] Length = 472 Score = 152 bits (385), Expect = 1e-35, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQTRGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|157368818|ref|YP_001476807.1| DNA cytosine methylase [Serratia proteamaculans 568] gi|157320582|gb|ABV39679.1| DNA-cytosine methyltransferase [Serratia proteamaculans 568] Length = 491 Score = 152 bits (385), Expect = 2e-35, Method: Composition-based stats. Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPT----PLGIKPRLGDILEEHIDDKSTISNK 56 +F +PQ RER+ ++ F N +F +P G++L E + K ++ Sbjct: 294 KNF-LPQHRERIVLVGFRRDLNIHGDFSLKNLSQFFPKKRPSFGELLLEDVAPKYILTEH 352 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 LW+ + ++ G GFG+GL S+ TLSARY+KDGSEI Sbjct: 353 LWKYLYNYAKKHQAKGNGFGFGLVNPKNESSVARTLSARYHKDGSEI 399 >gi|170769440|ref|ZP_02903893.1| DNA-cytosine methyltransferase [Escherichia albertii TW07627] gi|170121764|gb|EDS90695.1| DNA-cytosine methyltransferase [Escherichia albertii TW07627] Length = 472 Score = 151 bits (384), Expect = 2e-35, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKASFTLRDINQCFPTQRVTLAQLLDPVVEAKYILTPV 327 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374 >gi|300724477|ref|YP_003713798.1| DNA cytosine methylase [Xenorhabdus nematophila ATCC 19061] gi|297631015|emb|CBJ91699.1| DNA cytosine methylase [Xenorhabdus nematophila ATCC 19061] Length = 476 Score = 151 bits (384), Expect = 2e-35, Method: Composition-based stats. Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPT----PLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N F +P L ++L+ ++D K ++ LW+ Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRNMNQLFPAQRPTLKELLDSNVDKKYILTPALWKY 340 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + ++ G GFG+GL F ++ TLSARY+KDGSEI Sbjct: 341 LYNYAKKHQAKGNGFGFGLVFPDNPNSVARTLSARYHKDGSEI 383 >gi|290508755|ref|ZP_06548126.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. 1_1_55] gi|289778149|gb|EFD86146.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. 1_1_55] Length = 477 Score = 151 bits (383), Expect = 3e-35, Method: Composition-based stats. Identities = 35/107 (32%), Positives = 51/107 (47%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F F ++P G++LE D K ++ Sbjct: 274 RHF-LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTADAKFILTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + ++ G GFGYGL + TLSARYYKDG+EI Sbjct: 333 LWKYLYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 379 >gi|323222338|gb|EGA06720.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] Length = 259 Score = 151 bits (383), Expect = 3e-35, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 59 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 118 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 119 LYRYAKKHQARGNGFGYGMVYPDNPGSVARTLSARYYKDGAEI 161 >gi|331677842|ref|ZP_08378517.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591] gi|331074302|gb|EGI45622.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591] Length = 320 Score = 151 bits (382), Expect = 4e-35, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 117 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 175 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + N+ T TLSARYYKDG+EI Sbjct: 176 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 222 >gi|317048624|ref|YP_004116272.1| DNA-cytosine methyltransferase [Pantoea sp. At-9b] gi|316950241|gb|ADU69716.1| DNA-cytosine methyltransferase [Pantoea sp. At-9b] Length = 467 Score = 151 bits (382), Expect = 4e-35, Method: Composition-based stats. Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 10/110 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPR----LGDILEEHIDDKSTI 53 + A F +PQ RER+ ++ + F + P+ L +LE D K T+ Sbjct: 271 IDARHF-LPQHRERIVLVGIRRDTRLSEGFTLRALAQLYPKKVPTLKSLLEPQPDAKYTL 329 Query: 54 SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 S LW + + +K G GFG+GL + TLSARYYKDGSEI Sbjct: 330 SPVLWNYLYQYAKKHKAKGNGFGFGLNDPRNPSVCVRTLSARYYKDGSEI 379 >gi|56751653|ref|YP_172354.1| hypothetical protein syc1644_d [Synechococcus elongatus PCC 6301] gi|81301269|ref|YP_401477.1| DNA-cytosine methyltransferase [Synechococcus elongatus PCC 7942] gi|56686612|dbj|BAD79834.1| hypothetical protein [Synechococcus elongatus PCC 6301] gi|81170150|gb|ABB58490.1| DNA-cytosine methyltransferase [Synechococcus elongatus PCC 7942] Length = 424 Score = 151 bits (382), Expect = 4e-35, Method: Composition-based stats. Identities = 48/121 (39%), Positives = 61/121 (50%), Gaps = 23/121 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF---KFPTPLGIKPRLGDIL-------------- 43 + A F VPQ RER+YI+ F V F F P + DIL Sbjct: 228 IDAKGF-VPQHRERIYIVGFREE-VGFNWDSFSQPPTDTKCMADILHPNDGSEEVEEPYT 285 Query: 44 ---EEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 E ++DK T+S+KLW Q ++ AG GFG+GL ++S TLSARYYKDGSE Sbjct: 286 VGIEAKVNDKYTLSDKLWNYLQNYANKHRAAGNGFGFGLVNKDS-IARTLSARYYKDGSE 344 Query: 101 I 101 I Sbjct: 345 I 345 >gi|294979850|pdb|3ME5|A Chain A, Crystal Structure Of Putative Dna Cytosine Methylase From Shigella Flexneri 2a Str. 301 Length = 482 Score = 151 bits (382), Expect = 4e-35, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 271 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPXVEAKYILTPV 329 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG + N+ T TLSARYYKDG+EI Sbjct: 330 LWKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 376 >gi|213853126|ref|ZP_03382658.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. M223] Length = 219 Score = 150 bits (381), Expect = 4e-35, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ F N +F +P L ++LE ++ K ++ LW+ Sbjct: 19 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 78 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 79 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 121 >gi|210631776|ref|ZP_03297018.1| hypothetical protein COLSTE_00903 [Collinsella stercoris DSM 13279] gi|210159896|gb|EEA90867.1| hypothetical protein COLSTE_00903 [Collinsella stercoris DSM 13279] Length = 390 Score = 150 bits (381), Expect = 5e-35, Method: Composition-based stats. Identities = 42/94 (44%), Positives = 57/94 (60%), Gaps = 4/94 (4%) Query: 10 QRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67 Q RER+YI+ F + V+F + + +ILE +DD+ +S+KLW + K Sbjct: 231 QHRERIYIVGFRDD-VDFSWDDLDCPQNGQKAAEILETDVDDRYVLSDKLWSYLKAYKAK 289 Query: 68 NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 ++ AG GFGYGL S TT TLSARY+KDGSEI Sbjct: 290 HEAAGNGFGYGLITP-SDTTRTLSARYHKDGSEI 322 >gi|255262721|ref|ZP_05342063.1| cytosine-specific methyltransferase NlaX [Thalassiobium sp. R2A62] gi|255105056|gb|EET47730.1| cytosine-specific methyltransferase NlaX [Thalassiobium sp. R2A62] Length = 421 Score = 150 bits (380), Expect = 7e-35, Method: Composition-based stats. Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 13/114 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFP-------TPLGIKPRLGDILEEH--I 47 + A +FGVPQ RER+YI+ F V P + RLGD+LE + + Sbjct: 243 LAAKNFGVPQNRERVYIVGFDRDQVSEAEARDLPREILDGLKERKSETRLGDVLETNASV 302 Query: 48 DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 D K TIS++L GH++R ++ G GFG+ LF S NT+SARYYKDGSE+ Sbjct: 303 DPKFTISDRLLAGHERRLRAHRAKGNGFGFSLFNAESPYCNTISARYYKDGSEV 356 >gi|157145245|ref|YP_001452564.1| DNA cytosine methylase [Citrobacter koseri ATCC BAA-895] gi|157082450|gb|ABV12128.1| hypothetical protein CKO_00981 [Citrobacter koseri ATCC BAA-895] Length = 477 Score = 150 bits (380), Expect = 7e-35, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F P L ++LE ++ + ++ Sbjct: 274 RHF-LPQHRERIVLVGFRRDLNLKTDFTLRDIATRYPQQRITLAELLEPAVEARYVLTPV 332 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG+ + + T TLSARYYKDG+EI Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPANPGSVTRTLSARYYKDGAEI 379 >gi|161502886|ref|YP_001569998.1| DNA cytosine methylase [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|160864233|gb|ABX20856.1| hypothetical protein SARI_00944 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] Length = 476 Score = 149 bits (378), Expect = 1e-34, Method: Composition-based stats. Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 9/103 (8%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60 +PQ RER+ ++ N +F +P L ++LE ++ K ++ LW+ Sbjct: 276 LPQHRERIVLVGVRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335 Query: 61 HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 + ++ G GFGYG+ + ++ TLSARYYKDG+EI Sbjct: 336 LYCYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378 >gi|291463698|pdb|3LX6|A Chain A, Structure Of Probable Cytosine-Specific Methyltransferase From Shigella Flexneri gi|291463699|pdb|3LX6|B Chain B, Structure Of Probable Cytosine-Specific Methyltransferase From Shigella Flexneri Length = 410 Score = 149 bits (378), Expect = 1e-34, Method: Composition-based stats. Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 10/107 (9%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 209 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPXVEAKYILTPV 267 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW+ + + ++ G GFGYG + N+ T TLSARYYKDG+EI Sbjct: 268 LWKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 314 >gi|86136173|ref|ZP_01054752.1| hypothetical protein MED193_18659 [Roseobacter sp. MED193] gi|85827047|gb|EAQ47243.1| hypothetical protein MED193_18659 [Roseobacter sp. MED193] Length = 399 Score = 149 bits (377), Expect = 1e-34, Method: Composition-based stats. Identities = 48/115 (41%), Positives = 54/115 (46%), Gaps = 22/115 (19%) Query: 8 VPQRRERLYIIDFLNP-SVEFKFPT---PLGIKPRLGDILEEH----------------- 46 VPQ RER++I F F P G PRL DIL Sbjct: 207 VPQHRERIFISGFRRDVPTRFCLDDVVIPPGPNPRLSDILHPENGSEIAEPPYTEGHLAR 266 Query: 47 IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 I DK T+S+KLW Q +K AG GFG+GL S TLSARYYKDGSEI Sbjct: 267 IADKYTLSDKLWAYLQNYAAKHKAAGNGFGFGLCTPES-VARTLSARYYKDGSEI 320 >gi|10957343|ref|NP_058367.1| DNA cytosine methylase [Salmonella typhi] gi|7800396|gb|AAF69992.1|AF250878_153 EcoRII cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi] gi|145849042|emb|CAM91602.1| ecoRII cytosine methylase [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] Length = 475 Score = 149 bits (377), Expect = 1e-34, Method: Composition-based stats. Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 9/102 (8%) Query: 9 PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61 PQ RER+ ++ F F +P LG++L+ +D + +S KLWE Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSRRPTLGELLDAEVDSRYILSPKLWEYL 337 Query: 62 QKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 + ++ G GFG+GL S TLSARYY+DGSEI Sbjct: 338 YNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379 >gi|260752101|ref|YP_003237616.1| putative DNA modification methylase [Escherichia coli O111:H- str. 11128] gi|257767571|dbj|BAI39065.1| putative DNA modification methylase [Escherichia coli O111:H- str. 11128] Length = 475 Score = 148 bits (376), Expect = 2e-34, Method: Composition-based stats. Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 9/102 (8%) Query: 9 PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61 PQ RER+ ++ F F +P LG++L+ +D + +S KLWE Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSRRPTLGELLDAEVDSRYILSPKLWEYL 337 Query: 62 QKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 + ++ G GFG+GL S TLSARYY+DGSEI Sbjct: 338 YNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379 >gi|296114735|ref|ZP_06833385.1| DNA-cytosine methyltransferase [Gluconacetobacter hansenii ATCC 23769] gi|295978659|gb|EFG85387.1| DNA-cytosine methyltransferase [Gluconacetobacter hansenii ATCC 23769] Length = 419 Score = 148 bits (376), Expect = 2e-34, Method: Composition-based stats. Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 8/100 (8%) Query: 8 VPQRRERLYIIDFLNPSVEFKF----PTPLGIKPRLGDIL--EEHIDDKSTISNKLWEGH 61 VPQ+RER++I+ F +F P+ PRLG IL ++ K T++ LW Sbjct: 230 VPQKRERIFIVGFR-EKTDFDLKSLVVPPIEKGPRLGSILLPHAEVEPKYTLTEHLWNYL 288 Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q K + AG GFG+GL + TLSARY+KDGSEI Sbjct: 289 QNYKAKHAAAGNGFGFGLCGPDD-VARTLSARYFKDGSEI 327 >gi|18466581|ref|NP_569389.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|160431784|ref|YP_001551898.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Choleraesuis] gi|16505897|emb|CAD09776.1| putative DNA modification methylase [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|159885325|dbj|BAF92929.1| putative DNA modification methylase [Salmonella enterica subsp. enterica serovar Choleraesuis] Length = 475 Score = 148 bits (376), Expect = 2e-34, Method: Composition-based stats. Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 9/102 (8%) Query: 9 PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61 PQ RER+ ++ F F +P LG++L+ +D + +S KLWE Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSRRPTLGELLDAEVDSRYILSPKLWEYL 337 Query: 62 QKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 + ++ G GFG+GL S TLSARYY+DGSEI Sbjct: 338 YNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379 >gi|313651376|gb|EFS15772.1| modification methylase EcoRII [Shigella flexneri 2a str. 2457T] Length = 463 Score = 148 bits (376), Expect = 2e-34, Method: Composition-based stats. Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 9/102 (8%) Query: 9 PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61 PQ RER+ ++ F F +P LG++L+ +D + +S KLWE Sbjct: 266 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSRRPTLGELLDAEVDSRYILSPKLWEYL 325 Query: 62 QKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 + ++ G GFG+GL S TLSARYY+DGSEI Sbjct: 326 YNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 367 >gi|304398880|ref|ZP_07380750.1| DNA-cytosine methyltransferase [Pantoea sp. aB] gi|304353584|gb|EFM17961.1| DNA-cytosine methyltransferase [Pantoea sp. aB] Length = 458 Score = 148 bits (375), Expect = 2e-34, Method: Composition-based stats. Identities = 38/109 (34%), Positives = 52/109 (47%), Gaps = 9/109 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP----LGIKPRLGDILEEHIDDKSTIS 54 + A F +PQ RER+ ++ +F P L +LE DDK +S Sbjct: 266 IDARHF-LPQHRERIVLVGIRRDLKKQDFTLRDIRRFYPAQVPSLQSLLERAPDDKYILS 324 Query: 55 NKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW + + +K G GFG+GL ++ TLSARYYKDGSEI Sbjct: 325 PVLWRYLYQYAKKHKAKGNGFGFGLNDPHNPDCCVRTLSARYYKDGSEI 373 >gi|308187315|ref|YP_003931446.1| DNA cytosine methylase [Pantoea vagans C9-1] gi|308057825|gb|ADO09997.1| DNA cytosine methylase [Pantoea vagans C9-1] Length = 458 Score = 148 bits (375), Expect = 2e-34, Method: Composition-based stats. Identities = 38/109 (34%), Positives = 52/109 (47%), Gaps = 9/109 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP----LGIKPRLGDILEEHIDDKSTIS 54 + A F +PQ RER+ ++ +F P L +LE+ DDK +S Sbjct: 266 IDARHF-LPQHRERIVLVGIRRDLKKQDFTLRDIRRFYPAQVPSLQSLLEKAPDDKYILS 324 Query: 55 NKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW + + +K G GFG+GL + TLSARYYKDGSEI Sbjct: 325 PVLWRYLYQYAKKHKAKGNGFGFGLNDPRNPDCCVRTLSARYYKDGSEI 373 >gi|315498495|ref|YP_004087299.1| transcriptional regulator, xre family [Asticcacaulis excentricus CB 48] gi|315416507|gb|ADU13148.1| transcriptional regulator, XRE family [Asticcacaulis excentricus CB 48] Length = 410 Score = 148 bits (375), Expect = 2e-34, Method: Composition-based stats. Identities = 43/121 (35%), Positives = 56/121 (46%), Gaps = 23/121 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEH----------- 46 + A F VPQ RER+ I+ F V F + P +L IL Sbjct: 218 IDAQHF-VPQHRERIVIVGFR-EDVPFSWDDLNLPPKGSVKLSSILHPENAIEEAEPPYT 275 Query: 47 ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 + K T+++KLW Q + +K AG GFG+GL + TLSARYYKDGSE Sbjct: 276 TGIRAEVASKYTLTDKLWAYLQNYADKHKAAGNGFGFGLVGPGD-VSRTLSARYYKDGSE 334 Query: 101 I 101 I Sbjct: 335 I 335 >gi|212716092|ref|ZP_03324220.1| hypothetical protein BIFCAT_01005 [Bifidobacterium catenulatum DSM 16992] gi|212661459|gb|EEB22034.1| hypothetical protein BIFCAT_01005 [Bifidobacterium catenulatum DSM 16992] Length = 453 Score = 148 bits (374), Expect = 3e-34, Method: Composition-based stats. Identities = 42/117 (35%), Positives = 58/117 (49%), Gaps = 25/117 (21%) Query: 8 VPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEH------------------- 46 VPQ RER+YI+ F + +F + KP L DIL ++ Sbjct: 242 VPQHRERIYIVGFRS-HTDFTWDDLKLPEHKPVLADILHKNDGTEPYLPWDGDRYFDYEH 300 Query: 47 --IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + DK T++ +LW+ Q K ++ G GFGYGL + TLSARY+KDGSEI Sbjct: 301 NKVQDKYTLTPRLWQYLQDYKAKHEAMGHGFGYGLVTP-DMVSRTLSARYHKDGSEI 356 >gi|327394286|dbj|BAK11708.1| modification methylase EcoRII [Pantoea ananatis AJ13355] Length = 459 Score = 148 bits (374), Expect = 3e-34, Method: Composition-based stats. Identities = 38/105 (36%), Positives = 51/105 (48%), Gaps = 9/105 (8%) Query: 6 FGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58 F +PQ RER+ ++ S +F P L +LE DDK +S LW Sbjct: 270 FFLPQHRERIVLVGIRRDIAGSAQFSLRDIRQFFPAQVPSLQSLLEPQPDDKYILSPVLW 329 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101 + + +K G GFG+GL ++ TLSARYYKDGSEI Sbjct: 330 RYLYQYAKKHKARGNGFGFGLNDPHNVHCCVRTLSARYYKDGSEI 374 >gi|188533556|ref|YP_001907353.1| DNA cytosine methylase [Erwinia tasmaniensis Et1/99] gi|188028598|emb|CAO96460.1| DNA-cytosine methyltransferase [Erwinia tasmaniensis Et1/99] Length = 469 Score = 148 bits (374), Expect = 3e-34, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 52/106 (49%), Gaps = 9/106 (8%) Query: 4 CDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKL 57 F +PQ RER+ ++ F F + PR L +L+ +++K ++ L Sbjct: 277 KHF-LPQHRERIVLVGFRRDLQLPAFSLSLLPALYPRQRTPLNALLDSQVEEKYILTPTL 335 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 W+ + ++ G GFGYGL + TLSARYYKDGSEI Sbjct: 336 WKYLYHYAKKHQARGNGFGYGLVDPALENGVVRTLSARYYKDGSEI 381 >gi|291617874|ref|YP_003520616.1| EcoRIIM [Pantoea ananatis LMG 20103] gi|291152904|gb|ADD77488.1| EcoRIIM [Pantoea ananatis LMG 20103] Length = 459 Score = 148 bits (374), Expect = 3e-34, Method: Composition-based stats. Identities = 38/105 (36%), Positives = 51/105 (48%), Gaps = 9/105 (8%) Query: 6 FGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58 F +PQ RER+ ++ S +F P L +LE DDK +S LW Sbjct: 270 FFLPQHRERIVLVGIRRDIAGSAQFSLRDIRQFFPAQVPSLQSLLEPQPDDKYILSPVLW 329 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101 + + +K G GFG+GL ++ TLSARYYKDGSEI Sbjct: 330 RYLYQYAKKHKARGNGFGFGLNDPHNVHCCVRTLSARYYKDGSEI 374 >gi|148244085|ref|YP_001220322.1| DNA-cytosine methyltransferase [Acidiphilium cryptum JF-5] gi|146400648|gb|ABQ29180.1| DNA-cytosine methyltransferase [Acidiphilium cryptum JF-5] Length = 487 Score = 147 bits (373), Expect = 4e-34, Method: Composition-based stats. Identities = 43/116 (37%), Positives = 56/116 (48%), Gaps = 24/116 (20%) Query: 8 VPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRLGDILEEH---------------- 46 VPQ RER++I F + + EF F P P PRL IL Sbjct: 291 VPQHRERIFIAGFRDRNAEFTFKTLDIPDP-ASGPRLASILHPEDGTEKPDGHFTEGPLA 349 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + ++ T+++ LW Q E ++ AG GFG+GL TLSARYYKDGSEI Sbjct: 350 TVTERYTLTDHLWNYLQNYAEKHRRAGNGFGFGLCGPED-VARTLSARYYKDGSEI 404 >gi|66391578|ref|YP_239103.1| hypothetical protein RB43ORF127c [Enterobacteria phage RB43] gi|62288666|gb|AAX78649.1| hypothetical protein RB43ORF127c [Enterobacteria phage RB43] Length = 302 Score = 147 bits (372), Expect = 5e-34, Method: Composition-based stats. Identities = 49/100 (49%), Positives = 68/100 (68%), Gaps = 2/100 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + DFG+PQRRER++I+ FL+ V F FP P R+GDILE+ +DD T+S+ W+G Sbjct: 144 LNTKDFGLPQRRERVFIVCFLDD-VFFSFPVPPRTPTRVGDILED-VDDSYTLSDNAWKG 201 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 ++RKE NK GKGFGY +S T T++A+YYKDG + Sbjct: 202 FRERKERNKANGKGFGYQAVTADSTHTGTITAQYYKDGVQ 241 >gi|310767946|gb|ADP12896.1| DNA cytosine methylase [Erwinia sp. Ejp617] Length = 467 Score = 147 bits (372), Expect = 5e-34, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 52/106 (49%), Gaps = 9/106 (8%) Query: 4 CDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKL 57 F +PQ RER+ ++ F F + P L +L+ H++ K ++ L Sbjct: 275 KHF-LPQHRERIILVGFRRDLKLPAFSLSALPALYPLQRTPLKALLDSHVEAKYILTPTL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYGL + TLSARYYKDGSEI Sbjct: 334 WKYLYQYAKKHQARGNGFGYGLVDPVLENGVVRTLSARYYKDGSEI 379 >gi|259908144|ref|YP_002648500.1| DNA cytosine methylase [Erwinia pyrifoliae Ep1/96] gi|224963766|emb|CAX55267.1| DNA-cytosine methyltransferase [Erwinia pyrifoliae Ep1/96] gi|283478063|emb|CAY73979.1| DNA cytosine methylase [Erwinia pyrifoliae DSM 12163] Length = 467 Score = 147 bits (372), Expect = 5e-34, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 52/106 (49%), Gaps = 9/106 (8%) Query: 4 CDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKL 57 F +PQ RER+ ++ F F + P L +L+ H++ K ++ L Sbjct: 275 KHF-LPQHRERIILVGFRRDLKLPAFSLSALPALYPLQRTPLKALLDSHVEAKYILTPTL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 W+ + + ++ G GFGYGL + TLSARYYKDGSEI Sbjct: 334 WKYLYQYAKKHQARGNGFGYGLVDPALENGVVRTLSARYYKDGSEI 379 >gi|300717257|ref|YP_003742060.1| cytosine-specific methyltransferase [Erwinia billingiae Eb661] gi|299063093|emb|CAX60213.1| Cytosine-specific methyltransferase [Erwinia billingiae Eb661] Length = 466 Score = 147 bits (372), Expect = 5e-34, Method: Composition-based stats. Identities = 35/106 (33%), Positives = 51/106 (48%), Gaps = 9/106 (8%) Query: 4 CDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKL 57 F +PQ RER+ ++ EF + P+ L ++E +D K ++ L Sbjct: 275 KHF-LPQHRERIVLVGMRRDLKLPEFTLKALSTLYPKQRIPLRALMEPEVDSKYILTPTL 333 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 W+ + ++ G GFGYGL + TLSARYYKDGSEI Sbjct: 334 WKYLYNYAKKHQAKGNGFGYGLVDPQVETGVVRTLSARYYKDGSEI 379 >gi|239621327|ref|ZP_04664358.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp. infantis CCUG 52486] gi|239515788|gb|EEQ55655.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp. infantis CCUG 52486] Length = 343 Score = 147 bits (372), Expect = 5e-34, Method: Composition-based stats. Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 5/104 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDIL--EEHIDDKSTISNKL 57 + A F VPQ RER YI+ F + F F +G IL + DK +S+KL Sbjct: 179 IDAAGF-VPQHRERTYIVGFREEN-GFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKL 236 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 W Q K+ ++ AG GFGYG+ + T TLSARY KDGSEI Sbjct: 237 WTYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 280 >gi|23466029|ref|NP_696632.1| modification methylase very EcoRII (cytosine-specificmethyltransferase [Bifidobacterium longum NCC2705] gi|23326750|gb|AAN25268.1| modification methylase very similar to EcoRII (cytosine-specificmethyltransferase [Bifidobacterium longum NCC2705] Length = 323 Score = 147 bits (372), Expect = 6e-34, Method: Composition-based stats. Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 5/104 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDIL--EEHIDDKSTISNKL 57 + A F VPQ RER YI+ F + F F +G IL + DK +S+KL Sbjct: 159 IDAAGF-VPQHRERTYIVGFREEN-GFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKL 216 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 W Q K+ ++ AG GFGYG+ + T TLSARY KDGSEI Sbjct: 217 WTYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 260 >gi|189439219|ref|YP_001954300.1| site-specific DNA methylase [Bifidobacterium longum DJO10A] gi|189427654|gb|ACD97802.1| Site-specific DNA methylase [Bifidobacterium longum DJO10A] Length = 323 Score = 146 bits (371), Expect = 6e-34, Method: Composition-based stats. Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 5/104 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDIL--EEHIDDKSTISNKL 57 + A F VPQ RER YI+ F + F F +G IL + DK +S+KL Sbjct: 159 IDAAGF-VPQHRERTYIVGFREEN-GFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKL 216 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 W Q K+ ++ AG GFGYG+ + T TLSARY KDGSEI Sbjct: 217 WTYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 260 >gi|46191283|ref|ZP_00120453.2| COG0270: Site-specific DNA methylase [Bifidobacterium longum DJO10A] Length = 315 Score = 146 bits (371), Expect = 7e-34, Method: Composition-based stats. Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 5/104 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDIL--EEHIDDKSTISNKL 57 + A F VPQ RER YI+ F + F F +G IL + DK +S+KL Sbjct: 151 IDAAGF-VPQHRERTYIVGFREEN-GFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKL 208 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 W Q K+ ++ AG GFGYG+ + T TLSARY KDGSEI Sbjct: 209 WTYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 252 >gi|157412142|ref|YP_001481483.1| DNA cytosine methylase [Escherichia coli APEC O1] gi|99867167|gb|ABF67812.1| cytosine methylase [Escherichia coli APEC O1] Length = 489 Score = 146 bits (370), Expect = 9e-34, Method: Composition-based stats. Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 9/102 (8%) Query: 9 PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61 PQ RER+ +I F F +P L D+L+ +D K +S KLWE Sbjct: 292 PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPKLWEYL 351 Query: 62 QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 + + G GFG+GL + ++ T TLS+RY KDGSEI Sbjct: 352 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 393 >gi|226807724|ref|YP_002791420.1| Dcm [Enterobacter cloacae] gi|226810038|ref|YP_002791733.1| Dcm [Enterobacter cloacae] gi|226425951|gb|ACO54044.1| Dcm [Enterobacter cloacae] gi|226426265|gb|ACO54357.1| Dcm [Enterobacter cloacae] Length = 489 Score = 146 bits (370), Expect = 9e-34, Method: Composition-based stats. Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 9/102 (8%) Query: 9 PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61 PQ RER+ +I F F +P L D+L+ +D K +S KLWE Sbjct: 292 PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPKLWEYL 351 Query: 62 QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 + + G GFG+GL + ++ T TLS+RY KDGSEI Sbjct: 352 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 393 >gi|38347986|ref|NP_941235.1| DNA cytosine methylase [Serratia marcescens] gi|190410308|ref|YP_001965811.1| dcm [Klebsiella pneumoniae] gi|38259463|emb|CAE51691.1| DNA-cytosine methyltransferase [Serratia marcescens] gi|146151102|gb|ABQ02868.1| dcm [Klebsiella pneumoniae] Length = 475 Score = 146 bits (370), Expect = 9e-34, Method: Composition-based stats. Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 9/102 (8%) Query: 9 PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61 PQ RER+ +I F F +P L D+L+ +D K +S KLWE Sbjct: 278 PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPKLWEYL 337 Query: 62 QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 + + G GFG+GL + ++ T TLS+RY KDGSEI Sbjct: 338 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 379 >gi|237725529|ref|ZP_04556010.1| DNA (cytosine-5-)-methyltransferase [Bacteroides sp. D4] gi|229436216|gb|EEO46293.1| DNA (cytosine-5-)-methyltransferase [Bacteroides dorei 5_1_36/D4] Length = 374 Score = 145 bits (368), Expect = 1e-33, Method: Composition-based stats. Identities = 57/123 (46%), Positives = 73/123 (59%), Gaps = 22/123 (17%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLG-----------------IKPRLG 40 + A FGVPQ RERL+I+ + V+ FKFP + IK ++ Sbjct: 166 LNAKYFGVPQNRERLFIVAWYKDIVKATTFKFPYGIAPDGSTIYEKSKDLGDKVIKTKVS 225 Query: 41 DILEEH--IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98 DI E ID TIS++LW GHQ+RK+ NK GKGFGY LF ENS ++T+SARY+KDG Sbjct: 226 DIFEPEDSIDSYYTISDRLWIGHQERKKRNKANGKGFGYSLFNENSVYSSTISARYWKDG 285 Query: 99 SEI 101 SEI Sbjct: 286 SEI 288 >gi|254251049|ref|ZP_04944367.1| Site-specific DNA methylase [Burkholderia dolosa AUO158] gi|124893658|gb|EAY67538.1| Site-specific DNA methylase [Burkholderia dolosa AUO158] Length = 530 Score = 145 bits (368), Expect = 1e-33, Method: Composition-based stats. Identities = 42/118 (35%), Positives = 54/118 (45%), Gaps = 28/118 (23%) Query: 9 PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45 PQ RER+ I+ F P+ + P GIK + DIL + Sbjct: 331 PQHRERIVIVGFREPTPFSWESLQLPEKGGIK--MKDILHKLDGSEPRLEHDGDRYFDHE 388 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 ++DK T++ LW+ Q +K G GFGYGL TLSARYYKDGSEI Sbjct: 389 KQKVNDKYTLTPNLWKYLQDYAAKHKAKGNGFGYGLVGPED-IARTLSARYYKDGSEI 445 >gi|307729019|ref|YP_003906243.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1003] gi|307583554|gb|ADN56952.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1003] Length = 428 Score = 145 bits (368), Expect = 2e-33, Method: Composition-based stats. Identities = 40/115 (34%), Positives = 51/115 (44%), Gaps = 23/115 (20%) Query: 9 PQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEH--------------------- 46 PQ RER+ I+ F + F PRL IL + Sbjct: 235 PQHRERIVIVGFRQETGFSFDDLKLPASGPRLASILHKTDGSEPLLPHDGERFFDPVRRS 294 Query: 47 IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+GL S T TLSARY+KDGSEI Sbjct: 295 VQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGLVTPAS-VTRTLSARYHKDGSEI 348 >gi|328947602|ref|YP_004364939.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] gi|328447926|gb|AEB13642.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] Length = 431 Score = 145 bits (367), Expect = 2e-33, Method: Composition-based stats. Identities = 43/118 (36%), Positives = 56/118 (47%), Gaps = 26/118 (22%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEE------------------- 45 VPQ RER+ I+ F N V+F P + +L IL + Sbjct: 233 VPQHRERIVIVGFRN-KVDFSLEDMELPPKGEVKLASILHKTDGTEPRLPQDGDKYFDFE 291 Query: 46 --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + DK T+++ LW Q + ++ G GFGYGL EN TLSARYYKDGSEI Sbjct: 292 NNKVLDKYTLTDNLWAYLQAYAQKHRSMGNGFGYGLVNEND-IARTLSARYYKDGSEI 348 >gi|323525262|ref|YP_004227415.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1001] gi|323382264|gb|ADX54355.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1001] Length = 428 Score = 145 bits (366), Expect = 2e-33, Method: Composition-based stats. Identities = 41/116 (35%), Positives = 52/116 (44%), Gaps = 25/116 (21%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE--------------------- 45 PQ RER+ I+ F + F F PRL IL + Sbjct: 235 PQHRERIVIVGFREET-GFSFDDLRLPANGPRLASILHKTDGSEPLLPHDGERFFDHVRR 293 Query: 46 HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+GL S T TLSARY+KDGSEI Sbjct: 294 KVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGLVTPAS-VTRTLSARYHKDGSEI 348 >gi|294661528|ref|YP_003579981.1| hypothetical protein KP-KP15_gp115 [Klebsiella phage KP15] gi|292660689|gb|ADE34937.1| hypothetical protein [Klebsiella phage KP15] Length = 308 Score = 144 bits (365), Expect = 3e-33, Method: Composition-based stats. Identities = 50/100 (50%), Positives = 68/100 (68%), Gaps = 2/100 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 M DFG+PQRRER++I+ F +P V F FP P R+GDILE +D+ TIS++ W+G Sbjct: 144 MNTKDFGLPQRRERVFIVCFRDP-VFFSFPVPPRTPTRVGDILEPD-NDQYTISDRAWKG 201 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 ++RKE NK GKGFGY +S T T++A+YYKDG + Sbjct: 202 FRERKELNKANGKGFGYQAVTVDSVCTGTITAQYYKDGVQ 241 >gi|329298618|ref|ZP_08255954.1| DNA cytosine methylase [Plautia stali symbiont] Length = 465 Score = 144 bits (365), Expect = 3e-33, Method: Composition-based stats. Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 10/110 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPR----LGDILEEHIDDKSTI 53 + A F +PQ RER+ ++ + F + P L +LE K + Sbjct: 269 VDARHF-LPQHRERIVLVGIRRDTGLSEGFSLRALAALYPPEVPALHSLLELQPAAKYIL 327 Query: 54 SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101 S LW + + +K G GFG+GL + TLSARYYKDGSEI Sbjct: 328 SPTLWHYLYQYAKKHKAKGNGFGFGLNDPRNPHCCVRTLSARYYKDGSEI 377 >gi|217980150|ref|YP_002364200.1| DNA-cytosine methyltransferase [Thauera sp. MZ1T] gi|217508321|gb|ACK55106.1| DNA-cytosine methyltransferase [Thauera sp. MZ1T] Length = 419 Score = 144 bits (365), Expect = 4e-33, Method: Composition-based stats. Identities = 41/119 (34%), Positives = 53/119 (44%), Gaps = 26/119 (21%) Query: 8 VPQRRERLYIIDFLNPS-VEFKFPT---PLGIKPRLGDILEEH----------------- 46 VPQ RER+ I+ F N + F + P + DIL Sbjct: 223 VPQHRERILIVGFRNEDGIRFDWDAVGLPQKGVHVMRDILHRTDGTEPVLPWDGDRFFDH 282 Query: 47 ----IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + DK T++ KLW Q + ++ G GFG+GL S TLSARYYKDGSEI Sbjct: 283 AGRRVQDKYTLTPKLWRYLQDYADKHRAKGNGFGFGLVHPGS-VARTLSARYYKDGSEI 340 >gi|292488627|ref|YP_003531511.1| DNA cytosine methylase [Erwinia amylovora CFBP1430] gi|292899788|ref|YP_003539157.1| modification methylase EcoRII [Erwinia amylovora ATCC 49946] gi|291199636|emb|CBJ46755.1| modification methylase EcoRII [Erwinia amylovora ATCC 49946] gi|291554058|emb|CBA21160.1| DNA cytosine methylase [Erwinia amylovora CFBP1430] gi|312172770|emb|CBX81026.1| DNA cytosine methylase [Erwinia amylovora ATCC BAA-2158] Length = 469 Score = 144 bits (365), Expect = 4e-33, Method: Composition-based stats. Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 15/109 (13%) Query: 4 CDFGVPQRRERLYIIDFLNPSVEFKFPTP---------LGIKPRLGDILEEHIDDKSTIS 54 F +PQ RER+ ++ F + K P + L +L+ ++ K ++ Sbjct: 277 KHF-LPQHRERIILVGFRR---DLKLPAFSLSALPAWYPQQRTPLHALLDTDVEAKYILT 332 Query: 55 NKLWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101 LW+ + ++ G GFGYGL + TLSARYYKDGSEI Sbjct: 333 PTLWKYLYHYAKKHQARGNGFGYGLVDPALENGVVRTLSARYYKDGSEI 381 >gi|304373674|ref|YP_003858419.1| putative DNA-methyltransferase, type II restriction-modification system [Enterobacteria phage RB16] gi|299829630|gb|ADJ55423.1| putative DNA-methyltransferase, type II restriction-modification system [Enterobacteria phage RB16] Length = 302 Score = 144 bits (364), Expect = 4e-33, Method: Composition-based stats. Identities = 49/100 (49%), Positives = 67/100 (67%), Gaps = 2/100 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + DFG+PQRRER++I+ FL+ V F FP P R+GDILE+ DD T+S+ W+G Sbjct: 144 LNTKDFGLPQRRERVFIVCFLDD-VFFSFPVPPRTPTRVGDILEDA-DDSYTLSDNAWKG 201 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 ++RKE NK GKGFGY +S T T++A+YYKDG + Sbjct: 202 FRERKERNKANGKGFGYQAVTADSTHTGTITAQYYKDGVQ 241 >gi|189423370|ref|YP_001950547.1| DNA-cytosine methyltransferase [Geobacter lovleyi SZ] gi|189419629|gb|ACD94027.1| DNA-cytosine methyltransferase [Geobacter lovleyi SZ] Length = 415 Score = 144 bits (364), Expect = 4e-33, Method: Composition-based stats. Identities = 42/113 (37%), Positives = 52/113 (46%), Gaps = 21/113 (18%) Query: 8 VPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEH-----------------ID 48 VPQ RER+ I+ F F F P+L IL + Sbjct: 226 VPQHRERIIIVGFR-EKTGFSFDSLQLPKEGPKLFSILHPEDGTEQEETPFTVGDKAKVH 284 Query: 49 DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +K ++N LW Q +K AG GFG+GL +N T TLSARYYKDGSEI Sbjct: 285 EKYILTNNLWSYLQAYAAKHKAAGNGFGFGLVGKND-TARTLSARYYKDGSEI 336 >gi|170691874|ref|ZP_02883038.1| DNA-cytosine methyltransferase [Burkholderia graminis C4D1M] gi|170143158|gb|EDT11322.1| DNA-cytosine methyltransferase [Burkholderia graminis C4D1M] Length = 438 Score = 144 bits (364), Expect = 5e-33, Method: Composition-based stats. Identities = 42/116 (36%), Positives = 54/116 (46%), Gaps = 25/116 (21%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE--------------------- 45 PQ RER+ II F + + EF F PRL IL + Sbjct: 245 PQHRERIVIIGFRSDT-EFSFDDLRLPATGPRLASILHKTDGSEPLLPHDGERFFDHVQR 303 Query: 46 HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q + ++ AG GFG+GL S T TLSARY+KDGSEI Sbjct: 304 KVQPKYTLTPNLWAYLQAYADKHRAAGNGFGFGLVTPAS-VTRTLSARYHKDGSEI 358 >gi|7636053|emb|CAB88410.1| putative methyltransferase [Serratia marcescens] Length = 290 Score = 143 bits (362), Expect = 7e-33, Method: Composition-based stats. Identities = 36/102 (35%), Positives = 50/102 (49%), Gaps = 9/102 (8%) Query: 9 PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61 PQ RER+ +I F F +P L D+L+ +D K +S LWE Sbjct: 93 PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPXLWEYL 152 Query: 62 QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 + + G GFG+GL + ++ T TLS+RY KDGSEI Sbjct: 153 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 194 >gi|91782477|ref|YP_557683.1| C-5 cytosine-specific DNA methylase [Burkholderia xenovorans LB400] gi|91686431|gb|ABE29631.1| C-5 cytosine-specific DNA methylase [Burkholderia xenovorans LB400] Length = 418 Score = 143 bits (362), Expect = 8e-33, Method: Composition-based stats. Identities = 40/119 (33%), Positives = 54/119 (45%), Gaps = 25/119 (21%) Query: 6 FGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE------------------ 45 + PQ RER+ I+ F + EF F PRL IL + Sbjct: 228 YFTPQHRERIVIVGFREET-EFTFDDLNVPAEGPRLASILHKTDGSEPVLAHDGDRFFDH 286 Query: 46 ---HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + + T++ LW Q ++ AG GFG+GL +S T TLSARY+KDGSEI Sbjct: 287 ASREVQPRYTLTANLWAYLQAYAAKHRAAGNGFGFGLVTPDS-VTRTLSARYFKDGSEI 344 >gi|327198092|ref|YP_004306459.1| gp47 [Burkholderia phage KL3] gi|310657226|gb|ADP02340.1| gp47 [Burkholderia phage KL3] Length = 422 Score = 143 bits (361), Expect = 1e-32, Method: Composition-based stats. Identities = 39/116 (33%), Positives = 53/116 (45%), Gaps = 25/116 (21%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE--------------------- 45 PQ RER+ I+ F F + PRL IL + Sbjct: 229 PQHRERIVIVGFRK-KTGFSWDDLRLPADGPRLASILHKTDGSEPVLPWDGERFFDHEKR 287 Query: 46 HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+G+ + +S T TLSARY+KDGSEI Sbjct: 288 KVQSKYTLTPNLWTYLQAYAEKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 342 >gi|261337441|ref|ZP_05965325.1| modification methylase HpaII [Bifidobacterium gallicum DSM 20093] gi|270277829|gb|EFA23683.1| modification methylase HpaII [Bifidobacterium gallicum DSM 20093] Length = 442 Score = 142 bits (359), Expect = 2e-32, Method: Composition-based stats. Identities = 40/117 (34%), Positives = 58/117 (49%), Gaps = 25/117 (21%) Query: 8 VPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEE-------------------- 45 VPQ RER+YI+ F + +F + +P L DIL + Sbjct: 231 VPQHRERIYIVGFCS-KTDFTWDDLKFPDHQPILADILHKTDGTEPYLPWDGDKYFDFEH 289 Query: 46 -HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + DK T++ +LW+ Q ++ ++ G GFGYGL + TLSARY+KDGSEI Sbjct: 290 QKVQDKYTLTPRLWQYLQDYRKKHEALGHGFGYGLVTP-DMVSRTLSARYHKDGSEI 345 >gi|209520785|ref|ZP_03269531.1| DNA-cytosine methyltransferase [Burkholderia sp. H160] gi|209498782|gb|EDZ98891.1| DNA-cytosine methyltransferase [Burkholderia sp. H160] Length = 432 Score = 142 bits (359), Expect = 2e-32, Method: Composition-based stats. Identities = 41/116 (35%), Positives = 54/116 (46%), Gaps = 25/116 (21%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEH-------------------- 46 PQ RER+ I+ F + F + PRLG IL Sbjct: 238 PQHRERIIIVGFRGETT-FTWDDLRLPEQGPRLGAILHRKDGSEPVLPWDHDRFFDHAAR 296 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ KLW Q ++ AG GFG+GL + +S T TLSARY+KDGSEI Sbjct: 297 RVQPKYTLTPKLWAYLQNYAAKHRAAGNGFGFGLAYPDS-VTRTLSARYHKDGSEI 351 >gi|296159065|ref|ZP_06841892.1| DNA-cytosine methyltransferase [Burkholderia sp. Ch1-1] gi|295890626|gb|EFG70417.1| DNA-cytosine methyltransferase [Burkholderia sp. Ch1-1] Length = 426 Score = 141 bits (358), Expect = 2e-32, Method: Composition-based stats. Identities = 40/116 (34%), Positives = 54/116 (46%), Gaps = 25/116 (21%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEH-------------------- 46 PQ RER+ I+ F + F + PRLG IL Sbjct: 232 PQHRERIIIVGFRGET-SFSWDDLHLPENGPRLGSILHRTDGSEPVLPWDHDRFFDHTSR 290 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+G+ + +S T TLSARY+KDGSEI Sbjct: 291 RVQPKYTLTPNLWTYLQNYAEKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 345 >gi|119355933|ref|YP_910577.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides DSM 266] gi|119353282|gb|ABL64153.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides DSM 266] Length = 425 Score = 141 bits (358), Expect = 2e-32, Method: Composition-based stats. Identities = 42/115 (36%), Positives = 53/115 (46%), Gaps = 23/115 (20%) Query: 8 VPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEEH----------------- 46 VPQ RER++I F F P +P + IL Sbjct: 224 VPQHRERIFIAGFREDCGFSFDRFDLP-HGNERPVIETILHPENGMEDEEPPYTVGPLAR 282 Query: 47 IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 I D+ T+S+ LWE QK E ++ G GFG+GL + TLSARYYKDGSEI Sbjct: 283 ISDRYTLSDHLWEYLQKYAEKHRAKGNGFGFGLVGPHD-VARTLSARYYKDGSEI 336 >gi|149184876|ref|ZP_01863193.1| hypothetical protein ED21_17522 [Erythrobacter sp. SD-21] gi|148830987|gb|EDL49421.1| hypothetical protein ED21_17522 [Erythrobacter sp. SD-21] Length = 410 Score = 141 bits (358), Expect = 2e-32, Method: Composition-based stats. Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 23/121 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEH----------- 46 + A F +PQ RER+ ++ F F + P+ + R+ +L Sbjct: 216 LNARHF-LPQNRERIVLVGFR-EKSGFDWADLKLPVEGEARMRSVLHPENGSEIAESHYT 273 Query: 47 ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 + K T+SN LW+ + ++ AG GFGYGL + T TLSARYYKDGSE Sbjct: 274 EGELATVSAKYTLSNHLWKYLRDYSAKHRAAGNGFGYGLVGPDD-TCRTLSARYYKDGSE 332 Query: 101 I 101 I Sbjct: 333 I 333 >gi|118576810|ref|YP_876553.1| C-5 cytosine-specific DNA methylase [Cenarchaeum symbiosum A] gi|118195331|gb|ABK78249.1| C-5 cytosine-specific DNA methylase [Cenarchaeum symbiosum A] Length = 325 Score = 141 bits (357), Expect = 3e-32, Method: Composition-based stats. Identities = 44/94 (46%), Positives = 56/94 (59%), Gaps = 2/94 (2%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67 VPQ RERL+I+ F + VEF+FP KPRL DILE + ++ +W ++ KE Sbjct: 159 VPQHRERLFIVGF-DREVEFEFPKMKNAKPRLRDILEPDPGSEYVLTPGVWAALKRHKEA 217 Query: 68 NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + G GFGYG+ T TLS RYYKDGSEI Sbjct: 218 CRARGAGFGYGIADP-DGVTRTLSRRYYKDGSEI 250 >gi|226942156|ref|YP_002797230.1| Cytosine-specific methyltransferase [Laribacter hongkongensis HLHK9] gi|226717083|gb|ACO76221.1| Cytosine-specific methyltransferase [Laribacter hongkongensis HLHK9] Length = 420 Score = 141 bits (357), Expect = 3e-32, Method: Composition-based stats. Identities = 43/117 (36%), Positives = 54/117 (46%), Gaps = 26/117 (22%) Query: 9 PQRRERLYIIDFLNPSVEFKF---PTPLGIKPRLGDILEEH------------------- 46 PQ RER+ I F P V F + P P L +L Sbjct: 231 PQHRERILIAGFREP-VAFDWDAIPLPPKGSRTLRTVLHRTDGSEPVLPWDGDRFFDHQA 289 Query: 47 --IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + DK T++ KLW+ Q E ++ G GFG+GL +S T TLSARYYKDGSEI Sbjct: 290 RCVQDKYTLTPKLWDYLQAYAEKHRAKGNGFGFGLVGPDS-VTRTLSARYYKDGSEI 345 >gi|295675907|ref|YP_003604431.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1002] gi|295435750|gb|ADG14920.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1002] Length = 430 Score = 141 bits (356), Expect = 3e-32, Method: Composition-based stats. Identities = 40/116 (34%), Positives = 53/116 (45%), Gaps = 25/116 (21%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEH-------------------- 46 PQ RER+ I+ F F + PRLG IL Sbjct: 236 PQHRERIIIVGFR-GKTAFTWDDLRLPDEGPRLGAILHRTDGTEPVLPWDHDRFFDHATR 294 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ KLW Q ++ AG GFG+G+ + +S T TLSARY+KDGSEI Sbjct: 295 RVQPKYTLTPKLWAYLQNYAAKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 349 >gi|114571596|ref|YP_758276.1| DNA-cytosine methyltransferase [Maricaulis maris MCS10] gi|114342058|gb|ABI67338.1| DNA-cytosine methyltransferase [Maricaulis maris MCS10] Length = 406 Score = 141 bits (356), Expect = 3e-32, Method: Composition-based stats. Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 10/102 (9%) Query: 8 VPQRRERLYIIDFLNPSVEFKFP------TPLGIKPRLGDILEEH--IDDKSTISNKLWE 59 VPQ+RER++I+ F + S +F F P L IL+ H I K T++ KLW+ Sbjct: 228 VPQKRERVFIVGFRD-STDFSFEGFERLIPHASNHPTLDSILQSHNEIGQKYTLTEKLWD 286 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 Q ++ ++ G GFGY LF + TLSARY+KDGSEI Sbjct: 287 YLQAYRQKHESKGNGFGYSLFGPDD-VARTLSARYHKDGSEI 327 >gi|320331203|gb|EFW87160.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea str. race 4] gi|330882725|gb|EGH16874.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea str. race 4] Length = 420 Score = 140 bits (355), Expect = 5e-32, Method: Composition-based stats. Identities = 40/116 (34%), Positives = 53/116 (45%), Gaps = 25/116 (21%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEH-------------------- 46 PQ RER+ I+ F F + PRL IL + Sbjct: 228 PQHRERIIIVGFR-EKTGFSWDDLRLPTDGPRLASILHKTDGTERVLPWDEDRFFDHKKR 286 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+G+ F +S T TLSARY+KDGSEI Sbjct: 287 VVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGMAFPDS-VTRTLSARYHKDGSEI 341 >gi|85709931|ref|ZP_01040996.1| Type II restriction-modification system methylation subunit [Erythrobacter sp. NAP1] gi|85688641|gb|EAQ28645.1| Type II restriction-modification system methylation subunit [Erythrobacter sp. NAP1] Length = 370 Score = 140 bits (354), Expect = 7e-32, Method: Composition-based stats. Identities = 43/111 (38%), Positives = 59/111 (53%), Gaps = 10/111 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-------FKFPTPLGIKPRLGDILEEHID---DK 50 + A +FGVPQ+RER+YI+ F F G RLGD LE + Sbjct: 184 LAATEFGVPQKRERVYIVGFDRDHFGNIDANDVFAQLERGGHPTRLGDALEPEGANSLAR 243 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 TIS+KLW G +R ++ G GFG+ +F + NT+++RYYKDG EI Sbjct: 244 YTISDKLWSGLIRRMARHEAKGNGFGHKVFNYDDPYCNTITSRYYKDGREI 294 >gi|260909972|ref|ZP_05916659.1| modification methylase EcoRII [Prevotella sp. oral taxon 472 str. F0295] gi|260635922|gb|EEX53925.1| modification methylase EcoRII [Prevotella sp. oral taxon 472 str. F0295] Length = 370 Score = 140 bits (353), Expect = 8e-32, Method: Composition-based stats. Identities = 53/121 (43%), Positives = 71/121 (58%), Gaps = 20/121 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGI----------------KPRLGD 41 + A FGVPQ RERL+II + V+ FKFP + I ++ + Sbjct: 166 LNAKYFGVPQNRERLFIIAWNRELVDVDCFKFPYGIAIDGTSIYEKRKLKGRTIPTKVSE 225 Query: 42 ILEEH-IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 I E + TI++++WEGH+ RKE NK+ GKGFGY LF NS T+T+SARY+KDGSE Sbjct: 226 IFEPDNVTTPFTITDRMWEGHKTRKERNKMNGKGFGYSLFNANSEYTSTISARYWKDGSE 285 Query: 101 I 101 I Sbjct: 286 I 286 >gi|187923141|ref|YP_001894783.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN] gi|187714335|gb|ACD15559.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN] Length = 426 Score = 140 bits (353), Expect = 8e-32, Method: Composition-based stats. Identities = 40/116 (34%), Positives = 52/116 (44%), Gaps = 25/116 (21%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEH-------------------- 46 PQ RER+ I+ F F + PRLG IL Sbjct: 232 PQHRERIIIVGFR-GKTAFSWDDLRLPQDGPRLGSILHRTDGSEPVLPWDHDRFFDHAGR 290 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + K T++ LW Q E ++ AG GFG+G+ + S T TLSARY+KDGSEI Sbjct: 291 RVQPKYTLTPNLWTYLQNYAEKHRAAGNGFGFGMAYPTS-VTRTLSARYHKDGSEI 345 >gi|186476891|ref|YP_001858361.1| DNA-cytosine methyltransferase [Burkholderia phymatum STM815] gi|184193350|gb|ACC71315.1| DNA-cytosine methyltransferase [Burkholderia phymatum STM815] Length = 428 Score = 138 bits (350), Expect = 2e-31, Method: Composition-based stats. Identities = 41/116 (35%), Positives = 54/116 (46%), Gaps = 25/116 (21%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE--------------------- 45 PQ RER+ +I F + F + PRL IL Sbjct: 237 PQHRERIIMIGFRART-SFSWDDLRLPEEGPRLASILHRTDGTEPVLPWDGDRFFDHAAR 295 Query: 46 HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 H+ K T++ KLW Q + ++ AG GFGYG+ + S T TLSARY+KDGSEI Sbjct: 296 HVQPKYTLTPKLWTYLQNYADKHRAAGNGFGYGMAYPQS-VTRTLSARYHKDGSEI 350 >gi|149926993|ref|ZP_01915251.1| C-5 cytosine-specific DNA methylase [Limnobacter sp. MED105] gi|149824214|gb|EDM83434.1| C-5 cytosine-specific DNA methylase [Limnobacter sp. MED105] Length = 435 Score = 138 bits (349), Expect = 3e-31, Method: Composition-based stats. Identities = 43/117 (36%), Positives = 54/117 (46%), Gaps = 26/117 (22%) Query: 9 PQRRERLYIIDFLNPSVEFKF---PTPLGIKPRLGDILEE-------------------- 45 PQ RER+ I F + V F + P P +L +IL + Sbjct: 245 PQHRERILIAGFADQ-VAFDWDAIPLPPKGSRKLKEILHKTDGSEPYLPWDENRFFDHDS 303 Query: 46 -HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + DK T++ LW Q +K G GFG+GL S TT TLSARYYKDGSEI Sbjct: 304 KKVQDKYTLTPGLWTYLQNYAAKHKAKGNGFGFGLVGPES-TTRTLSARYYKDGSEI 359 >gi|254429380|ref|ZP_05043087.1| DNA-cytosine methyltransferase superfamily [Alcanivorax sp. DG881] gi|196195549|gb|EDX90508.1| DNA-cytosine methyltransferase superfamily [Alcanivorax sp. DG881] Length = 435 Score = 138 bits (348), Expect = 3e-31, Method: Composition-based stats. Identities = 37/118 (31%), Positives = 55/118 (46%), Gaps = 26/118 (22%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPL---GIKPRLGDILEEH------------------ 46 VPQ RER+ I+ F P F + + R+ ++L Sbjct: 244 VPQHRERIAIVGFREPMP-FSWDAMKMAGKGEKRMREVLHREDGSEPYLEWDGDRFFDHG 302 Query: 47 ---IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 +++K ++ KLW+ + K ++ G GFG+GL +S TLSARYYKDGSEI Sbjct: 303 KGEVNEKYILTPKLWKYLKDYKAKHQAKGNGFGFGLVGPDS-VARTLSARYYKDGSEI 359 >gi|238898088|ref|YP_002923769.1| DNA cytosine methylase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gi|229465848|gb|ACQ67622.1| DNA cytosine methylase [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] Length = 401 Score = 138 bits (348), Expect = 3e-31, Method: Composition-based stats. Identities = 37/116 (31%), Positives = 52/116 (44%), Gaps = 25/116 (21%) Query: 9 PQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEH-------------------- 46 PQ RER+ I+ F F + PRL IL Sbjct: 208 PQHRERIIIVGFR-EKTGFSWDDLKLPEEGPRLASILHRTDGTEPVLPWDGERFFDHDRR 266 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + + T++ LW Q + ++ AG GFG+G+ + +S T TLSARY+KDGSEI Sbjct: 267 AVPLRYTLTPNLWAYLQAYADKHRAAGNGFGFGIVYPDS-VTRTLSARYHKDGSEI 321 >gi|121997219|ref|YP_001002006.1| DNA-cytosine methyltransferase [Halorhodospira halophila SL1] gi|121588624|gb|ABM61204.1| DNA-cytosine methyltransferase [Halorhodospira halophila SL1] Length = 436 Score = 137 bits (346), Expect = 5e-31, Method: Composition-based stats. Identities = 39/115 (33%), Positives = 53/115 (46%), Gaps = 24/115 (20%) Query: 8 VPQRRERLYIIDFLNPS----VEFKFPTPLGIKPRLGDILEEH----------------- 46 VPQ RER+Y++ F + + FP P L ++L Sbjct: 241 VPQHRERIYMVGFRKDTPFTWNQLDFPAPDAR--TLREVLHPEDGSEAAEPPYTEGDLAT 298 Query: 47 IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + DK +S KLW+ Q + ++ AG GFGY T TLSARY+KDGSEI Sbjct: 299 VGDKYVLSEKLWKYLQDYRAKHEHAGNGFGYSKVGPED-TARTLSARYHKDGSEI 352 >gi|54293106|ref|YP_125521.1| hypothetical protein lpl0145 [Legionella pneumophila str. Lens] gi|53752938|emb|CAH14374.1| hypothetical protein lpl0145 [Legionella pneumophila str. Lens] Length = 417 Score = 136 bits (344), Expect = 8e-31, Method: Composition-based stats. Identities = 39/113 (34%), Positives = 54/113 (47%), Gaps = 20/113 (17%) Query: 8 VPQRRERLYIIDFLNPSV----EFKFPTPLG------IKPRLGDILEE---------HID 48 VPQ RER++I+ F + + P + P G +EE + Sbjct: 226 VPQHRERIFIVGFREDLPFSWNDLRLPPKNSVLLESILHPENGTEIEEKPYTFGEKAEVS 285 Query: 49 DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 T+S+KLW Q K+ + G GFG+GL E + TLSARY+KDGSEI Sbjct: 286 SCFTLSDKLWNYLQDYKKKHSEKGNGFGFGLVSEKN-IARTLSARYHKDGSEI 337 >gi|254526757|ref|ZP_05138809.1| modification methylase EcoRII [Prochlorococcus marinus str. MIT 9202] gi|221538181|gb|EEE40634.1| modification methylase EcoRII [Prochlorococcus marinus str. MIT 9202] Length = 298 Score = 136 bits (344), Expect = 9e-31, Method: Composition-based stats. Identities = 39/122 (31%), Positives = 59/122 (48%), Gaps = 24/122 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL----GIKPRLGDILEEH---------- 46 + A F VPQ R+R+YI+ F + F F + P L +L Sbjct: 99 INAKSF-VPQNRQRIYIVGFREEN-NFNFDDLIIPDISKGPTLSSVLHPEDGSENFEDPY 156 Query: 47 -------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99 +++K TI+NKLW+ + ++ ++ G GFG+GL TLSARY+KDG+ Sbjct: 157 TIPHLSKVNEKYTITNKLWDYLKMYEKKHRAKGNGFGFGLCKRED-VARTLSARYHKDGA 215 Query: 100 EI 101 EI Sbjct: 216 EI 217 >gi|228469904|ref|ZP_04054843.1| cytosine-specific methyltransferase NlaX [Porphyromonas uenonis 60-3] gi|228308539|gb|EEK17327.1| cytosine-specific methyltransferase NlaX [Porphyromonas uenonis 60-3] Length = 395 Score = 135 bits (341), Expect = 2e-30, Method: Composition-based stats. Identities = 49/122 (40%), Positives = 68/122 (55%), Gaps = 21/122 (17%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFP----------------TPLGIKPRLGD 41 + A FGVPQ RERL+I+ + + F FP I+ ++ D Sbjct: 188 LNAKYFGVPQNRERLFIVAWSKDLISADRFLFPYGIDAEGNTIYDKQMAKRCAIRTKVSD 247 Query: 42 ILEEHIDDK--STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99 I E ++ TIS+++W GHQ RK+ N++ GKGFGY F NS T+T+SARY+KDGS Sbjct: 248 IFEPQSIERDGFTISDRMWLGHQTRKKRNRLNGKGFGYSKFTGNSVYTSTISARYWKDGS 307 Query: 100 EI 101 EI Sbjct: 308 EI 309 >gi|126464142|ref|YP_001045255.1| DNA-cytosine methyltransferase [Rhodobacter sphaeroides ATCC 17029] gi|126105953|gb|ABN78483.1| DNA-cytosine methyltransferase [Rhodobacter sphaeroides ATCC 17029] Length = 417 Score = 135 bits (341), Expect = 2e-30, Method: Composition-based stats. Identities = 42/123 (34%), Positives = 60/123 (48%), Gaps = 24/123 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEF-KFPTPLGIK-PRLGDILEEH--------- 46 + A F VPQ RER++I+ ++ K P G+ PR G +L + Sbjct: 216 IDARCF-VPQHRERIFIVGVRKDLDMKIDLSKLVLPSGVTGPRFGTVLHKEDGSELPNNR 274 Query: 47 --------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98 + D+ T+S+KLW+ Q E ++ G GFG+GL TLSARY+KDG Sbjct: 275 SFLDPEGRVSDRYTLSDKLWKYLQDYAEKHRQKGNGFGFGL-TRRGDVARTLSARYHKDG 333 Query: 99 SEI 101 SEI Sbjct: 334 SEI 336 >gi|320156908|ref|YP_004189287.1| DNA-cytosine methyltransferase [Vibrio vulnificus MO6-24/O] gi|319932220|gb|ADV87084.1| DNA-cytosine methyltransferase [Vibrio vulnificus MO6-24/O] Length = 552 Score = 132 bits (334), Expect = 1e-29, Method: Composition-based stats. Identities = 36/107 (33%), Positives = 48/107 (44%), Gaps = 14/107 (13%) Query: 9 PQRRERLYIIDFLNPSVEFKFP---------TPLGIKPRLGDIL---EEHIDDKSTISNK 56 PQ RER+ ++ VE + R+ DIL E K T++ Sbjct: 311 PQHRERIVLVGVRKDLVEKNPEYKKLSLKNIEVPQERLRVSDILTDLSEEETKKYTLTPN 370 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 LW ++ G GFG+GL ++ T TLSARYYKDGSEI Sbjct: 371 LWNYLYHYALKHQSKGNGFGFGLVDPSNPNAVTRTLSARYYKDGSEI 417 >gi|46581246|ref|YP_012054.1| type II DNA modification methyltransferase [Desulfovibrio vulgaris str. Hildenborough] gi|46450667|gb|AAS97314.1| type II DNA modification methyltransferase, putative [Desulfovibrio vulgaris str. Hildenborough] gi|311234912|gb|ADP87766.1| DNA-cytosine methyltransferase [Desulfovibrio vulgaris RCH1] Length = 358 Score = 131 bits (332), Expect = 2e-29, Method: Composition-based stats. Identities = 39/116 (33%), Positives = 60/116 (51%), Gaps = 16/116 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-----------EFKF--PTPLGIKPRLGDILEEHI 47 + A D+ +PQ RER++++ F P +F F + G + L ++E + Sbjct: 166 IDARDW-IPQHRERIFMVGFRLPEACPAGAQKWDVKDFDFGKVSRRGSQKDLESVIEPDV 224 Query: 48 DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101 +K T+ W + K N+ G+GFGYG+ A TT TLSARY+KDG+EI Sbjct: 225 PEKYTLGPGTWNTLVRHKANHAAKGQGFGYGMITPPFAGQTTRTLSARYHKDGAEI 280 >gi|332188292|ref|ZP_08390019.1| DNA-cytosine methyltransferase family protein [Sphingomonas sp. S17] gi|332011688|gb|EGI53766.1| DNA-cytosine methyltransferase family protein [Sphingomonas sp. S17] Length = 423 Score = 128 bits (324), Expect = 2e-28, Method: Composition-based stats. Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 28/120 (23%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD-------------------------- 41 VPQ R+R+ ++ F V F + L P + D Sbjct: 229 VPQHRQRILLVGF-QKDVGFDWEKVLAKMPAVADGPKLASILHREDGTEEEGEDDDRRFI 287 Query: 42 ILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + + + K ++++LW+ Q E ++ AG GFG + T+ TLSARYYKDGSEI Sbjct: 288 LADGKVQKKYVLTDRLWQYLQGYAEKHRQAGNGFGCSVVGPKD-TSRTLSARYYKDGSEI 346 >gi|261252209|ref|ZP_05944782.1| DNA-cytosine methyltransferase [Vibrio orientalis CIP 102891] gi|260935600|gb|EEX91589.1| DNA-cytosine methyltransferase [Vibrio orientalis CIP 102891] Length = 584 Score = 128 bits (322), Expect = 4e-28, Method: Composition-based stats. Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 11/105 (10%) Query: 8 VPQRRERLYIIDFLNP------SVEFKFPTPLGIKPRLGDIL---EEHIDDKSTISNKLW 58 +PQ RER+ ++ + + L DIL + K T++ LW Sbjct: 307 LPQHRERVVLVGVRKDLTIDKSKLSLNNIQKPTERVPLKDILCELSDEDSSKYTLTPNLW 366 Query: 59 EGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101 ++ G GFG+GL + + T TLSARY+KDGSEI Sbjct: 367 NYLYNYALKHQTQGNGFGFGLVDPSNINTVTRTLSARYHKDGSEI 411 >gi|225076313|ref|ZP_03719512.1| hypothetical protein NEIFLAOT_01354 [Neisseria flavescens NRL30031/H210] gi|224952437|gb|EEG33646.1| hypothetical protein NEIFLAOT_01354 [Neisseria flavescens NRL30031/H210] Length = 359 Score = 125 bits (315), Expect = 2e-27, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F + +F++P P+G+K DI E+ + K +S Sbjct: 181 INAKDFGVPQNRERIFIVGFHPDTKVNDFEYPKPIGLKTSFSDIREKETVPTKYYLSTVY 240 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 + +K KE ++ G GFGY + + N + Sbjct: 241 IDTLRKHKERHEAKGNGFGYEII-PDDGIANAI 272 >gi|169786848|ref|YP_001700742.1| modification methylase (cytosine-specific methyltransferase)(HpaIIM-like) [Acinetobacter baumannii SDF] gi|169150765|emb|CAP02959.1| modification methylase (Cytosine-specific methyltransferase)(HpaIIM-like) [Acinetobacter baumannii] Length = 366 Score = 122 bits (307), Expect = 2e-26, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 55/93 (59%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F + +F++PTP G K D+ EE+ + K +SN+ Sbjct: 186 INAKDFGVPQNRERIFIVGFHKDTGVHDFEYPTPTGKKVCFADVKEENVVPTKYYLSNQY 245 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 + ++ K +++ G GFGY + +++ N + Sbjct: 246 LQTLERHKAHHESKGNGFGYAII-PDNSIANAI 277 >gi|261400408|ref|ZP_05986533.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970] gi|269209852|gb|EEZ76307.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970] Length = 362 Score = 121 bits (305), Expect = 3e-26, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F + +FK+P P GI+ DI E+ + K +S + Sbjct: 180 VNAKDFGVPQNRERIFIVGFRGDTDIKDFKYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 239 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 + +K K+ ++ G GFGY + + N + Sbjct: 240 IDTLRKHKQRHEEKGNGFGYEIIS-DDGIANAI 271 >gi|313668796|ref|YP_004049080.1| C-5 cytosine-specific DNA-methylase [Neisseria lactamica ST-640] gi|313006258|emb|CBN87720.1| C-5 cytosine-specific DNA-methylase [Neisseria lactamica 020-06] Length = 362 Score = 121 bits (304), Expect = 4e-26, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F + +FK+P P GI+ DI E+ + K +S + Sbjct: 180 VNAKDFGVPQNRERIFIVGFRGDTDIKDFKYPEPTGIQTAFQDIREKDTVPTKYYLSTQY 239 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 + +K K+ ++ G GFGY + + N + Sbjct: 240 IDTLRKHKQRHEEKGNGFGYEIIS-DDGIANAI 271 >gi|330960632|gb|EGH60892.1| DNA cytosine methylase [Pseudomonas syringae pv. maculicola str. ES4326] Length = 178 Score = 121 bits (304), Expect = 4e-26, Method: Composition-based stats. Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 4/83 (4%) Query: 19 DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYG 78 F +E P +P GD+L++ +D K ++ LW+ + E ++ G GFG+G Sbjct: 4 GFTLRDIEKLIPKQ---RPSFGDLLDKEVDSKYILTPNLWDYLYRYAEKHRQKGNGFGFG 60 Query: 79 LFFENSATTNTLSARYYKDGSEI 101 L N TLSARY+KDGSEI Sbjct: 61 LTRPND-IARTLSARYHKDGSEI 82 >gi|159027151|emb|CAO86782.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 347 Score = 120 bits (302), Expect = 7e-26, Method: Composition-based stats. Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 3/86 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57 + A FGVPQ R R++I+ F F +P P + L DILEE + K +SN+ Sbjct: 145 LNARYFGVPQNRPRIFIVGFREDLNIYHFSYPQPTHPETCLKDILEEKEVSVKYYLSNQY 204 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN 83 E K K ++ G GFGY + + Sbjct: 205 LETLFKHKARHENKGNGFGYEIISPD 230 >gi|167854713|ref|ZP_02477492.1| cell division protein MukB [Haemophilus parasuis 29755] gi|167854127|gb|EDS25362.1| cell division protein MukB [Haemophilus parasuis 29755] Length = 361 Score = 120 bits (302), Expect = 8e-26, Method: Composition-based stats. Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F F +P PL K D+ E++ + K +S + Sbjct: 181 LNAKDFGVPQNRERIFIVGFRQDLAINSFYYPAPLNRKVCFNDVKEKNVVPTKYYLSTQY 240 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 E +K K ++ G GFGY + + N + Sbjct: 241 IETLRKHKARHQDKGNGFGYEII-PDDGIANAI 272 >gi|169334482|ref|ZP_02861675.1| hypothetical protein ANASTE_00885 [Anaerofustis stercorihominis DSM 17244] gi|169259199|gb|EDS73165.1| hypothetical protein ANASTE_00885 [Anaerofustis stercorihominis DSM 17244] Length = 337 Score = 120 bits (301), Expect = 9e-26, Method: Composition-based stats. Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 3/84 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + + +FGVPQ RER+YI+ F N +F FPTP+ ++ DI+EE + K +S+ Sbjct: 156 LNSRNFGVPQNRERIYIVAFRNDIAPKDFIFPTPIDENKKIKDIMEEKPVSPKYYLSDVY 215 Query: 58 WEGHQKRKENNKIAGKGFGYGLFF 81 E +K K ++ G GFGY + Sbjct: 216 LETLRKHKARHEAKGNGFGYEIRD 239 >gi|219870523|ref|YP_002474898.1| Type II modification methyltransferase HpaII/DNA (cytosine-5-)-methyltransferase [Haemophilus parasuis SH0165] gi|219690727|gb|ACL31950.1| Type II modification methyltransferase HpaII/DNA (cytosine-5-)-methyltransferase [Haemophilus parasuis SH0165] Length = 350 Score = 119 bits (300), Expect = 1e-25, Method: Composition-based stats. Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F F +P PL K D+ E++ + K +S + Sbjct: 170 LNAKDFGVPQNRERIFIVGFRQDLAINSFYYPAPLNRKVCFNDVKEKNVVPTKYYLSTQY 229 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 E +K K ++ G GFGY + + N + Sbjct: 230 IETLRKHKARHQDKGNGFGYEII-PDDGIANAI 261 >gi|27497145|gb|AAO17336.1| methylase [Neisseria lactamica] Length = 384 Score = 118 bits (298), Expect = 2e-25, Method: Composition-based stats. Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F + F++P P GI+ DI E+ + K +S + Sbjct: 202 VNAKDFGVPQNRERIFIVGFRGDTDIKYFEYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 261 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 + +K K+ ++ G GFGY + + N + Sbjct: 262 IDTLRKHKQRHEEKGNGFGYEIIS-DDGIANAI 293 >gi|213053049|ref|ZP_03345927.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] Length = 169 Score = 118 bits (298), Expect = 2e-25, Method: Composition-based stats. Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 2/71 (2%) Query: 33 LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTL 90 +P L ++LE ++ K ++ LW+ + + ++ G GFGYG+ + ++ TL Sbjct: 1 PPRRPTLAELLEPVVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTL 60 Query: 91 SARYYKDGSEI 101 SARYYKDG+EI Sbjct: 61 SARYYKDGAEI 71 >gi|213027601|ref|ZP_03342048.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] Length = 176 Score = 118 bits (297), Expect = 2e-25, Method: Composition-based stats. Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 2/71 (2%) Query: 33 LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTL 90 +P L ++LE ++ K ++ LW+ + + ++ G GFGYG+ + ++ TL Sbjct: 8 PPRRPTLAELLEPVVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTL 67 Query: 91 SARYYKDGSEI 101 SARYYKDG+EI Sbjct: 68 SARYYKDGAEI 78 >gi|166368121|ref|YP_001660394.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa NIES-843] gi|166090494|dbj|BAG05202.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa NIES-843] Length = 347 Score = 118 bits (297), Expect = 3e-25, Method: Composition-based stats. Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 3/86 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57 + A FGVPQ R R++I+ F F +P P + L DILEE + K +SN+ Sbjct: 145 LNARYFGVPQNRPRIFIVGFREDLNIYHFSYPQPTHQETCLKDILEEKEVSVKYYLSNQY 204 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN 83 E K K ++ G GFGY + + Sbjct: 205 LETLFKHKARHQHKGNGFGYEIISTD 230 >gi|309378773|emb|CBX22599.1| putative DNA cytosine methyltransferase [Neisseria lactamica Y92-1009] Length = 342 Score = 118 bits (296), Expect = 3e-25, Method: Composition-based stats. Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A DFGVPQ RER++I+ F + F++P P GI+ DI E+ + K +S + Sbjct: 160 VNAKDFGVPQNRERIFIVGFRGDTDIKYFEYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 219 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 + +K K+ ++ G GFGY + + N + Sbjct: 220 IDTLRKHKQRHEEKGNGFGYEIIS-DDGIANAI 251 >gi|290969050|ref|ZP_06560585.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1 str. 28L] gi|290781006|gb|EFD93599.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1 str. 28L] Length = 333 Score = 117 bits (295), Expect = 4e-25, Method: Composition-based stats. Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 3/87 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57 + + DFGVPQ RER+YI+ F F+FP + DI+EE K +S+ Sbjct: 147 LNSKDFGVPQNRERIYIVAFREDIAPNTFRFPEKTDDTKVIADIMEEKEPSSKYYLSDVY 206 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS 84 +K K+ ++ G GFGY + +S Sbjct: 207 LASLRKHKQRHQAKGNGFGYEIRGVHS 233 >gi|127459|sp|P15446|MTH2_HAEPA RecName: Full=Modification methylase HpaII; Short=M.HpaII; AltName: Full=Cytosine-specific methyltransferase HpaII gi|43630|emb|CAA35705.1| unnamed protein product [Haemophilus parainfluenzae] gi|305377|gb|AAA20481.1| HpaII modification methyltransferase [Haemophilus parainfluenzae] Length = 358 Score = 117 bits (295), Expect = 5e-25, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 47/93 (50%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A +FGVPQ RER+YI+ F + F +P PL DI EE + K +S + Sbjct: 176 VNAKNFGVPQNRERIYIVGFHKSTGVNSFSYPEPLDKIVTFADIREEKTVPTKYYLSTQY 235 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 + +K KE ++ G GFGY + + N + Sbjct: 236 IDTLRKHKERHESKGNGFGYEII-PDDGIANAI 267 >gi|167751356|ref|ZP_02423483.1| hypothetical protein EUBSIR_02342 [Eubacterium siraeum DSM 15702] gi|167655602|gb|EDR99731.1| hypothetical protein EUBSIR_02342 [Eubacterium siraeum DSM 15702] Length = 475 Score = 116 bits (293), Expect = 7e-25, Method: Composition-based stats. Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 3/87 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + + +FGVPQ RER+YI+ F N +F+FP R+ DI+EE+ + K +S+ Sbjct: 294 LNSKNFGVPQNRERIYIVAFRNDIAPEKFEFPQGNDDTKRIKDIIEENPVPAKYYLSDVY 353 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS 84 E ++ K ++ G GFGY + Sbjct: 354 LETLRRHKARHESKGNGFGYEVRGMED 380 >gi|149369548|ref|ZP_01889400.1| C-5 cytosine-specific DNA-methylase [unidentified eubacterium SCB49] gi|149356975|gb|EDM45530.1| C-5 cytosine-specific DNA-methylase [unidentified eubacterium SCB49] Length = 421 Score = 116 bits (292), Expect = 1e-24, Method: Composition-based stats. Identities = 30/91 (32%), Positives = 46/91 (50%), Gaps = 4/91 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57 + A FGVPQ RER++I+ F FK+P P + L +ILE E + K +S Sbjct: 241 LNAKKFGVPQNRERIFIVGFRKDLGINNFKYPEPTDTEAILENILEAEEVSVKYYLSEVY 300 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTN 88 + + + ++ G GFGY + N+ T N Sbjct: 301 LQTLRNHRARHESKGNGFGYEII-PNNGTAN 330 >gi|300813374|ref|ZP_07093725.1| Modification methylase HpaII [Peptoniphilus sp. oral taxon 836 str. F0141] gi|300512517|gb|EFK39666.1| Modification methylase HpaII [Peptoniphilus sp. oral taxon 836 str. F0141] Length = 347 Score = 115 bits (289), Expect = 2e-24, Method: Composition-based stats. Identities = 32/87 (36%), Positives = 45/87 (51%), Gaps = 3/87 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57 + + DFGVPQ RER+YI+ F +F FP + DI+EE K +S+ Sbjct: 147 INSKDFGVPQNRERIYIVAFREDISPNKFIFPEETDDTKVIADIMEEKETSPKYYLSDVY 206 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS 84 E +K K+ +K G GFGY + NS Sbjct: 207 LESLRKHKQRHKAKGNGFGYEIRDVNS 233 >gi|313892290|ref|ZP_07825883.1| modification methylase HpaII [Dialister microaerophilus UPII 345-E] gi|313119428|gb|EFR42627.1| modification methylase HpaII [Dialister microaerophilus UPII 345-E] Length = 329 Score = 114 bits (287), Expect = 4e-24, Method: Composition-based stats. Identities = 31/87 (35%), Positives = 43/87 (49%), Gaps = 3/87 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57 + + +FGVPQ RER+YI+ F N F FP + L DI+E E + + +S Sbjct: 147 LNSKNFGVPQNRERIYIVAFRNDISPENFDFPEGTDTEKTLKDIIEKEEVSSRYYLSETY 206 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENS 84 K KE K G GFGY + +S Sbjct: 207 LNSLIKHKERQKAKGNGFGYEIRQMDS 233 >gi|327403407|ref|YP_004344245.1| DNA-cytosine methyltransferase [Fluviicola taffensis DSM 16823] gi|327318915|gb|AEA43407.1| DNA-cytosine methyltransferase [Fluviicola taffensis DSM 16823] Length = 422 Score = 114 bits (287), Expect = 4e-24, Method: Composition-based stats. Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 4/91 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57 M A +FGVPQ RER++I+ F F++P P+ D+ EE + K +S Sbjct: 241 MNAKNFGVPQNRERIFIVGFRKDLNIDSFEYPLPVSKSVTFQDVREEKEVSVKYYLSETY 300 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTN 88 K KE + G GFG+ + + N Sbjct: 301 LNTLVKHKERHASKGNGFGFEII-PDDGIAN 330 >gi|326798326|ref|YP_004316145.1| DNA-cytosine methyltransferase [Sphingobacterium sp. 21] gi|326549090|gb|ADZ77475.1| DNA-cytosine methyltransferase [Sphingobacterium sp. 21] Length = 409 Score = 114 bits (286), Expect = 5e-24, Method: Composition-based stats. Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 4/91 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-EEHIDDKSTISNKL 57 + A +FGVPQ RER++I+ + F++P PL + DI EE + K +S + Sbjct: 229 VNAKNFGVPQNRERIFIVGYRKDLGIDRFEYPEPLDEPVAIEDIFEEEEVSVKYYLSTQY 288 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTN 88 + ++ K ++ G GFG+ + N N Sbjct: 289 LKTLKEHKARHESKGNGFGFEII-PNDGIAN 318 >gi|154484133|ref|ZP_02026581.1| hypothetical protein EUBVEN_01844 [Eubacterium ventriosum ATCC 27560] gi|149735175|gb|EDM51061.1| hypothetical protein EUBVEN_01844 [Eubacterium ventriosum ATCC 27560] Length = 366 Score = 114 bits (286), Expect = 5e-24, Method: Composition-based stats. Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 3/86 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57 + + DFGVPQ RER+YI+ F S F+FP + DI+EE + K +S Sbjct: 164 LNSKDFGVPQNRERIYIVAFRKDINSENFEFPVGNKPDTCIRDIMEEQEVSVKYYLSTTY 223 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN 83 E ++ K + G GFGY + + Sbjct: 224 IETLKRHKARHAAKGNGFGYEIRDLD 249 >gi|150026305|ref|YP_001297131.1| Type II modification methyltransferase HpaII [Flavobacterium psychrophilum JIP02/86] gi|149772846|emb|CAL44330.1| Type II modification methyltransferase HpaII [Flavobacterium psychrophilum JIP02/86] Length = 425 Score = 113 bits (284), Expect = 8e-24, Method: Composition-based stats. Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDD-KSTISNKL 57 + A +FGVPQ RER+YI+ F F++P PL P + E+ + K +S + Sbjct: 239 VNAKNFGVPQNRERIYIVGFRQDLNISSFEYPEPLENNPTFESVKEKLVPPTKYYLSTQY 298 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 + K + G GFGY + ++ N + Sbjct: 299 VQTLINHKARHASKGNGFGYAII-PDNGIANAI 330 >gi|291530358|emb|CBK95943.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3] Length = 696 Score = 113 bits (283), Expect = 1e-23, Method: Composition-based stats. Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 3/82 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + + +FGVPQ RER+YI+ F N F FP L DI E + + K +S+ Sbjct: 154 LNSKNFGVPQNRERIYIVAFRNDIAPDNFDFPESTDTNKCLLDIRERNPVPAKYYLSDVY 213 Query: 58 WEGHQKRKENNKIAGKGFGYGL 79 + +K K ++ G GFGY + Sbjct: 214 VDTLRKHKARHEAKGNGFGYEI 235 >gi|292670064|ref|ZP_06603490.1| modification methylase EcoRII [Selenomonas noxia ATCC 43541] gi|292648252|gb|EFF66224.1| modification methylase EcoRII [Selenomonas noxia ATCC 43541] Length = 377 Score = 111 bits (279), Expect = 3e-23, Method: Composition-based stats. Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 3/80 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57 + + DFGVPQ RER+YI+ F N S F FP + DI+E E + K +S Sbjct: 181 LNSKDFGVPQNRERIYIVAFRNDIDSTGFAFPEGHDSNTTIRDIMEAEEVSVKYYLSTVY 240 Query: 58 WEGHQKRKENNKIAGKGFGY 77 ++ K +++ G GFGY Sbjct: 241 LASLRRHKAHHEALGHGFGY 260 >gi|282859944|ref|ZP_06269032.1| DNA (cytosine-5-)-methyltransferase [Prevotella bivia JCVIHMP010] gi|282587347|gb|EFB92564.1| DNA (cytosine-5-)-methyltransferase [Prevotella bivia JCVIHMP010] Length = 448 Score = 109 bits (273), Expect = 2e-22, Method: Composition-based stats. Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 4/93 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57 + A +FGVPQ RER+YI+ F F +P P DI E + K +S Sbjct: 258 LNAANFGVPQHRERVYIVGFRKDLNIKAFNYPMPTDNSKTFADIKEATTVSSKYYLSTTY 317 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90 + K + G GFGY + ++ N + Sbjct: 318 LDTLIAHKARHAAKGHGFGYEIIS-DTGIANAI 349 >gi|313674544|ref|YP_004052540.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] gi|312941242|gb|ADR20432.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] Length = 420 Score = 108 bits (272), Expect = 2e-22, Method: Composition-based stats. Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 3/86 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57 + A D+GVPQ+RER++I+ F F++P P D+ EE + K +SN Sbjct: 242 INAKDYGVPQKRERIFIVGFRKDLKIETFEYPEPSKSPVSFEDVKEEEPVSVKYYLSNTY 301 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN 83 +K K + G GFGY + ++ Sbjct: 302 LNTLKKHKARHLGKGNGFGYAVIADD 327 >gi|255514225|gb|EET90487.1| DNA-cytosine methyltransferase [Candidatus Micrarchaeum acidiphilum ARMAN-2] Length = 328 Score = 108 bits (270), Expect = 4e-22, Method: Composition-based stats. Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 14/113 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---------GIKPRLGD----ILEEHI 47 + A ++GVPQ+R+R++ I E P+ G+KP + + + + Sbjct: 156 LNAANYGVPQKRQRIFFIGVNRRQAEKAILPPVPTHSEHPTNGLKPWVPSKQFLLPPQKV 215 Query: 48 DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 + S ++ G +RK+ N GFG+ F + S +NT+SARY+KDG+E Sbjct: 216 SKRFYYSERMINGFIRRKKKNAERNIGFGWQ-FLDFSKPSNTISARYWKDGAE 267 >gi|49476998|ref|YP_035184.1| modification methylase HpaII (cytosine-specific methyltransferase HpaII) [Bacillus thuringiensis serovar konkukian str. 97-27] gi|49328554|gb|AAT59200.1| modification methylase HpaII (Cytosine-specific methyltransferase HpaII) [Bacillus thuringiensis serovar konkukian str. 97-27] Length = 373 Score = 102 bits (255), Expect = 2e-20, Method: Composition-based stats. Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 14/106 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--------FKFPTPLGIKP---RLGDILEEHIDD 49 + + +FGVPQ R R+YI+ F F P K + D+LE+++ + Sbjct: 164 LNSRNFGVPQNRPRIYIVGFNQRLYRDKIESMPLFTLPKSRSRKKIYDSVRDVLEDNVGE 223 Query: 50 KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFE---NSATTNTLSA 92 K +S E +K KE G GFGY + + +N L A Sbjct: 224 KYYLSEGYLETLKKHKEAQGKKGNGFGYSIVNLPEIENPVSNALLA 269 >gi|254282099|ref|ZP_04957067.1| modification methylase SsoII [gamma proteobacterium NOR51-B] gi|219678302|gb|EED34651.1| modification methylase SsoII [gamma proteobacterium NOR51-B] Length = 356 Score = 96.5 bits (240), Expect = 1e-18, Method: Composition-based stats. Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 5/97 (5%) Query: 8 VPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 V QRR R +++ N F+FP L +L + D K T+S+K+W GH+ Sbjct: 192 VAQRRVRCFMVAVRNDIAANRGAFEFPKFPEGSIPLRSVLSKEPDPKYTLSDKMWAGHKA 251 Query: 64 RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 R N G GF L +NT+ ARY KD E Sbjct: 252 RTIRNVERGTGFT-ALEANLDKPSNTIVARYGKDAKE 287 >gi|113971536|ref|YP_735329.1| DNA-cytosine methyltransferase [Shewanella sp. MR-4] gi|113886220|gb|ABI40272.1| DNA-cytosine methyltransferase [Shewanella sp. MR-4] Length = 417 Score = 95.4 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 8/100 (8%) Query: 8 VPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEE---HIDDKSTISNKLWEG 60 V QRR R +++ FKFP G L D LEE + ++ TIS++LWEG Sbjct: 254 VAQRRVRCFMVCVREDVFQEFGAFKFPEFEGEPIPLRDALEELTAELMEEYTISDRLWEG 313 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100 H R + N G GF + N +NT+ ARY KDG E Sbjct: 314 HINRTQRNLDRGTGFTAHVADLNRP-SNTIVARYGKDGKE 352 >gi|323968854|gb|EGB64190.1| DNA-cytosine methyltransferase [Escherichia coli TA007] Length = 272 Score = 92.7 bits (230), Expect = 2e-17, Method: Composition-based stats. Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 4/57 (7%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 A DFGVPQ RER+YI+ F V F FPTPL K R+GDILE+ +D+K T+S+ Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSD 271 >gi|238917714|ref|YP_002931231.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC 27750] gi|238873074|gb|ACR72784.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC 27750] Length = 311 Score = 90.4 bits (224), Expect = 7e-17, Method: Composition-based stats. Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 5/75 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + + D+GVPQ R R YI+ F N + F+FP + L D+LE +DDK +S+++ Sbjct: 148 LNSADYGVPQTRNRTYIVCFDNQNARFEFPEKKKLNKTLQDLLEPEVDDKYFLSDRILPT 207 Query: 61 HQK-----RKENNKI 70 K ++I Sbjct: 208 ILSDGTGGYKAKSEI 222 >gi|119493789|ref|ZP_01624358.1| type II restriction enzyme HaeII [Lyngbya sp. PCC 8106] gi|119452484|gb|EAW33671.1| type II restriction enzyme HaeII [Lyngbya sp. PCC 8106] Length = 689 Score = 90.4 bits (224), Expect = 8e-17, Method: Composition-based stats. Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 6/86 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID-DKSTISNKLWE 59 + A DFG+PQ+RER YI+ FL ++ F FP P+ + L +ILE DKS +++ + Sbjct: 150 LNALDFGLPQKRERTYIVGFL-ENIHFSFPKPIQKRVSLSEILEPDEQVDKSLFASEFIQ 208 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSA 85 +K ++ K F ++ EN + Sbjct: 209 ----KKRIQRLKVKPFYPSIWHENKS 230 >gi|237742049|ref|ZP_04572530.1| modification methylase HpaII [Fusobacterium sp. 4_1_13] gi|229429697|gb|EEO39909.1| modification methylase HpaII [Fusobacterium sp. 4_1_13] Length = 385 Score = 87.7 bits (217), Expect = 5e-16, Method: Composition-based stats. Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 12/102 (11%) Query: 3 ACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLG------DILEEHIDDKSTI 53 A DFG+PQRR R YII F F + L D+LE D K + Sbjct: 170 AKDFGIPQRRLRTYIIGFRKDLLQDNNFILEPLPKNRTDLKIYKNLNDLLEFQNDIKYYV 229 Query: 54 SNKLWEGHQKRKENNKIAGKGFGYGLFFEN---SATTNTLSA 92 ++ + ++ K + + G GFG+ + + NT+ A Sbjct: 230 ASGYLKTLERHKLKHSLKGNGFGFEVVNAPNIKNPIANTILA 271 >gi|288559284|ref|YP_003422770.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1] gi|288541994|gb|ADC45878.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1] Length = 339 Score = 87.3 bits (216), Expect = 6e-16, Method: Composition-based stats. Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK--STISNKLW 58 + + D+GVPQ RER++I+ F + FKFP P K + D+LE+++ D S I++ Sbjct: 170 LNSKDYGVPQNRERIFIVGFKDNVNTFKFPLPFENKANINDLLEKNVKDHELSGIASDHL 229 Query: 59 EGHQKRKENNKIAGKGF 75 + H + NK K + Sbjct: 230 KKHYEEFLKNKKVNKNY 246 >gi|296114006|ref|YP_003627944.1| DNA-cytosine methyltransferase [Moraxella catarrhalis RH4] gi|295921700|gb|ADG62051.1| DNA-cytosine methyltransferase [Moraxella catarrhalis RH4] Length = 410 Score = 87.3 bits (216), Expect = 7e-16, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + D+G+PQ RER+++I F N P F+FP P+ ++ + D LE++ D K + K + Sbjct: 182 LNSKDYGIPQHRERIFVIGFKNKPKNGFEFPQPIELEYTMQDFLEDYTDSKYFLKEKGIK 241 Query: 60 GHQKRKENNK 69 K K Sbjct: 242 FVTSSKNRQK 251 >gi|326573696|gb|EGE23654.1| DNA-cytosine methyltransferase [Moraxella catarrhalis O35E] Length = 408 Score = 86.9 bits (215), Expect = 8e-16, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + D+G+PQ RER+++I F N P F+FP P+ ++ + D LE++ D K + K + Sbjct: 180 LNSKDYGIPQHRERIFVIGFKNKPKNGFEFPQPIELEYTMQDFLEDYTDSKYFLKEKGIK 239 Query: 60 GHQKRKENNK 69 K K Sbjct: 240 FVTSSKNRQK 249 >gi|282879499|ref|ZP_06288233.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS 5C-B1] gi|281306646|gb|EFA98672.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS 5C-B1] Length = 438 Score = 86.1 bits (213), Expect = 1e-15, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 4/70 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE- 59 + + D+G+PQ RER++ I F P V+F FP P+ ++ ++ D LE+++D K + K + Sbjct: 208 LNSKDYGIPQHRERIFCIGFHTP-VKFAFPAPIPLEYKMYDFLEDYVDTKYFLKEKGIKF 266 Query: 60 --GHQKRKEN 67 H+ + Sbjct: 267 VTSHKNHTKC 276 >gi|167746073|ref|ZP_02418200.1| hypothetical protein ANACAC_00768 [Anaerostipes caccae DSM 14662] gi|167654588|gb|EDR98717.1| hypothetical protein ANACAC_00768 [Anaerostipes caccae DSM 14662] Length = 312 Score = 85.0 bits (210), Expect = 3e-15, Method: Composition-based stats. Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 5/75 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + D+G+PQ R R YI+ F N + EF+FP + L D+LE +DDK +S ++ Sbjct: 148 LNTADYGIPQTRNRTYIVCFANDNAEFEFPDKQELNLTLQDLLETEVDDKYFLSERILPT 207 Query: 61 HQK-----RKENNKI 70 K ++I Sbjct: 208 ILSDGTGGYKAKSEI 222 >gi|255279955|ref|ZP_05344510.1| modification methylase EcoRII [Bryantella formatexigens DSM 14469] gi|255269728|gb|EET62933.1| modification methylase EcoRII [Bryantella formatexigens DSM 14469] Length = 311 Score = 84.6 bits (209), Expect = 5e-15, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 34/58 (58%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + + DFGVPQ R R Y++ F N EF FP ++ L D+LE+ + +K +S ++ Sbjct: 148 LNSADFGVPQTRNRTYLVCFSNQKAEFTFPQTEPLESTLQDLLEQDVAEKYFLSERII 205 >gi|170757755|ref|YP_001781752.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str. Okra] gi|169122967|gb|ACA46803.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str. Okra] Length = 561 Score = 84.2 bits (208), Expect = 5e-15, Method: Composition-based stats. Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 10/96 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + A D+G+PQ RER++I+ + F FP RL D LE +D+K IS K Sbjct: 149 LNAKDYGIPQNRERVFIVSIRKDIDTGIFSFPKGFDNGLRLKDFLENEVDEKYYISEKAT 208 Query: 59 EGHQKR-KENNKIAGKGFGYGLFFENSATTNTLSAR 93 +G + K + + ++S + TL R Sbjct: 209 QGLLRALKRPHTPK-------MLNKDSEYSPTLDTR 237 >gi|167747653|ref|ZP_02419780.1| hypothetical protein ANACAC_02374 [Anaerostipes caccae DSM 14662] gi|239625035|ref|ZP_04668066.1| modification methylase Rho11sI [Clostridiales bacterium 1_7_47_FAA] gi|167653015|gb|EDR97144.1| hypothetical protein ANACAC_02374 [Anaerostipes caccae DSM 14662] gi|239521421|gb|EEQ61287.1| modification methylase Rho11sI [Clostridiales bacterium 1_7_47FAA] Length = 504 Score = 84.2 bits (208), Expect = 5e-15, Method: Composition-based stats. Identities = 25/72 (34%), Positives = 42/72 (58%), Gaps = 6/72 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN--- 55 + A ++G+PQ RER+Y++ + +F FP P+ RL DILE+ +D+K +S+ Sbjct: 158 LNAKNYGIPQNRERVYLVLIKKECDNGKFVFPEPMENGRRLMDILEDEVDEKYYLSDDKV 217 Query: 56 -KLWEGHQKRKE 66 KL ++RK Sbjct: 218 QKLITDMKERKA 229 >gi|323152708|gb|EFZ38980.1| DNA-cytosine methyltransferase [Escherichia coli EPECa14] Length = 374 Score = 83.8 bits (207), Expect = 7e-15, Method: Composition-based stats. Identities = 14/70 (20%), Positives = 29/70 (41%), Gaps = 8/70 (11%) Query: 4 CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56 F +PQ RER+ ++ F N +F + L +L+ ++ K ++ Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327 Query: 57 LWEGHQKRKE 66 LW+ + + Sbjct: 328 LWKYLYRYAK 337 >gi|315608882|ref|ZP_07883855.1| modification methylase EcoRII [Prevotella buccae ATCC 33574] gi|315249409|gb|EFU29425.1| modification methylase EcoRII [Prevotella buccae ATCC 33574] Length = 312 Score = 83.8 bits (207), Expect = 7e-15, Method: Composition-based stats. Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 3/66 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI--KPRLGDILEEHIDDKSTISNKLW 58 + A DFG+PQ+RER+ I+ F + ++ F FPTP+ I + L DILE +D K + +K+ Sbjct: 147 LNALDFGIPQKRERIIIVGFKD-NILFSFPTPVPISQRKTLKDILEIDVDKKYYVKDKIR 205 Query: 59 EGHQKR 64 E R Sbjct: 206 ESRLMR 211 >gi|254443346|ref|ZP_05056822.1| C-5 cytosine-specific DNA methylase superfamily [Verrucomicrobiae bacterium DG1235] gi|198257654|gb|EDY81962.1| C-5 cytosine-specific DNA methylase superfamily [Verrucomicrobiae bacterium DG1235] Length = 349 Score = 83.0 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 3/86 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57 +KA DFG+ Q+RER++I+ F F +P + ++ DILE H + ++ K Sbjct: 176 LKASDFGLAQKRERVFIVGFRKSLGVEGFSYPEKGNDRSKISDILEPSHSVGQWLLTKKS 235 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFEN 83 + K+AG G GY + EN Sbjct: 236 LACLRDHSSKQKLAGNGHGYAILDEN 261 >gi|16923911|gb|AAL31632.1|AF438204_2 C5 DNA methyltransferase [Positive selection vector pMTet1] Length = 418 Score = 82.7 bits (204), Expect = 1e-14, Method: Composition-based stats. Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 9/97 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A FG+PQ+R+R Y++ FLN ++ F+FP P I +G++LE + +IS L + Sbjct: 246 LDASHFGIPQKRKRFYLVAFLNQNIHFEFPKPPMISKDIGEVLESDVTG-YSISEHLQKS 304 Query: 61 HQKRKENNKIAGKGFGYGLFFEN-SATTNTLSARYYK 96 + +K++ K L +N + TL + Y+K Sbjct: 305 YLFKKDDGK-------PSLIDKNTTGAVKTLVSTYHK 334 >gi|127464|sp|P11408|MTM1_MORSP RecName: Full=Modification methylase MspI; Short=M.MspI; AltName: Full=Cytosine-specific methyltransferase MspI gi|44539|emb|CAA32393.1| unnamed protein product [Moraxella sp.] Length = 418 Score = 82.7 bits (204), Expect = 1e-14, Method: Composition-based stats. Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 9/97 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A FG+PQ+R+R Y++ FLN ++ F+FP P I +G++LE + +IS L + Sbjct: 246 LDASHFGIPQKRKRFYLVAFLNQNIHFEFPKPPMISKDIGEVLESDVTG-YSISEHLQKS 304 Query: 61 HQKRKENNKIAGKGFGYGLFFEN-SATTNTLSARYYK 96 + +K++ K L +N + TL + Y+K Sbjct: 305 YLFKKDDGK-------PSLIDKNTTGAVKTLVSTYHK 334 >gi|159026805|emb|CAO86650.1| ngoBIM [Microcystis aeruginosa PCC 7806] Length = 331 Score = 82.7 bits (204), Expect = 2e-14, Method: Composition-based stats. Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +FG+PQ+RER++I+ F F +P P + L +ILEE++ D S K+ + Sbjct: 156 LNALNFGLPQKRERIFIVGFREAR-GFIWPKPALSRTSLTEILEENVSDFYYASEKIQKS 214 Query: 61 HQKRKENNK 69 ++E K Sbjct: 215 RLLKREGKK 223 >gi|281420730|ref|ZP_06251729.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205] gi|281405022|gb|EFB35702.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205] Length = 432 Score = 82.7 bits (204), Expect = 2e-14, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + +CD+G+PQ RER++ + F P+ +FK+P P+ ++ ++ D LE++ID K + K + Sbjct: 203 LNSCDYGIPQHRERVFCLGFKKPT-DFKYPAPIKLEYKMYDFLEDYIDTKYFLKEKGIKF 261 Query: 61 HQKRKENNKI 70 K K Sbjct: 262 VTSHKNREKS 271 >gi|317497298|ref|ZP_07955621.1| C-5 cytosine-specific DNA methylase [Lachnospiraceae bacterium 5_1_63FAA] gi|316895367|gb|EFV17526.1| C-5 cytosine-specific DNA methylase [Lachnospiraceae bacterium 5_1_63FAA] Length = 363 Score = 82.7 bits (204), Expect = 2e-14, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 36/56 (64%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A D+GVPQ RER++ I LN +F+FP +K +L DILE+++D K + N Sbjct: 204 LNARDYGVPQNRERVFCISELNGENKFEFPKSRELKLKLYDILEKNVDSKYYLKNN 259 >gi|291087089|ref|ZP_06345376.2| modification methylase HpaII [Clostridium sp. M62/1] gi|291076158|gb|EFE13522.1| modification methylase HpaII [Clostridium sp. M62/1] Length = 490 Score = 82.3 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 23/103 (22%), Positives = 40/103 (38%), Gaps = 12/103 (11%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR---------LGDILEEHIDDKST 52 +FG+PQ R R+YI+ F P + DIL+ + ++ Sbjct: 182 NTRNFGLPQNRPRVYIVAFSRNYFGEHLKLIPERTPEKSEKVIFKSVRDILDVDVSERFF 241 Query: 53 ISNKLWEGHQKRKENNKIAGKGFGYGLFFENS---ATTNTLSA 92 +S+ L + ++ K K G GFG + +T+ A Sbjct: 242 LSSGLLKTLEEHKARQKRNGNGFGCRIANATEIECPIASTILA 284 >gi|306828113|ref|ZP_07461376.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pyogenes ATCC 10782] gi|304429650|gb|EFM32696.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pyogenes ATCC 10782] Length = 214 Score = 82.3 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 32/55 (58%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + A D+GVPQ RER++ + L + FP + RL D+LEE +D+K +S Sbjct: 150 LNAKDYGVPQNRERVFCVSILGDHEPYIFPEKQELTIRLKDVLEEDVDEKYYLSE 204 >gi|288576182|ref|ZP_05978340.2| DNA (cytosine-5-)-methyltransferase [Neisseria mucosa ATCC 25996] gi|288566126|gb|EFC87686.1| DNA (cytosine-5-)-methyltransferase [Neisseria mucosa ATCC 25996] Length = 406 Score = 81.9 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P+ F+FP + ++ + D LE++ D K + K Sbjct: 179 MNSKDYGIPQHRERIFVVGFHTPPTNGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 235 >gi|319956919|ref|YP_004168182.1| DNA-cytosine methyltransferase [Nitratifractor salsuginis DSM 16511] gi|319419323|gb|ADV46433.1| DNA-cytosine methyltransferase [Nitratifractor salsuginis DSM 16511] Length = 394 Score = 81.9 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 8/76 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + +G+PQ RER +++ F + + F+FP + +K L D+LE +D+K +++K Sbjct: 145 LNTKHYGLPQNRERYFLVGFKSKTAGERFRFPKKVPLKLILSDVLENKVDEKYYLTDKAL 204 Query: 59 EGHQKRKENNKIAGKG 74 E N+ G G Sbjct: 205 EYM------NRDTGDG 214 >gi|145629543|ref|ZP_01785341.1| modification methylase HaeII [Haemophilus influenzae 22.1-21] gi|144978386|gb|EDJ88150.1| modification methylase HaeII [Haemophilus influenzae 22.1-21] Length = 219 Score = 81.5 bits (201), Expect = 3e-14, Method: Composition-based stats. Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 10/94 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58 + DFG+PQ+RER+YI+ FL+ + F+FP P+G L +ILE + + +S++L Sbjct: 45 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL- 102 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 KRK + I ++ EN + +SA Sbjct: 103 ----KRKRLSSITKDVPYPSIWHEN--ISGNVSA 130 >gi|56461628|ref|YP_156909.1| DNA cytosine methylase [Idiomarina loihiensis L2TR] gi|56180638|gb|AAV83360.1| DNA cytosine methylase [Idiomarina loihiensis L2TR] Length = 419 Score = 81.5 bits (201), Expect = 3e-14, Method: Composition-based stats. Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 9/97 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFGVPQ R+R Y++ F F FP P IK +G +LE+ + +IS L + Sbjct: 240 LNASDFGVPQNRKRFYLVAFDGKDCGFSFPQPPMIKADIGTLLEKG-AEGYSISEHLQKT 298 Query: 61 HQKRKENNKIAGKGFGYGLFFEN-SATTNTLSARYYK 96 + +K++ + L N TL + Y+K Sbjct: 299 YLFKKDDGR-------PILIDRNTKGPMRTLVSSYHK 328 >gi|161869767|ref|YP_001598934.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442] gi|161595320|gb|ABX72980.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442] Length = 411 Score = 81.5 bits (201), Expect = 3e-14, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|218767941|ref|YP_002342453.1| putative modification methylase [Neisseria meningitidis Z2491] gi|6900408|emb|CAB72018.1| putative cytosine-specific methyltransferase [Neisseria meningitidis] gi|121051949|emb|CAM08255.1| putative modification methylase [Neisseria meningitidis Z2491] Length = 411 Score = 81.5 bits (201), Expect = 3e-14, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|148826843|ref|YP_001291596.1| modification methylase HaeII [Haemophilus influenzae PittGG] gi|148718085|gb|ABQ99212.1| modification methylase HaeII [Haemophilus influenzae PittGG] Length = 318 Score = 81.5 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 10/94 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58 + DFG+PQ+RER+YI+ FL+ + F+FP P+G L +ILE + + +S++L Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL- 201 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 KRK + I ++ EN + +SA Sbjct: 202 ----KRKRLSSITKDVPYPSIWHEN--ISGNVSA 229 >gi|319776347|ref|YP_004138835.1| Cytosine-specific methyltransferase [Haemophilus influenzae F3047] gi|329123500|ref|ZP_08252064.1| modification methylase HaeII [Haemophilus aegyptius ATCC 11116] gi|317450938|emb|CBY87164.1| Cytosine-specific methyltransferase [Haemophilus influenzae F3047] gi|327471082|gb|EGF16537.1| modification methylase HaeII [Haemophilus aegyptius ATCC 11116] Length = 318 Score = 81.5 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 10/94 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58 + DFG+PQ+RER+YI+ FL+ + F+FP P+G L +ILE + + +S++L Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL- 201 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 KRK + I ++ EN + +SA Sbjct: 202 ----KRKRLSSITKDVPYPSIWHEN--ISGNVSA 229 >gi|325127899|gb|EGC50802.1| DNA-cytosine methyltransferase [Neisseria meningitidis N1568] Length = 411 Score = 81.5 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|304387865|ref|ZP_07370039.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC 13091] gi|254670653|emb|CBA06706.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha153] gi|254672637|emb|CBA06420.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha275] gi|261392815|emb|CAX50396.1| putative type II restriction-modification system enzyme Mod [Neisseria meningitidis 8013] gi|304338130|gb|EFM04266.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC 13091] gi|319410190|emb|CBY90526.1| putative type II restriction-modification system enzyme Mod [Neisseria meningitidis WUE 2594] gi|325134031|gb|EGC56686.1| DNA-cytosine methyltransferase [Neisseria meningitidis M13399] gi|325203903|gb|ADY99356.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240355] Length = 411 Score = 81.5 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|15676724|ref|NP_273868.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis MC58] gi|7226061|gb|AAF41239.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis MC58] gi|308389005|gb|ADO31325.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha710] gi|316984499|gb|EFV63467.1| modification methylase HpaII [Neisseria meningitidis H44/76] gi|325129944|gb|EGC52743.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304] gi|325140023|gb|EGC62552.1| DNA-cytosine methyltransferase [Neisseria meningitidis CU385] gi|325206334|gb|ADZ01787.1| DNA-cytosine methyltransferase [Neisseria meningitidis M04-240196] Length = 411 Score = 81.5 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|121634611|ref|YP_974856.1| putative modification methylase [Neisseria meningitidis FAM18] gi|4887086|gb|AAD32180.1|AF125564_2 putative site specific DNA methyltransferase [Neisseria meningitidis] gi|120866317|emb|CAM10058.1| putative modification methylase [Neisseria meningitidis FAM18] gi|325132026|gb|EGC54724.1| DNA-cytosine methyltransferase [Neisseria meningitidis M6190] gi|325135954|gb|EGC58564.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579] gi|325137780|gb|EGC60355.1| DNA-cytosine methyltransferase [Neisseria meningitidis ES14902] gi|325142075|gb|EGC64502.1| DNA-cytosine methyltransferase [Neisseria meningitidis 961-5945] gi|325198036|gb|ADY93492.1| DNA-cytosine methyltransferase [Neisseria meningitidis G2136] gi|325202381|gb|ADY97835.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149] gi|325207867|gb|ADZ03319.1| DNA-cytosine methyltransferase [Neisseria meningitidis NZ-05/33] Length = 411 Score = 81.5 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240 >gi|12229852|sp|O30868|MTH2_HAEAE RecName: Full=Modification methylase HaeII; Short=M.HaeII; AltName: Full=Cytosine-specific methyltransferase HaeII gi|2425087|gb|AAB70829.1| HaeII methylase [Haemophilus aegyptius ATCC 11116] Length = 318 Score = 81.5 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 10/94 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58 + DFG+PQ+RER+YI+ FL+ + F+FP P+G L +ILE + + +S++L Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL- 201 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 KRK + I ++ EN + +SA Sbjct: 202 ----KRKRLSSITKDVPYPSIWHEN--ISGNVSA 229 >gi|68250112|ref|YP_249224.1| modification methylase HaeII [Haemophilus influenzae 86-028NP] gi|68058311|gb|AAX88564.1| modification methylase HaeII [Haemophilus influenzae 86-028NP] Length = 318 Score = 81.5 bits (201), Expect = 4e-14, Method: Composition-based stats. Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 10/94 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58 + DFG+PQ+RER+YI+ FL+ + F+FP P+G L +ILE + + +S++L Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL- 201 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 KRK + I ++ EN + +SA Sbjct: 202 ----KRKRLSSITKDVPYPSIWHEN--ISGNVSA 229 >gi|462658|sp|P34878|MTSB_LACLC RecName: Full=Modification methylase ScrFIB; Short=M.ScrFI-B; Short=M.ScrFIB; AltName: Full=Cytosine-specific methyltransferase ScrFIB gi|149495|gb|AAA16838.1| methyl-5-cytosine methylase [Lactococcus lactis] gi|2327032|gb|AAB66694.1| 5-methyl-cytosine-methyltransferase [Lactococcus lactis subsp. cremoris] gi|739995|prf||2004282A methyl-5-cytosine methyltransferase Length = 360 Score = 81.1 bits (200), Expect = 4e-14, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 35/56 (62%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A DFG+PQ RER++ I LNP+ +F FP + + D+LEE++ +K + N Sbjct: 201 LNARDFGIPQNRERVFCISILNPNEDFTFPQKQNLTLSMNDLLEENVSEKFYLKNN 256 >gi|325144138|gb|EGC66445.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240013] gi|325200491|gb|ADY95946.1| DNA-cytosine methyltransferase [Neisseria meningitidis H44/76] Length = 406 Score = 81.1 bits (200), Expect = 4e-14, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 179 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 235 >gi|313668701|ref|YP_004048985.1| modification methylase [Neisseria lactamica ST-640] gi|313006163|emb|CBN87625.1| putative modification methylase [Neisseria lactamica 020-06] Length = 372 Score = 81.1 bits (200), Expect = 4e-14, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 M + D+G+PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 145 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 201 >gi|166367724|ref|YP_001659997.1| modification methylase NgoBI [Microcystis aeruginosa NIES-843] gi|166090097|dbj|BAG04805.1| modification methylase NgoBI [Microcystis aeruginosa NIES-843] Length = 330 Score = 80.7 bits (199), Expect = 6e-14, Method: Composition-based stats. Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 11/82 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +FG+PQ+RER++I+ F F +P P + L +ILEE++ D S ++ + Sbjct: 156 LNALNFGLPQKRERIFIVGFREAR-GFIWPKPALSRTTLTEILEENVSDFYYASARIQKS 214 Query: 61 --HQKRKEN--------NKIAG 72 ++ + ++ G Sbjct: 215 RFLKREGKKPYSEPTIWHENKG 236 >gi|170719133|ref|YP_001784281.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336] gi|168827262|gb|ACA32633.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336] Length = 408 Score = 80.7 bits (199), Expect = 7e-14, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 M + ++G+PQ RER++++ F +P F+FPT + ++ + D LE++ D K + K + Sbjct: 180 MNSKNYGIPQHRERIFVVGFKTSPKGGFQFPTKIPLERTMQDFLEDYTDSKYFLKEKGIK 239 Query: 60 GHQKRKENNK 69 K K Sbjct: 240 FVTSSKNRQK 249 >gi|296313699|ref|ZP_06863640.1| modification methylase NgoBI [Neisseria polysaccharea ATCC 43768] gi|296839717|gb|EFH23655.1| modification methylase NgoBI [Neisseria polysaccharea ATCC 43768] Length = 315 Score = 79.6 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 8/85 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58 + DFG+PQ+RER+YI+ F + ++ F FP P+ LGD+LE ++ +S+ L Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGDLLENDRDVEPSYFLSDAL- 199 Query: 59 EGHQKRKENNKIAGKGFGYGLFFEN 83 K+K + ++ EN Sbjct: 200 ----KQKRLAALKKAPPTPSIWHEN 220 >gi|148826164|ref|YP_001290917.1| modification methylase [Haemophilus influenzae PittEE] gi|148716324|gb|ABQ98534.1| modification methylase [Haemophilus influenzae PittEE] gi|162532590|gb|ABY16693.1| probable methylase [Haemophilus influenzae] gi|309973308|gb|ADO96509.1| Probable cytosine-specific DNA methyltransferase [Haemophilus influenzae R2846] Length = 409 Score = 79.2 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 M + ++G+PQ RER++++ F P F FP + ++ + D LE++ D K + K + Sbjct: 181 MNSKNYGIPQHRERIFVVGFKTPPQGGFMFPAEIPLEHSMQDFLEDYTDSKYYLKEKGIK 240 Query: 60 GHQKRKENNK 69 K K Sbjct: 241 FVTSSKNRQK 250 >gi|268595734|ref|ZP_06129901.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae 35/02] gi|291044897|ref|ZP_06570606.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|293397972|ref|ZP_06642178.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|268549123|gb|EEZ44541.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae 35/02] gi|291011791|gb|EFE03787.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|291611918|gb|EFF40987.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] Length = 320 Score = 79.2 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE ++ +S+ L Sbjct: 147 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 204 Query: 59 EGHQKRKENNKIAGKGFGYGLFFEN 83 K+K + ++ EN Sbjct: 205 ----KQKRLAALKKAPPTPSIWHEN 225 >gi|239999928|ref|ZP_04719852.1| NgoIM [Neisseria gonorrhoeae 35/02] gi|240116859|ref|ZP_04730921.1| NgoIM [Neisseria gonorrhoeae PID1] gi|240127204|ref|ZP_04739865.1| NgoIM [Neisseria gonorrhoeae SK-93-1035] Length = 278 Score = 79.2 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE ++ +S+ L Sbjct: 105 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 162 Query: 59 EGHQKRKENNKIAGKGFGYGLFFEN 83 K+K + ++ EN Sbjct: 163 ----KQKRLAALKKAPPTPSIWHEN 183 >gi|268597921|ref|ZP_06132088.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA19] gi|268551709|gb|EEZ46728.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA19] Length = 320 Score = 79.2 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE ++ +S+ L Sbjct: 147 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 204 Query: 59 EGHQKRKENNKIAGKGFGYGLFFEN 83 K+K + ++ EN Sbjct: 205 ----KQKRLAALKKAPPTPSIWHEN 225 >gi|194099739|ref|YP_002002874.1| NgoIM [Neisseria gonorrhoeae NCCP11945] gi|240013125|ref|ZP_04720038.1| NgoIM [Neisseria gonorrhoeae DGI18] gi|240015568|ref|ZP_04722108.1| NgoIM [Neisseria gonorrhoeae FA6140] gi|240114103|ref|ZP_04728593.1| NgoIM [Neisseria gonorrhoeae MS11] gi|240114658|ref|ZP_04728720.1| NgoIM [Neisseria gonorrhoeae PID18] gi|240120196|ref|ZP_04733158.1| NgoIM [Neisseria gonorrhoeae PID24-1] gi|240122493|ref|ZP_04735449.1| NgoIM [Neisseria gonorrhoeae PID332] gi|240126658|ref|ZP_04739544.1| NgoIM [Neisseria gonorrhoeae SK-92-679] gi|254492718|ref|ZP_05105889.1| modification methylase NgoBI [Neisseria gonorrhoeae 1291] gi|260441536|ref|ZP_05795352.1| NgoIM [Neisseria gonorrhoeae DGI2] gi|268600171|ref|ZP_06134338.1| modification methylase NgoBI [Neisseria gonorrhoeae MS11] gi|268600304|ref|ZP_06134471.1| modification methylase NgoBI [Neisseria gonorrhoeae PID18] gi|268602536|ref|ZP_06136703.1| modification methylase NgoBI [Neisseria gonorrhoeae PID1] gi|268681085|ref|ZP_06147947.1| modification methylase NgoBI [Neisseria gonorrhoeae PID332] gi|268685237|ref|ZP_06152099.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-92-679] gi|268685565|ref|ZP_06152427.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-93-1035] gi|193935029|gb|ACF30853.1| NgoIM [Neisseria gonorrhoeae NCCP11945] gi|226511758|gb|EEH61103.1| modification methylase NgoBI [Neisseria gonorrhoeae 1291] gi|268584302|gb|EEZ48978.1| modification methylase NgoBI [Neisseria gonorrhoeae MS11] gi|268584435|gb|EEZ49111.1| modification methylase NgoBI [Neisseria gonorrhoeae PID18] gi|268586667|gb|EEZ51343.1| modification methylase NgoBI [Neisseria gonorrhoeae PID1] gi|268621369|gb|EEZ53769.1| modification methylase NgoBI [Neisseria gonorrhoeae PID332] gi|268625521|gb|EEZ57921.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-92-679] gi|268625849|gb|EEZ58249.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-93-1035] gi|317165226|gb|ADV08767.1| NgoIM [Neisseria gonorrhoeae TCDC-NG08107] Length = 315 Score = 78.8 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE ++ +S+ L Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 199 Query: 59 EGHQKRKENNKIAGKGFGYGLFFEN 83 K+K + ++ EN Sbjct: 200 ----KQKRLAALKKAPPTPSIWHEN 220 >gi|59802299|ref|YP_209011.1| NgoIM [Neisseria gonorrhoeae FA 1090] gi|240081825|ref|ZP_04726368.1| NgoIM [Neisseria gonorrhoeae FA19] gi|59719194|gb|AAW90599.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA 1090] Length = 315 Score = 78.8 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE ++ +S+ L Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 199 Query: 59 EGHQKRKENNKIAGKGFGYGLFFEN 83 K+K + ++ EN Sbjct: 200 ----KQKRLAALKKAPPTPSIWHEN 220 >gi|197303495|ref|ZP_03168534.1| hypothetical protein RUMLAC_02217 [Ruminococcus lactaris ATCC 29176] gi|197297493|gb|EDY32054.1| hypothetical protein RUMLAC_02217 [Ruminococcus lactaris ATCC 29176] Length = 496 Score = 78.4 bits (193), Expect = 3e-13, Method: Composition-based stats. Identities = 25/103 (24%), Positives = 44/103 (42%), Gaps = 12/103 (11%) Query: 2 KACDFGVPQRRERLYIIDFLNP---------SVEFKFPTPLGIKPRLGDILEEHIDDKST 52 +FG+PQ R R+YI+ F + + I + ++L+ ++DDK Sbjct: 165 NTREFGLPQNRPRVYIMAFSKKIYGNAIKLLNAQLPISRDETIFRDVTEVLDTNVDDKYY 224 Query: 53 ISNKLWEGHQKRKENNKIAGKGFGYGLF---FENSATTNTLSA 92 ++ E ++ K K G GFGY + E+ T+ A Sbjct: 225 MAEGYLETLKRHKARQKKNGYGFGYCVVNKSNEDHPIAYTILA 267 >gi|12229862|sp|Q59603|MTB1_NEIGO RecName: Full=Modification methylase NgoBI; Short=M.NgoBI; AltName: Full=Cytosine-specific methyltransferase NgoBI; Short=M.NgoI gi|5924404|gb|AAB03206.2| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae] Length = 317 Score = 78.0 bits (192), Expect = 4e-13, Method: Composition-based stats. Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58 + DFG+PQ+RER+YI+ F + ++ F FP P+ LG++LE ++ +S+ L Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 199 Query: 59 EGHQKRKENNKIAGKGFGYGLFFEN 83 K+K + ++ EN Sbjct: 200 ----KQKRLAALKKAPPTPSIWHEN 220 >gi|291165856|gb|EFE27903.1| modification methylase EcoRII [Filifactor alocis ATCC 35896] Length = 375 Score = 77.6 bits (191), Expect = 5e-13, Method: Composition-based stats. Identities = 26/104 (25%), Positives = 41/104 (39%), Gaps = 13/104 (12%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFK--------FPTPLG--IKPRLGDILEEHIDDKS 51 + +FG+PQ R R YI+ F PT + L +LE + K Sbjct: 165 NSRNFGIPQNRPRTYIMAFNRQLYGADTLLGIGNLLPTEKNRYLYEDLNSLLEFRAEPKY 224 Query: 52 TISNKLWEGHQKRKENNKIAGKGFGYGLFFE---NSATTNTLSA 92 +S+ + + +E + G GFGY + E NT+ A Sbjct: 225 YMSSGYFNTLVRHRERERKKGNGFGYRVVNEPGIEHPVANTIMA 268 >gi|219855710|ref|YP_002472832.1| hypothetical protein CKR_2367 [Clostridium kluyveri NBRC 12016] gi|219569434|dbj|BAH07418.1| hypothetical protein [Clostridium kluyveri NBRC 12016] Length = 419 Score = 76.9 bits (189), Expect = 8e-13, Method: Composition-based stats. Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 12/100 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKL 57 M A +FG+PQRRER+ I+ F +F FP K + ILE + +IS +L Sbjct: 245 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTG-YSISKRL 303 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96 E + +K++ K + +S NTL A Y+K Sbjct: 304 QESYLFKKDDGK-------PQIVDFDSTIQVNTLVASYHK 336 >gi|153955289|ref|YP_001396054.1| DNA methylase [Clostridium kluyveri DSM 555] gi|146348147|gb|EDK34683.1| Predicted DNA methylase [Clostridium kluyveri DSM 555] Length = 416 Score = 76.5 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 12/100 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKL 57 M A +FG+PQRRER+ I+ F +F FP K + ILE + +IS +L Sbjct: 242 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTG-YSISKRL 300 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96 E + +K++ K + +S NTL A Y+K Sbjct: 301 QESYLFKKDDGK-------PQIVDFDSTIQVNTLVASYHK 333 >gi|220930232|ref|YP_002507141.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10] gi|220000560|gb|ACL77161.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10] Length = 416 Score = 76.5 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 12/100 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKL 57 M A +FG+PQRRER+ I+ F +F FP K + ILE + +IS +L Sbjct: 242 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTG-YSISKRL 300 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96 E + +K++ K + +S NTL A Y+K Sbjct: 301 QESYLFKKDDGK-------PQIVDFDSTIQVNTLVASYHK 333 >gi|254804105|ref|YP_003082326.1| putative type II DNA modification methyltransferase [Neisseria meningitidis alpha14] gi|254667647|emb|CBA03458.1| putative type II DNA modification methyltransferase [Neisseria meningitidis alpha14] Length = 315 Score = 76.5 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 8/85 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58 + DFG+PQ+RER+YII F + ++ F FP P+ LG++LE ++ +S+ L Sbjct: 142 LNTLDFGLPQKRERIYIIGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDAL- 199 Query: 59 EGHQKRKENNKIAGKGFGYGLFFEN 83 K+K + ++ EN Sbjct: 200 ----KQKRLAALKKAPPTPSIWHEN 220 >gi|307152213|ref|YP_003887597.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822] gi|306982441|gb|ADN14322.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822] Length = 317 Score = 76.1 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 7/92 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ+RER++I+ L P + F++P P+ L +ILE + S ++ Sbjct: 159 LNALDFGLPQKRERIFIVGCLEP-IPFEWPMPVRTIKPLKEILETTVAASYYASEQI--- 214 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 R + ++ EN +SA Sbjct: 215 RLNRLAKYQGKNDN-EPTIWHENK--AGHISA 243 >gi|154173655|ref|YP_001409100.1| cytosine-specific methyltransferase NlaX [Campylobacter curvus 525.92] gi|112802981|gb|EAU00325.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Campylobacter curvus 525.92] Length = 352 Score = 75.7 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Query: 1 MKACDFGVPQRRERLYIIDFL--NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + D+G+ Q RER+YI+ FL + + F F + + + D L++ +D+K ++ Sbjct: 152 LNTKDYGIAQNRERIYIVGFLDFDEYLNFDFAPRVPLTTAIRDYLDDEVDEKYYLNEN 209 >gi|331091171|ref|ZP_08340013.1| hypothetical protein HMPREF9477_00656 [Lachnospiraceae bacterium 2_1_46FAA] gi|330405393|gb|EGG84929.1| hypothetical protein HMPREF9477_00656 [Lachnospiraceae bacterium 2_1_46FAA] Length = 375 Score = 75.3 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 24/104 (23%), Positives = 41/104 (39%), Gaps = 13/104 (12%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG----------IKPRLGDILEEHIDDKS 51 + +FG+PQ R R YI+ F + + L ++LE H + K Sbjct: 165 NSRNFGIPQNRPRTYIMAFNRQRYGAAALAGIENCLPIENDWYLYEDLNELLEFHAEAKY 224 Query: 52 TISNKLWEGHQKRKENNKIAGKGFGYGLFFE---NSATTNTLSA 92 +++ + + +E G GFGY + E NT+ A Sbjct: 225 YMASGYLDTLIRHREREHGKGNGFGYRIVNEPGIEHPVANTIMA 268 >gi|254303554|ref|ZP_04970912.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] gi|148323746|gb|EDK88996.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] Length = 492 Score = 74.2 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + + D+G+PQ RER++++ F +F+FP P ++ + D L +++ K + K Sbjct: 265 LNSKDYGIPQNRERVFVVGFRKDLKLKKKFEFPRPFLLEKTMQDFLLDNVAGKYYLQEK 323 >gi|153870185|ref|ZP_01999636.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS] gi|152073352|gb|EDN70367.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS] Length = 235 Score = 74.2 bits (182), Expect = 6e-12, Method: Composition-based stats. Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 4/71 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + + DFG+PQ+RER I+ F ++ F FP PLGIKP L ILE+ D N L Sbjct: 144 LNSLDFGIPQKRERTIIVGF-QENIAFSFPKPLGIKPDLTKILEK---DSEVEKNILLLM 199 Query: 61 HQKRKENNKIA 71 K++E K+ Sbjct: 200 SLKKRECKKLN 210 >gi|291561285|emb|CBL40084.1| DNA-methyltransferase (dcm) [butyrate-producing bacterium SS3/4] Length = 247 Score = 73.4 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + + D+GVPQ RER++I+ + F+FP + ++ +GD+L+E + + +S + Sbjct: 153 LNSADYGVPQGRERVFIVSIRKDVDDHSFRFPPVIPLEMCMGDLLDEEVPAEFYLSEEKT 212 Query: 59 EGHQKRKENN 68 + + N+ Sbjct: 213 QSVIRHDSNH 222 >gi|127427|sp|P17044|MTBF_BACSU RecName: Full=Modification methylase BsuFI; Short=M.BsuFI; AltName: Full=Cytosine-specific methyltransferase BsuFI gi|39984|emb|CAA35888.1| unnamed protein product [Bacillus subtilis] Length = 409 Score = 73.4 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 12/100 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKL 57 M A +FG+PQRRER+ I+ F +F FP K + ILE + +IS +L Sbjct: 241 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTG-YSISKRL 299 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96 E + +K++ K + NTL A Y+K Sbjct: 300 QESYLFKKDDGK-------PQIVDFRCTYQVNTLVASYHK 332 >gi|218439646|ref|YP_002377975.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424] gi|218172374|gb|ACK71107.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424] Length = 320 Score = 73.4 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 11/94 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ+RER++I+ L+P + F +P L +ILE + S ++ + Sbjct: 159 LNALDFGLPQKRERIFIVGCLDP-IPFIWPNSTRPFKPLQEILETQVSSSYYASEQIRK- 216 Query: 61 HQKRKENNKIAGKGFG--YGLFFENSATTNTLSA 92 R + F ++ EN +SA Sbjct: 217 --NRLAKYEGK---FYNEPTIWHENK--AGHISA 243 >gi|159026722|emb|CAO89036.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 455 Score = 72.6 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 3/48 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEE 45 + A DFG+PQ RER++I+ FKFP PLGI P++ DILE+ Sbjct: 169 LNAYDFGLPQNRERVFIVGIRKDIDNYERFKFPLPLGIHPKVLDILED 216 >gi|166368611|ref|YP_001660884.1| cytosine-specific methyltransferase [Microcystis aeruginosa NIES-843] gi|166090984|dbj|BAG05692.1| cytosine-specific methyltransferase [Microcystis aeruginosa NIES-843] Length = 464 Score = 72.6 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 3/48 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEE 45 + A DFG+PQ RER++I+ FKFP PLGI P++ DILE+ Sbjct: 177 LNAYDFGLPQNRERVFIVGIRKDIDNYERFKFPLPLGIHPKVLDILED 224 >gi|302671270|ref|YP_003831230.1| DNA-cytosine methyltransferase [Butyrivibrio proteoclasticus B316] gi|302395743|gb|ADL34648.1| DNA-cytosine methyltransferase [Butyrivibrio proteoclasticus B316] Length = 579 Score = 72.6 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A D+GVPQ RERL+++ F N VEF FP + ++ ++ D L ++ + K Sbjct: 354 LNARDYGVPQNRERLFVVGFRNDLDLDVEFSFPQAIELEKKMQDFLLDNAPGGYFLPEK 412 >gi|313678561|ref|YP_004056301.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45] gi|312950401|gb|ADR24996.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45] Length = 315 Score = 72.3 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 5/61 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDK--STISN 55 + A D+G +PQ RER+YI+ F + F FP P+ ++ + D LE ++DD ++ Sbjct: 145 LNAKDYGDIPQNRERIYIVGFKDKHSHDAFSFPLPVKLRTSINDCLEVNVDDDSFYYSAD 204 Query: 56 K 56 K Sbjct: 205 K 205 >gi|172038109|ref|YP_001804610.1| putative modification methylase [Cyanothece sp. ATCC 51142] gi|171699563|gb|ACB52544.1| putative modification methylase [Cyanothece sp. ATCC 51142] Length = 344 Score = 72.3 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 23/93 (24%), Positives = 46/93 (49%), Gaps = 9/93 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW-E 59 + A +FG+PQ+RER++I+ F +P F + P + L +I+E+ + + S ++ Sbjct: 167 LNALNFGLPQKRERVFIVGFRDPLA-FIWKQPNILMKPLSEIIEKSVSEFYYASEQIQRN 225 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 K + N++ ++ EN +SA Sbjct: 226 RLAKYQGNHQHK-----ITIWHENK--AGHISA 251 >gi|325269501|ref|ZP_08136117.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] gi|324988120|gb|EGC20087.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] Length = 388 Score = 72.3 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A D+G+PQ RERLY + F +FK+P P+ ++ ++ D LE++ + + +K Sbjct: 180 LNARDYGIPQTRERLYCVGFKK-KTKFKYPAPIPLRYKMYDFLEDYTNSEYFEKDK 234 >gi|323650448|gb|ADX97301.1| M.Fnu4HI [Fusobacterium nucleatum] Length = 351 Score = 71.9 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 7/70 (10%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTIS-- 54 + A D+G +PQ RER+YI+ F N F+FP PL + + D+LE+ +ID+K S Sbjct: 145 LNAKDYGNIPQNRERIYIVGFKNEEHFKNFEFPFPLELTRNIEDMLEKNNIDEKYYYSKE 204 Query: 55 -NKLWEGHQK 63 NK ++ +K Sbjct: 205 KNKFYDTLEK 214 >gi|291320332|ref|YP_003515594.1| modification methylase Bsp6I [Mycoplasma agalactiae] gi|290752665|emb|CBH40638.1| Modification methylase Bsp6I [Mycoplasma agalactiae] Length = 315 Score = 71.5 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 5/61 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK--STISN 55 + A D+G +PQ RER+YI+ F + F FP P+ +K L D LE ++DD ++ Sbjct: 145 LNAKDYGDIPQNRERIYIVGFKDKHSYDIFSFPLPVKLKTSLNDCLEVNVDDDCFYYSAD 204 Query: 56 K 56 K Sbjct: 205 K 205 >gi|54297036|ref|YP_123405.1| hypothetical protein lpp1078 [Legionella pneumophila str. Paris] gi|53750821|emb|CAH12229.1| hypothetical protein lpp1078 [Legionella pneumophila str. Paris] Length = 320 Score = 70.7 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 9/87 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58 + + DFGVPQ+RER YI+ F++ +V F+FP G+ L ILE+ I +K S+ + Sbjct: 146 LNSLDFGVPQKRERTYIVGFID-NVPFEFPK-GGVPFNLESILEKEQQIPNKYYASDYI- 202 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSA 85 ++K + G ++ EN + Sbjct: 203 ----RQKRIAALKGVPPIPSIWHENKS 225 >gi|251778642|ref|ZP_04821562.1| methyl transferase [Clostridium botulinum E1 str. 'BoNT E Beluga'] gi|243082957|gb|EES48847.1| methyl transferase [Clostridium botulinum E1 str. 'BoNT E Beluga'] Length = 586 Score = 70.7 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + + D+GV Q RER++++ F N F+ P + + ++ D L +++ K +++K Sbjct: 330 LNSKDYGVAQNRERIFVVGFRNDLELVKPFEEPEKVQLNKKMKDYLLDNVSGKYYLNSK 388 >gi|67922277|ref|ZP_00515790.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] gi|67855853|gb|EAM51099.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] Length = 226 Score = 70.7 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+RER++II +P + F F P + L +I+E+ + + S + + Sbjct: 167 LNALDFGLPQKRERIFIIGLRDP-LNFTFKKPNISRKPLSEIIEKSVSEFYYASEHIQK 224 >gi|310657624|ref|YP_003935345.1| cytosine-specific methyltransferase [Clostridium sticklandii DSM 519] gi|308824402|emb|CBH20440.1| Cytosine-specific methyltransferase [Clostridium sticklandii] Length = 326 Score = 70.3 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 30/98 (30%), Positives = 45/98 (45%), Gaps = 14/98 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR----LGDILEEHIDDKSTISN 55 M + +FGVPQ+RER+ II F +EF FP + L ++E + +K S Sbjct: 154 MNSVNFGVPQKRERVIIIGFRKDLELEFNFPEEIIANEWEFLNLSMVIESEVSEKYFFSE 213 Query: 56 KLWEG-HQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 K +G +KR NK G + + NT+ A Sbjct: 214 KAVQGMLKKRATMNK--------GRAQDINKPCNTVGA 243 >gi|288928693|ref|ZP_06422539.1| modification methylase NgoBI (Cytosine-specific methyltransferase NgoBI) [Prevotella sp. oral taxon 317 str. F0108] gi|288329677|gb|EFC68262.1| modification methylase NgoBI (Cytosine-specific methyltransferase NgoBI) [Prevotella sp. oral taxon 317 str. F0108] Length = 309 Score = 69.9 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 30/91 (32%), Positives = 42/91 (46%), Gaps = 13/91 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLN----PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A DFG+PQ+RER+ I+ F + + +F F L ILEE D I K Sbjct: 142 LNAMDFGLPQKRERVIIVGFRDKMAYENFDFTFKKKPFN---LATILEEEKD----IDPK 194 Query: 57 LWEG-HQKRKENNKIAGKG-FGYGLFFENSA 85 L+ + K AGK F ++ EN A Sbjct: 195 LYASKTIREKRKASTAGKEVFYPSIWHENKA 225 >gi|256822924|ref|YP_003146887.1| DNA-cytosine methyltransferase [Kangiella koreensis DSM 16069] gi|256796463|gb|ACV27119.1| DNA-cytosine methyltransferase [Kangiella koreensis DSM 16069] Length = 419 Score = 69.9 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 12/64 (18%) Query: 1 MKACDFG-VPQRRERLYIIDFLNP-----------SVEFKFPTPLGIKPRLGDILEEHID 48 + + DFG VPQ RER+YII F + + EF +P P+ + + D+L++ + Sbjct: 239 LNSMDFGDVPQNRERIYIIGFKDEANWQNNKGATRTSEFSWPEPIRLSKSVRDLLDKQVS 298 Query: 49 DKST 52 + Sbjct: 299 EHYF 302 >gi|82752078|ref|YP_417819.1| DNA modification methylase [Staphylococcus aureus RF122] gi|82657609|emb|CAI82057.1| DNA modification methylase [Staphylococcus aureus RF122] Length = 402 Score = 69.6 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 5/57 (8%) Query: 1 MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDIL--EEHIDDKST 52 + A D+G +PQ RER+YI+ F F+FP + +K + DI+ E ID++ Sbjct: 156 LNAKDYGDIPQNRERIYIVGFKCRKAFDLFEFPEKIDLKTGIKDIINFESEIDERYY 212 >gi|10954474|ref|NP_039765.1| DNA cytosine-5 methylase subunit A [Methanothermobacter thermautotrophicus] gi|266583|sp|P29567|MTHT_METTF RecName: Full=Modification methylase MthTI; Short=M.MthTI; AltName: Full=Cytosine-specific methyltransferase MthTI gi|44641|emb|CAA48436.1| TIM [Methanothermobacter thermautotrophicus] gi|149743|gb|AAA73370.1| TIM [Methanothermobacter thermautotrophicus] Length = 330 Score = 69.6 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 18/96 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ R+R++I+ + +++F+FP PL K L D + + + K + Sbjct: 144 LNAKDYGVPQDRKRVFIVGYREDLNLKFEFPKPLNKKVTLRDAIGDLPEPKPAL------ 197 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARY 94 E N+ G+ L N T T S+RY Sbjct: 198 ------EKNRSNGEN----LEVPNHEYMTGTFSSRY 223 >gi|329767116|ref|ZP_08258644.1| hypothetical protein HMPREF0428_00341 [Gemella haemolysans M341] gi|328837841|gb|EGF87466.1| hypothetical protein HMPREF0428_00341 [Gemella haemolysans M341] Length = 396 Score = 69.2 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK--STISN 55 + D+G VPQ RER+YI+ FL +F+FP + ++ +L DI++ I +K + Sbjct: 145 LNGKDYGNVPQNRERIYIVGFLEKESFDKFEFPKKIKLETKLSDIIDFDIKEKEIYYYRD 204 >gi|2599488|gb|AAB84141.1| FauI DNA methyltransferase [Flavobacterium aquatile] Length = 343 Score = 69.2 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 16/99 (16%) Query: 1 MKACDFGVPQRRERLYIIDFL--NPSVEFKFPTPL---GIKPRLGDILEEHID--DKSTI 53 + + +FGVPQ+RER++I+ F + + FKFP P+ G K L +++++ D +K Sbjct: 165 LNSSEFGVPQKRERVFIVGFRDFDDYLNFKFPQPITLEGSKIVLKEVIDKKADTEEKWFF 224 Query: 54 SNKLWEGHQK-RKENNKIAGKGFGYGLFFENSATTNTLS 91 S K +G + R++ NK G + + NT+S Sbjct: 225 SQKAVDGMLRVREKMNK--------GRVQDLNQPCNTIS 255 >gi|5420107|emb|CAB46561.1| cytosine-specific methyltransferase [Streptococcus thermophilus] Length = 316 Score = 68.8 bits (168), Expect = 3e-10, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 5/59 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL--EEHIDDKSTIS 54 M A D+G +PQ RER+YI+ F + +F P + ++ + D++ + +DDK + Sbjct: 145 MNAADYGNIPQNRERIYIVAFRDKEDYADFDLPKSIPLETSIKDVIDFDSKVDDKFYYT 203 >gi|1171044|sp|P43420|MTB6_BACSF RecName: Full=Modification methylase Bsp6I; Short=M.Bsp6I; AltName: Full=Cytosine-specific methyltransferase Bsp6I gi|547481|emb|CAA57293.1| site-specific DNA-methyltransferase (cytosine-specific) [Bacillus sp.] gi|1098125|prf||2115268B methyltransferase Bsp6IM Length = 315 Score = 68.8 bits (168), Expect = 3e-10, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDI--LEEHIDDKSTISN 55 + A DFG +PQ RER+YI+ F N F FP P + + D+ L + +DD+ + Sbjct: 145 LNAKDFGNIPQNRERIYIVGFRNIEHYKNFNFPMPQPLTLTIKDMINLSDKLDDRFYYTE 204 >gi|308185227|ref|YP_003929360.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori SJM180] gi|308061147|gb|ADO03043.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori SJM180] Length = 317 Score = 68.8 bits (168), Expect = 3e-10, Method: Composition-based stats. Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 14/101 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + DFG+PQ+R R++I+ ++EF FP + K D+L++ ++ K IS K+ Sbjct: 141 LNTLDFGIPQQRNRVFIVALRKNSFTNLEFVFPAKIPCKISTLDLLDKQVELKYFISQKM 200 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYK 96 + + GY + ++ TL+A +K Sbjct: 201 IKTILGKGTK--------GY-IVEPSIDTPIAKTLTATMHK 232 >gi|225571452|ref|ZP_03780448.1| hypothetical protein CLOHYLEM_07550 [Clostridium hylemonae DSM 15053] gi|225159928|gb|EEG72547.1| hypothetical protein CLOHYLEM_07550 [Clostridium hylemonae DSM 15053] Length = 377 Score = 68.8 bits (168), Expect = 3e-10, Method: Composition-based stats. Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 9/86 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+RER+ II P + ++ F + K L DILE+ ID K S ++ Sbjct: 222 LNALDFGLPQKRERIIIIGSKKPFLMDWTF--NVEKKKTLDDILEKDIDKKHYASPEIVA 279 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSA 85 KRK + + ++ EN + Sbjct: 280 ---KRKAKHTAS---IYPSIWHENKS 299 >gi|325913633|ref|ZP_08175995.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B] gi|325476992|gb|EGC80142.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B] Length = 372 Score = 68.4 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 11/99 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 ++A DFG+ Q R+R+ I+ F + + F+FP + DILE++ + IS KL Sbjct: 199 LEASDFGLAQSRKRVIIVGFRSDIDDSSFEFPKGNSKHVAVKDILEDNPEG-YPISKKLQ 257 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENS-ATTNTLSARYYK 96 E + +K++ + + +NS TL++ Y+K Sbjct: 258 ENYLFKKDDGR-------PYVVDKNSTGLAKTLNSSYHK 289 >gi|322383485|ref|ZP_08057261.1| hypothetical protein PL1_3347 [Paenibacillus larvae subsp. larvae B-3650] gi|321152224|gb|EFX45054.1| hypothetical protein PL1_3347 [Paenibacillus larvae subsp. larvae B-3650] Length = 425 Score = 68.4 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 19/81 (23%), Positives = 32/81 (39%), Gaps = 26/81 (32%) Query: 1 MKACDFGVPQRRERLYIIDFLN--------------------------PSVEFKFPTPLG 34 + + +GVPQ RER++I+ + + F +P Sbjct: 144 LNSKFYGVPQSRERVFIVCSRDVEPEAWSIEGNGVLAKAKRRLQAMGARTFNFDWPKNGE 203 Query: 35 IKPRLGDILEEHIDDKSTISN 55 + RL DILE +D+K +S Sbjct: 204 VMTRLRDILEPEVDEKYYLSP 224 >gi|331270911|ref|YP_004385622.1| putative cytosine-specific DNA methylotransferase [Clostridium botulinum BKT015925] gi|329127303|gb|AEB77247.1| putative cytosine-specific DNA methylotransferase [Clostridium botulinum BKT015925] Length = 318 Score = 68.4 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF--KFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 M D+G+P R RLYI+ +F KFPT + +K + D+LE+ ++DK +++K++ Sbjct: 151 MNTSDYGLPHTRRRLYIVGQRKDLGDFDYKFPTEIELKLNVQDLLEKDVNDKYYLTDKMY 210 Query: 59 EG 60 + Sbjct: 211 KT 212 >gi|309379398|emb|CBX21965.1| unnamed protein product [Neisseria lactamica Y92-1009] Length = 223 Score = 68.0 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Query: 7 GVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 G PQ RER++++ F P + F+FP + ++ + D LE++ D K + K Sbjct: 2 GFPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 52 >gi|293596744|ref|ZP_05263998.2| DNA-methyltransferase [Listeria monocytogenes J2818] gi|293592003|gb|EFG00338.1| DNA-methyltransferase [Listeria monocytogenes J2818] Length = 327 Score = 67.6 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 24/104 (23%), Positives = 42/104 (40%), Gaps = 8/104 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD-KSTISNKLWE 59 + A DFG+PQ RER++++ L + F+FP + L D ++ +D +S + Sbjct: 150 LNARDFGIPQNRERVFVVSVLGNNTGFQFPEKIESAMSLKDYIDFEVDPTDYALSENEKQ 209 Query: 60 GHQKRKEN---NKIAGKGF----GYGLFFENSATTNTLSARYYK 96 + + KGF + T+ T R K Sbjct: 210 LFFRENNKLFIHTNTKKGFQEVEQFDSVNVERPTSKTRRGRVGK 253 >gi|269122857|ref|YP_003305434.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM 12112] gi|268314183|gb|ACZ00557.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM 12112] Length = 329 Score = 67.6 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 26/102 (25%), Positives = 44/102 (43%), Gaps = 10/102 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDIL--EEHID------DK 50 + + DFG+PQ+RER+Y++ F F FP P + + D+L +E + D Sbjct: 152 LNSLDFGIPQKRERIYMVCFRKDLNIKNFIFPKPFKLSTFVEDLLLPDEEVSNLIINRDD 211 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +K + + + GKG + TLSA Sbjct: 212 LVLKDKEIKENSNKAIRIGTVGKGGQGERIYSPKGIAITLSA 253 >gi|254901064|ref|ZP_05260988.1| DNA-methyltransferase (cytosine-specific) [Listeria monocytogenes J0161] Length = 320 Score = 67.6 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 24/104 (23%), Positives = 42/104 (40%), Gaps = 8/104 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD-KSTISNKLWE 59 + A DFG+PQ RER++++ L + F+FP + L D ++ +D +S + Sbjct: 143 LNARDFGIPQNRERVFVVSVLGNNTGFQFPEKIESAMSLKDYIDFEVDPTDYALSENEKQ 202 Query: 60 GHQKRKEN---NKIAGKGF----GYGLFFENSATTNTLSARYYK 96 + + KGF + T+ T R K Sbjct: 203 LFFRENNKLFIHTNTKKGFQEVEQFDSVNVERPTSKTRRGRVGK 246 >gi|327463103|gb|EGF09424.1| modification methylase ScrFIA [Streptococcus sanguinis SK1] Length = 346 Score = 67.2 bits (164), Expect = 7e-10, Method: Composition-based stats. Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 6/77 (7%) Query: 3 ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNKL 57 A +GVPQ+RER++I+ + F+FP L IL+++ID+K S + Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNEEDYTPLKAILQKNIDEKYYFSERA 220 Query: 58 WEGHQKRKENNKIAGKG 74 +G K K KG Sbjct: 221 VKGMLNSKS-GKKMNKG 236 >gi|218247578|ref|YP_002372949.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] gi|218168056|gb|ACK66793.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] Length = 727 Score = 66.9 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI------DDKSTIS 54 + A DFGVPQ RER+ II + +F P+L + L++ + T+ Sbjct: 146 LNAKDFGVPQHRERIVIIATRHKKFDFNLIQQQKPIPKLREFLDKTGNFDYLHPKEYTLI 205 Query: 55 NK 56 + Sbjct: 206 DN 207 >gi|167465361|ref|ZP_02330450.1| DNA-cytosine methyltransferase [Paenibacillus larvae subsp. larvae BRL-230010] Length = 432 Score = 66.9 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 20/81 (24%), Positives = 32/81 (39%), Gaps = 26/81 (32%) Query: 1 MKACDFGVPQRRERLYIIDFLN--------------------------PSVEFKFPTPLG 34 + + +GVPQ RER++II + + F +P Sbjct: 144 LNSKFYGVPQSRERVFIICSRDVEPEAWSTEGNGVLTKAKRRLQMMGARTFNFDWPKNSE 203 Query: 35 IKPRLGDILEEHIDDKSTISN 55 + RL DILE +D+K +S Sbjct: 204 VTTRLRDILETEVDEKYYLSP 224 >gi|291551321|emb|CBL27583.1| DNA-methyltransferase (dcm) [Ruminococcus torques L2-14] Length = 595 Score = 66.5 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTI 53 + + ++G+PQ RERL+++ F +F FP P+ ++ ++ D L ++ + Sbjct: 368 LNSKNYGIPQNRERLFVVGFREDLELAKKFSFPNPIPLRKKMKDFLMDNAPGGYFL 423 >gi|257061088|ref|YP_003138976.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] gi|256591254|gb|ACV02141.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] Length = 331 Score = 66.5 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI------DDKSTIS 54 + A DFGVPQ RER+ II + +F P+L + L++ + T+ Sbjct: 146 LNAKDFGVPQHRERIVIIATRHKKFDFNLIQQQKPIPKLREFLDKTGNFDYLHSKEYTLI 205 Query: 55 NK 56 + Sbjct: 206 DN 207 >gi|329769727|ref|ZP_08261128.1| hypothetical protein HMPREF0433_00892 [Gemella sanguinis M325] gi|328838089|gb|EGF87707.1| hypothetical protein HMPREF0433_00892 [Gemella sanguinis M325] Length = 406 Score = 66.1 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK--STISN 55 + D+G +PQ RER+YI+ FL +F+FP + ++ +L DI++ I +K + Sbjct: 155 LNGKDYGNIPQNRERIYIVGFLEKESYDKFEFPNEIKLETKLSDIIDFDIKEKEIYYYRD 214 >gi|169823657|ref|YP_001691160.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328] gi|167832277|dbj|BAG09192.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328] Length = 332 Score = 66.1 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 5/61 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL--EEHIDDKSTISN 55 + A +FG +PQ RER+YI+ F + + F+FP P+ + + D + E D + Sbjct: 147 LNATEFGNIPQNRERIYIVAFRDKNCLDNFEFPKPIELTTTIRDFIDFENKKDTSFYYTE 206 Query: 56 K 56 K Sbjct: 207 K 207 >gi|269121452|ref|YP_003309629.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386] gi|268615330|gb|ACZ09698.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386] Length = 372 Score = 66.1 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLWE 59 + A ++ +PQ RERL+ + L+ V++ FP P + L D+LE+ +D+K I+ K Sbjct: 150 LNALNYEIPQNRERLFCLSILDDKVKYNFPGPKKLNILLKDLLEKEVDEKYFINEEKTKA 209 Query: 60 GHQKRKEN 67 +K K+ Sbjct: 210 FIEKYKDK 217 >gi|220929948|ref|YP_002506857.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10] gi|220000276|gb|ACL76877.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10] Length = 338 Score = 66.1 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 17/106 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL---EEHIDDKSTISN 55 + A ++G+PQ RER+Y++ F N F FP P +K + D L E ++ Sbjct: 152 LNAVNYGIPQNRERIYMVCFRNDLNIENFNFPKPFPLKRYVEDFLLEDESQVEHLYIQRP 211 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFEN---------SATTNTLSA 92 + + E+NK + K G+ + TLSA Sbjct: 212 ---DTYFNGVEDNKYSNKPIRLGIVNKGGQGERIYSTKGIAITLSA 254 >gi|314055098|ref|YP_004063436.1| cytosine-specific methyltransferase [Ostreococcus tauri virus 2] gi|313574989|emb|CBI70002.1| cytosine-specific methyltransferase [Ostreococcus tauri virus 2] Length = 315 Score = 65.7 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query: 8 VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 VPQ RER+YI+ F + F F G K L D +E + DK S+K Sbjct: 153 VPQHRERIYIVGFRDKELHDNFNFDFVEGDKGNLCDFMESCVPDKYYYSDKY 204 >gi|126660265|ref|ZP_01731380.1| putative DNA modification methylase (N.MgoV) [Cyanothece sp. CCY0110] gi|126618440|gb|EAZ89194.1| putative DNA modification methylase (N.MgoV) [Cyanothece sp. CCY0110] Length = 458 Score = 65.7 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 12/90 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILEE----HIDDKSTI 53 + + DFGVPQ RER++I+ ++FP PL ++ RL D+L+E + +K + Sbjct: 173 INSYDFGVPQNRERVFIVGIRKDRKNCHHYQFPKPLKVQIRLLDVLDELKHCQVTEKVKL 232 Query: 54 SNKLWEG-----HQKRKENNKIAGKGFGYG 78 + ++ + R + N F + Sbjct: 233 TPEILFNGNIPPSRNRFQKNDELNDFFTFS 262 >gi|172039424|ref|YP_001805925.1| putative site-specific DNA-methyltransferase [Cyanothece sp. ATCC 51142] gi|171700878|gb|ACB53859.1| putative site-specific DNA-methyltransferase [Cyanothece sp. ATCC 51142] Length = 729 Score = 65.7 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 6/59 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE-----EHIDDK-STI 53 + A DFGVPQ RER+ II LN F P L L+ E++D K T+ Sbjct: 146 LNAKDFGVPQNRERIIIIGTLNKKFNFDLIDIQKNVPSLRSFLDQKGNFEYLDPKEYTL 204 >gi|281491829|ref|YP_003353809.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp. lactis KF147] gi|281375540|gb|ADA65046.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp. lactis KF147] Length = 351 Score = 65.3 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 6/79 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP----RLGDILEEHIDDKSTISN 55 ++A ++G+PQ+RER++I+ N + +F F P P L +L++ D+K S+ Sbjct: 159 LRAVEYGIPQKRERVFIVGIRNDLNKKFHFADPPIQSPLDYTPLKKVLQKDFDEKYYFSD 218 Query: 56 KLWEGHQKRKENNKIAGKG 74 + EG K K +KI KG Sbjct: 219 RAVEGMLKSK-MSKIMNKG 236 >gi|15616070|ref|NP_244375.1| cytosine-specific methyltransferase [Bacillus halodurans C-125] gi|10176132|dbj|BAB07227.1| cytosine-specific methyltransferase [Bacillus halodurans C-125] Length = 326 Score = 65.3 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLG----IKPRLGDILEEHIDD 49 + A D+ VPQ RER+ I+ F N EF FP ++ L D+ E +D Sbjct: 146 LNAKDYSVPQNRERVIIVGFRNDLGITEFTFPEKHDKIVTLREALADLPEPSPED 200 >gi|257870038|ref|ZP_05649691.1| DNA methylase [Enterococcus gallinarum EG2] gi|257804202|gb|EEV33024.1| DNA methylase [Enterococcus gallinarum EG2] Length = 401 Score = 65.3 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDIL--EEHIDDKSTIS 54 + D+G VPQ RER+Y++ F N F FP+ + + +L D++ E DDK Sbjct: 156 LNGKDYGNVPQNRERIYVVGFRNQQAFDNFHFPSKVELTTKLSDVIDFENPKDDKYYYK 214 >gi|289167787|ref|YP_003446056.1| site-specific DNA methylase [Streptococcus mitis B6] gi|288907354|emb|CBJ22191.1| site-specific DNA methylase [Streptococcus mitis B6] Length = 346 Score = 65.3 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 6/77 (7%) Query: 3 ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNKL 57 A +GVPQ+RER++I+ + F+FP L IL++ ID+K S + Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNVEDYTPLKVILQQDIDEKYYFSERA 220 Query: 58 WEGHQKRKENNKIAGKG 74 +G K K KG Sbjct: 221 VQGMLNSKS-GKKMNKG 236 >gi|148988377|ref|ZP_01819824.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pneumoniae SP6-BS73] gi|147926058|gb|EDK77132.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pneumoniae SP6-BS73] Length = 343 Score = 65.3 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 6/77 (7%) Query: 3 ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNKL 57 A +GVPQ+RER++I+ + F+FP L IL++ ID+K S + Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNVEDYTPLKVILQQDIDEKYYFSERA 220 Query: 58 WEGHQKRKENNKIAGKG 74 +G K K KG Sbjct: 221 VQGMLNSKS-GKKMNKG 236 >gi|312281368|ref|YP_004022731.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii 177R1B] gi|312181897|gb|ADQ42066.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii 177R1B] Length = 319 Score = 64.9 bits (158), Expect = 4e-09, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEE--HIDDKSTISN 55 + + ++G VPQ RER+YI+ FL+ S FKFP P+ + + DI++ D+K Sbjct: 146 LNSLEYGNVPQNRERVYIVGFLDKSMYEAFKFPEPVSLTVTIHDIIKPWEKKDEKYYYRE 205 >gi|328912201|gb|AEB63797.1| Modification methylase Rho11sI [Bacillus amyloliquefaciens LL3] Length = 503 Score = 64.5 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 34/101 (33%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30 + + F VPQ RER+YII +E FK+ Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWVLEKGRNDVLSKGKKRLKELNIKSFNFKWS 208 Query: 31 TPLGIKPRLGDILEEHIDDKSTISN----KLWEGHQKRKEN 67 + RL +ILEE++D+K +S KL E +K KE Sbjct: 209 AQDIVGQRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEK 249 >gi|218248203|ref|YP_002373574.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] gi|257060473|ref|YP_003138361.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] gi|218168681|gb|ACK67418.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] gi|256590639|gb|ACV01526.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] Length = 460 Score = 64.5 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 32/48 (66%), Gaps = 3/48 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEE 45 + A DFG+PQ R+R++++ N S ++FP PL I P++ DIL++ Sbjct: 168 LNAYDFGLPQNRDRVFLVGIRNDIEGSQNYQFPDPLNIHPKVLDILDD 215 >gi|269119458|ref|YP_003307635.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386] gi|268613336|gb|ACZ07704.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386] Length = 383 Score = 64.5 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + A D+ +PQRR+R++ + + ++ FP P+ +K RL D+LE+ + +K + + Sbjct: 148 LNAKDYRIPQRRKRVFCVSIF-GNEKYVFPKPVELKLRLRDMLEKEVPEKYYLKD 201 >gi|308185228|ref|YP_003929361.1| DNA-cytosine methyltransferase [Helicobacter pylori SJM180] gi|308061148|gb|ADO03044.1| DNA-cytosine methyltransferase [Helicobacter pylori SJM180] Length = 368 Score = 64.5 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 19/85 (22%), Positives = 37/85 (43%), Gaps = 25/85 (29%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH------------ 46 + A ++G+PQ R RL+++ F F FP+P + + D+L+++ Sbjct: 187 LDARNYGIPQGRRRLFLVGFKEQEKCANFTFPSPKELTITMQDLLQDNIKEGNLLSKNAI 246 Query: 47 -----------IDDKSTISNKLWEG 60 +D+K +S KL + Sbjct: 247 LDTKSFLGGELVDEKYFLSEKLLKY 271 >gi|328553026|gb|AEB23518.1| SP-beta prophage DNA (cytosine-5-)-methyltransferase [Bacillus amyloliquefaciens TA208] Length = 503 Score = 64.5 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 34/101 (33%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30 + + F VPQ RER+YII +E FK+ Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWIVEKGRNDVLSKGKKRLKELNIKSFNFKWS 208 Query: 31 TPLGIKPRLGDILEEHIDDKSTISN----KLWEGHQKRKEN 67 + RL +ILEE++D+K +S KL E +K KE Sbjct: 209 AQDIVGKRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEK 249 >gi|254933776|ref|ZP_05267135.1| DNA-cytosine methyltransferase [Listeria monocytogenes HPB2262] gi|293585336|gb|EFF97368.1| DNA-cytosine methyltransferase [Listeria monocytogenes HPB2262] Length = 325 Score = 64.2 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK-STISNK 56 + A D+G+PQ RER++++ L + EF+FP + L D ++ +D +S Sbjct: 143 LNARDYGIPQNRERVFVVSVLGNNKEFQFPEKVKPVKSLKDYIDFDVDPTAYALSEN 199 >gi|332310450|gb|EGJ23545.1| DNA-methyltransferase (Dcm) [Listeria monocytogenes str. Scott A] Length = 325 Score = 64.2 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK-STISNK 56 + A D+G+PQ RER++++ L + EF+FP + L D ++ +D +S Sbjct: 143 LNARDYGIPQNRERVFVVSVLGNNKEFQFPEKVKPVKSLKDYIDFDVDPTAYALSEN 199 >gi|157265308|ref|YP_001467867.1| C5 cytosine-specific DNA methylase [Thermus phage P23-45] gi|157265426|ref|YP_001467984.1| C5 cytosine-specific DNA methylase [Thermus phage P74-26] gi|156905203|gb|ABU96847.1| C5 cytosine-specific DNA methylase [Thermus phage P23-45] gi|156905321|gb|ABU96964.1| C5 cytosine-specific DNA methylase [Thermus phage P74-26] Length = 368 Score = 64.2 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 9/54 (16%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53 + A D+GVPQ+RER++I+ + +F FP P P + K + Sbjct: 162 LNAADYGVPQKRERVFIVGVRSDLPGDFAFPLPTHANP--------QVAAKYGL 207 >gi|327399867|ref|YP_004346898.1| cytosine-specific methyltransferase [Lactobacillus amylovorus GRL 1112] gi|327182537|gb|AEA32972.1| cytosine-specific methyltransferase [Lactobacillus amylovorus GRL 1112] Length = 401 Score = 64.2 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55 + D+G +PQ RER+Y++ F N F FP P+ + L DI++ D+K Sbjct: 153 LNGKDYGNIPQNRERIYVVGFDNKEDYDRFDFPAPIKLTKTLHDIIDFHGKKDEKYYYRE 212 >gi|255018626|ref|ZP_05290752.1| DNA-methyltransferase (cytosine-specific) [Listeria monocytogenes FSL F2-515] Length = 172 Score = 64.2 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK-STISNK 56 + A DFG+PQ RER++++ L + EF+FP + L D ++ ++ +S Sbjct: 110 LNARDFGIPQNRERVFVVSVLGNNKEFQFPEKVEPVKSLKDYIDFDVEPTAYALSEN 166 >gi|1171045|sp|P09915|MTBR_BPRH1 RecName: Full=Modification methylase Rho11sI; Short=M.Rho11sI; AltName: Full=Bsu P11s; AltName: Full=Cytosine-specific methyltransferase Rho11sI gi|579194|emb|CAA28869.1| unnamed protein product [Bacillus phage rho11s] Length = 503 Score = 64.2 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 34/101 (33%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30 + + F VPQ RER+YII +E FK+ Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWVVEKGRNDVLSKGKKRLKELNIKSFNFKWS 208 Query: 31 TPLGIKPRLGDILEEHIDDKSTISN----KLWEGHQKRKEN 67 + RL +ILEE++D+K +S KL E +K KE Sbjct: 209 AQDIVGRRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEK 249 >gi|901818|gb|AAA69959.1| 5C-DNA methyltransferase [Bacillus phage H2] Length = 503 Score = 64.2 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 34/101 (33%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30 + + F VPQ RER+YII +E FK+ Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWIVEKGRYDVLSKGKKRLKELNIKSFNFKWS 208 Query: 31 TPLGIKPRLGDILEEHIDDKSTISN----KLWEGHQKRKEN 67 + RL +ILEE++D+K +S KL E +K KE Sbjct: 209 AQDIVGKRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEK 249 >gi|303231468|ref|ZP_07318199.1| modification methylase HhaI family protein [Veillonella atypica ACS-049-V-Sch6] gi|302513905|gb|EFL55916.1| modification methylase HhaI family protein [Veillonella atypica ACS-049-V-Sch6] Length = 411 Score = 64.2 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55 + D+G +PQ RER+YI+ FL S F FP + + L DI++ +D+ + Sbjct: 154 LNGKDYGNIPQNRERIYIVGFLEKSAYDAFIFPDEIPLTTSLSDIIDFNGKMDEYYYYTE 213 >gi|118138268|pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances Sequence Discrimination Of Dna Methyltransferase M.Hhai Length = 327 Score = 64.2 bits (156), Expect = 7e-09, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|229824483|ref|ZP_04450552.1| hypothetical protein GCWU000282_01806 [Catonella morbi ATCC 51271] gi|229786084|gb|EEP22198.1| hypothetical protein GCWU000282_01806 [Catonella morbi ATCC 51271] Length = 406 Score = 63.8 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 5/59 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDD--KSTIS 54 + D G +PQ RER+YI+ F + F+FP + + +L D+++ HI + K + Sbjct: 156 LNGKDHGNIPQNRERIYIVGFRDKQAFDAFQFPESVDLTTKLDDVIDFHIAENAKYYYT 214 >gi|161761159|pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 Score = 63.8 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|160877870|pdb|2Z6U|A Chain A, Ternary Structure Of The Glu119ala M.Hhai, C5-Cytosine Dna Methyltransferase, With Unmodified Dna And Adohcy Length = 327 Score = 63.8 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|50513617|pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna Methyltransferase: An Insight Into Protein-Protein Interactions gi|50513618|pdb|1SVU|B Chain B, Structure Of The Q237w Mutant Of Hhai Dna Methyltransferase: An Insight Into Protein-Protein Interactions Length = 327 Score = 63.8 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|189096062|pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Score = 63.8 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|12084381|pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase Mutant (T250g) In Complex With Dna And Adohcy gi|85544394|pdb|2C7R|A Chain A, Hhai Dna Methyltransferase (T250g Mutant) Complex With Oligonucleotide Containing 2-Aminopurine As A Target Base (Gpgc:gmgc) And Sah Length = 327 Score = 63.8 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|127455|sp|P05102|MTH1_HAEPH RecName: Full=Modification methylase HhaI; Short=M.HhaI; AltName: Full=Cytosine-specific methyltransferase HhaI gi|1065144|pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna And S-Adenosyl-L-Homocysteine gi|1942412|pdb|3MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Unmodified Dna And Adohcy gi|1942415|pdb|4MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Native Dna And Adohcy gi|2392799|pdb|5MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Hemimethylated Dna And Adohcy gi|3660437|pdb|6MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Adohcy And Dna Containing 4'-Thio-2'deoxycytidine At The Target gi|4139672|pdb|7MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX gi|4139675|pdb|8MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX gi|4139680|pdb|9MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX gi|4558252|pdb|10MH|A Chain A, Ternary Structure Of Hhai Methyltransferase With Adohcy And Hemimethylated Dna Containing 5,6-Dihydro-5-Azacytosine At The Target gi|4699814|pdb|2HMY|B Chain B, Binary Complex Of Hhai Methyltransferase With Adomet Formed In The Presence Of A Short Nonpsecific Dna Oligonucleotide gi|24158912|pdb|1M0E|A Chain A, Zebularine: A Novel Dna Methylation Inhibitor That Forms A Covalent Complex With Dna Methyltransferase gi|52695513|pdb|1SKM|A Chain A, Hhai Methyltransferase In Complex With Dna Containing An Abasic South Carbocyclic Sugar At Its Target Site gi|85544385|pdb|2C7O|A Chain A, Hhai Dna Methyltransferase Complex With 13mer Oligonucleotide Containing 2-Aminopurine Adjacent To The Target Base (Pcgc:gmgc) And Sah gi|85544388|pdb|2C7P|A Chain A, Hhai Dna Methyltransferase Complex With Oligonucleotide Containing 2-Aminopurine Opposite To The Target Base ( Gcgc:gmpc) And Sah gi|85544391|pdb|2C7Q|A Chain A, Hhai Dna Methyltransferase Complex With Oligonucleotide Containing 2-Aminopurine Outside The Recognition Sequence (Paired With G) And Sah gi|116667789|pdb|2HR1|A Chain A, Ternary Structure Of Wt M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy gi|157831356|pdb|1HMY|A Chain A, Crystal Structure Of The Hhal Dna Methyltransferase Complexed With S-Adenosyl-L-Methionine gi|290560089|pdb|3EEO|A Chain A, M. Hhai Co-Crystallized With Synthetic Dsdna Containing A Propane Diol In Place Of The Deoxycytidine Residue Targeted For Methylation. gi|148949|gb|AAA24989.1| DNA methylase [Haemophilus haemolyticus] Length = 327 Score = 63.8 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|159795737|pdb|2Z6A|A Chain A, S-Adenosyl-L-Methionine-Dependent Methyl Transfer: Observable Precatalytic Intermediates During Dna Cytosine Methylation Length = 327 Score = 63.8 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|331270912|ref|YP_004385623.1| putative cytosine-specific DNA methylotransferase [Clostridium botulinum BKT015925] gi|329127304|gb|AEB77248.1| putative cytosine-specific DNA methylotransferase [Clostridium botulinum BKT015925] Length = 349 Score = 63.8 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53 + A +FG+PQ RER+++I + + KF RL DIL+ +D++ I Sbjct: 149 LNAKNFGIPQNRERIFVIGIREYIDNKQMKFNEGKDYGYRLKDILQNQVDERFYI 203 >gi|146298415|ref|YP_001193006.1| DNA-cytosine methyltransferase [Flavobacterium johnsoniae UW101] gi|146152833|gb|ABQ03687.1| DNA-cytosine methyltransferase [Flavobacterium johnsoniae UW101] Length = 329 Score = 63.8 bits (155), Expect = 9e-09, Method: Composition-based stats. Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 9/101 (8%) Query: 1 MKACDFG-VPQRRERLYIIDF-----LNPSVEFKFPTPLGIKPRLGDIL-EEHIDDK-ST 52 + DFG +P RER++I+ F + EF FP + + D++ +E +D+K Sbjct: 144 LNTKDFGNIPHNRERIFIVAFDKDYIKDDKFEFHFPEKEDLTKSIKDLITKEKVDEKFYY 203 Query: 53 ISNKLWEGHQKRKENNKIAGKGFGYGLFFEN-SATTNTLSA 92 +K + NK F EN S+ TL+A Sbjct: 204 HEDKYMYDMLRESITNKDRIYQFRRQYVRENKSSVCPTLTA 244 >gi|197302809|ref|ZP_03167861.1| hypothetical protein RUMLAC_01538 [Ruminococcus lactaris ATCC 29176] gi|197298046|gb|EDY32594.1| hypothetical protein RUMLAC_01538 [Ruminococcus lactaris ATCC 29176] Length = 333 Score = 63.4 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL---EEHIDDKSTISN 55 + A D+G+PQ+RER+Y++ F N F +P P + + + L EE + D Sbjct: 152 LNAVDYGIPQKRERIYMVCFRNDLGITGFSYPKPFKLTRHVENFLLDDEEMVKDLYVERP 211 >gi|148380278|ref|YP_001254819.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum A str. ATCC 3502] gi|148289762|emb|CAL83870.1| putative C-5 cytosine-specific DNA methylase [Clostridium botulinum A str. ATCC 3502] Length = 340 Score = 63.4 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + + D+G PQ RER++ I FKFP P+ + IL+E++D K NK Sbjct: 152 LNSKDYGSPQSRERMFCISIRKDIDACLFKFPKPMDSIVPINTILDEYVDKKYYCINKY 210 >gi|260890220|ref|ZP_05901483.1| modification methylase EcoRII [Leptotrichia hofstadii F0254] gi|260859840|gb|EEX74340.1| modification methylase EcoRII [Leptotrichia hofstadii F0254] Length = 293 Score = 63.4 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 5/57 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL--EEHIDDKST 52 + A ++G VPQ RER+YII F F+ PL ++ ++GDI+ ++ +D+K Sbjct: 115 LNASEYGNVPQNRERIYIIGFRKKEDYDNFEDIKPLKLEKKIGDIIDFDKKVDEKYY 171 >gi|296126993|ref|YP_003634245.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563] gi|296018809|gb|ADG72046.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563] Length = 324 Score = 63.4 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RER+YI+ F +F FP P+ + L D L E Sbjct: 152 LNASDYGIPQKRERIYIVCFRKDLNIKKFDFPKPIELIKHLEDFLLEE 199 >gi|126658057|ref|ZP_01729209.1| DNA cytosine methylase [Cyanothece sp. CCY0110] gi|126620695|gb|EAZ91412.1| DNA cytosine methylase [Cyanothece sp. CCY0110] Length = 358 Score = 63.4 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 13/101 (12%) Query: 1 MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A F +PQ RER+YI+ F L VEF FP + +E +++ +IS Sbjct: 181 LDAALFNLPQVRERIYIVGFCRDYLKERVEFNFPVGRKNNVFIDQFIETNVEG-YSISKH 239 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96 L + + +K++ + + +NS T + Y+K Sbjct: 240 LQKTYLFKKDDGR-------PQIVDQNSKVKVKTFVSTYHK 273 >gi|325269502|ref|ZP_08136118.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] gi|324988121|gb|EGC20088.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] Length = 393 Score = 63.0 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + D+GVPQ R+R+Y I F + +FK+P P+ + + D L++ + + + K Sbjct: 180 LNGKDYGVPQSRDRIYCIGFKKET-DFKYPAPIPLVKTVYDYLQKKFEKRYLLRQK 234 >gi|317500279|ref|ZP_07958506.1| cytosine-specific methyltransferase [Lachnospiraceae bacterium 8_1_57FAA] gi|331087487|ref|ZP_08336423.1| hypothetical protein HMPREF1025_00006 [Lachnospiraceae bacterium 3_1_46FAA] gi|316898322|gb|EFV20366.1| cytosine-specific methyltransferase [Lachnospiraceae bacterium 8_1_57FAA] gi|330410467|gb|EGG89898.1| hypothetical protein HMPREF1025_00006 [Lachnospiraceae bacterium 3_1_46FAA] Length = 410 Score = 62.6 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 22/46 (47%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A DFGVPQ+RERL + N V F FP KP L DIL Sbjct: 227 LNAWDFGVPQKRERLITVGIRNDLVGKVSFSFPKEHNYKPVLRDIL 272 >gi|258511120|ref|YP_003184554.1| DNA-cytosine methyltransferase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|257477846|gb|ACV58165.1| DNA-cytosine methyltransferase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 395 Score = 62.6 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 10/70 (14%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ+RER++I+ F + ++E+ FP P L + ++ + + WE Sbjct: 178 LNAADYGVPQKRERVFIVGFRSDLNIEWSFPNPTHSFDAL--LYDQWVTGEY------WE 229 Query: 60 GHQKRKENNK 69 H + + ++ Sbjct: 230 RH-RVAKKHR 238 >gi|330718183|ref|ZP_08312783.1| cytosine-specific methyltransferase [Leuconostoc fallax KCTC 3537] Length = 414 Score = 62.6 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + A ++G +PQ RER+Y++ F + F FP + + +L DI++ Sbjct: 152 LNAKEYGNIPQNRERIYVVGFKDKKAFDNFSFPEKIDLTTKLSDIID 198 >gi|57506196|ref|ZP_00372116.1| C-5 cytosine-specific DNA methylase [Campylobacter upsaliensis RM3195] gi|57015523|gb|EAL52317.1| C-5 cytosine-specific DNA methylase [Campylobacter upsaliensis RM3195] Length = 315 Score = 62.6 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + ++G +PQ RER+YII FL+ F FP + + ++ +LE+ +D ++ Sbjct: 142 LNTSEYGNIPQNRERIYIIGFLDFHTYESFHFPAKIKLTQKIQHLLEKGVDKSFYYTSH 200 >gi|309789605|ref|ZP_07684186.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6] gi|308228341|gb|EFO81988.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6] Length = 342 Score = 62.2 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 22/100 (22%), Positives = 37/100 (37%), Gaps = 18/100 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL----EEHIDDKSTISNK 56 + A +GVPQ RERL ++ F FP PL K +G+ L + ++ Sbjct: 157 LNAVHYGVPQNRERLIVVG---HKGGFSFPKPLSTKVTVGEALGEMVHSTPPESKFLTPS 213 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFEN---SATTNTLSAR 93 + K + + Y + + TL+ R Sbjct: 214 MDAYVAKYERAS--------YCKVPRDLHLDKPSRTLTCR 245 >gi|300869073|ref|ZP_07113674.1| Cytosine-specific methyltransferase (fragment) [Oscillatoria sp. PCC 6506] gi|300332930|emb|CBN58870.1| Cytosine-specific methyltransferase (fragment) [Oscillatoria sp. PCC 6506] Length = 345 Score = 62.2 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 9/62 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDILEEHID------DKSTI 53 + A +FG+PQ RER++II EFKF P+L D L+ D K T+ Sbjct: 141 LNAKNFGLPQHRERIFIIG--TKGKEFKFSKLKTKFPPKLRDFLDVEGDFEILDRSKYTL 198 Query: 54 SN 55 + Sbjct: 199 ID 200 >gi|9630267|ref|NP_046694.1| modification methylase [Bacillus phage SPBc2] gi|16079084|ref|NP_389907.1| SP-beta prophage DNA (cytosine-5-)-methyltransferase [Bacillus subtilis subsp. subtilis str. 168] gi|221309931|ref|ZP_03591778.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str. 168] gi|221314254|ref|ZP_03596059.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str. NCIB 3610] gi|221319176|ref|ZP_03600470.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str. JH642] gi|221323451|ref|ZP_03604745.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str. SMY] gi|56405062|sp|P68585|MTBP_BACSU RecName: Full=Phi-3T prophage-derived modification methylase Phi3TI; Short=M.Phi3TI; AltName: Full=Cytosine-specific methyltransferase Phi3TI gi|56405063|sp|P68586|MTBP_BPPHT RecName: Full=Modification methylase Phi3TI; Short=M.Phi3TI; AltName: Full=Cytosine-specific methyltransferase Phi3TI gi|7433506|pir||T12906 modification methylase - Bacillus subtilis phage SPBc2 gi|215471|gb|AAA32352.1| methyltransferase (ttg start codon) [Bacillus phage phi3T] gi|2634418|emb|CAB13917.1| putative SP-beta prophage DNA (cytosine-5-)-methyltransferase [Bacillus subtilis subsp. subtilis str. 168] gi|3025620|gb|AAC13115.1| modification methylase [Bacillus phage SPbeta] Length = 443 Score = 62.2 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 22/85 (25%), Positives = 33/85 (38%), Gaps = 30/85 (35%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30 + + F VPQ RER+YII VE FK+P Sbjct: 182 LNSKFFNVPQNRERVYIIGIREDLVENEQWVVGQKRNDVLSKGKKRLQEINIKSFNFKWP 241 Query: 31 TPLGIKPRLGDILEEHIDDKSTISN 55 + RL +ILE+ +D+K ++ Sbjct: 242 LQDTVTKRLREILEDFVDEKYYLNE 266 >gi|208289|gb|AAA72678.1| Mtase protein (ttg start codon) [synthetic construct] Length = 474 Score = 62.2 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 22/85 (25%), Positives = 33/85 (38%), Gaps = 30/85 (35%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30 + + F VPQ RER+YII VE FK+P Sbjct: 182 LNSKFFNVPQNRERVYIIGIREDLVENEQWVVGQKRNDVLSKGKKRLQEINIKSFNFKWP 241 Query: 31 TPLGIKPRLGDILEEHIDDKSTISN 55 + RL +ILE+ +D+K ++ Sbjct: 242 LQDTVTKRLREILEDFVDEKYYLNE 266 >gi|223937258|ref|ZP_03629164.1| DNA-cytosine methyltransferase [bacterium Ellin514] gi|223894043|gb|EEF60498.1| DNA-cytosine methyltransferase [bacterium Ellin514] Length = 408 Score = 62.2 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 10/72 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ RER++I+ F + +E+ FP P + + K + WE Sbjct: 186 LNAADYGVPQFRERVFIVGFRHDLGIEWSFPKPTHSY-------DALVKAKWV-TGDYWE 237 Query: 60 GHQKRKENNKIA 71 H K + ++ Sbjct: 238 QH-KIAKKHRPK 248 >gi|331084584|ref|ZP_08333682.1| hypothetical protein HMPREF0992_02606 [Lachnospiraceae bacterium 6_1_63FAA] gi|330400654|gb|EGG80261.1| hypothetical protein HMPREF0992_02606 [Lachnospiraceae bacterium 6_1_63FAA] Length = 324 Score = 61.5 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL--EEHIDDKSTISN 55 + A +G V Q RER+YI+ F + +F +P + + + DI+ E +D+K + Sbjct: 146 LNAMTYGNVAQNRERIYIVAFRDEEDYEKFHWPLSIPLTNSVKDIIDFENKVDEKYYYTP 205 >gi|326571776|gb|EGE21785.1| DNA-cytosine methyltransferase [Moraxella catarrhalis BC7] Length = 458 Score = 61.5 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 6/67 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57 + + D+GVPQ RER Y + + F+FP +L DI+E +DKS I +K Sbjct: 261 LNSYDYGVPQFRERWYCVAIRKDSDNGRFEFPKNRDRTTKLRDIIESDNNDKSLILSKFE 320 Query: 58 ---WEGH 61 H Sbjct: 321 IDRINYH 327 >gi|227500535|ref|ZP_03930589.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus tetradius ATCC 35098] gi|227217363|gb|EEI82692.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus tetradius ATCC 35098] Length = 321 Score = 61.5 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ L + F F + R L + LE+ + + TI+ + Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFDKLERKETRTLSEFLEKDVSELYTITQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|254442311|ref|ZP_05055787.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae bacterium DG1235] gi|198256619|gb|EDY80927.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae bacterium DG1235] Length = 338 Score = 61.5 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Query: 3 ACDFGVPQRRERLYIIDFL----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + DFGVPQ RER+Y + N + +F FP LG L+ D +S+ + Sbjct: 156 SVDFGVPQMRERVYFVGVRKDLVNSNFDFTFPEKAKRVKGLGSYLKSK-DPSYALSDAGY 214 Query: 59 EGHQKR 64 +K Sbjct: 215 AYLEKY 220 >gi|119511452|ref|ZP_01630563.1| modification methylase NlaIV [Nodularia spumigena CCY9414] gi|119463917|gb|EAW44843.1| modification methylase NlaIV [Nodularia spumigena CCY9414] Length = 433 Score = 61.5 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 18/82 (21%), Positives = 31/82 (37%), Gaps = 19/82 (23%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF-----PT--------------PLGIKPRLGD 41 + + +FG+PQ R R+Y+I LN + +F P + D Sbjct: 148 LNSANFGLPQNRVRIYLIGILNATPKFNLMSDVGPKDSHTYNPQQMSLFHKPKRPATVAD 207 Query: 42 ILEEHIDDKSTISNKLWEGHQK 63 ILE++ K S ++ Sbjct: 208 ILEDNPSSKYDCSPPFINALKR 229 >gi|237739124|ref|ZP_04569605.1| C-5 cytosine-specific DNA methylase [Fusobacterium sp. 2_1_31] gi|229423724|gb|EEO38771.1| C-5 cytosine-specific DNA methylase [Fusobacterium sp. 2_1_31] Length = 361 Score = 61.1 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDK 50 + A ++GV Q+RERL I+ N + F FPTP KP L DIL + + K Sbjct: 179 LNAWNYGVAQKRERLIIVGIRNDLINKLNFLFPTPHKYKPVLRDILLDCPESK 231 >gi|209524941|ref|ZP_03273486.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] gi|209494590|gb|EDZ94900.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] Length = 442 Score = 61.1 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 4/60 (6%) Query: 1 MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A DFG+PQ R+R++I+ N F+FP PL + P+L D +E + K I K Sbjct: 160 INASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNLHPKLFDFVEG-VSQKPVIKKKF 218 >gi|159027646|emb|CAO89510.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 728 Score = 61.1 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 6/62 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL-----EEHIDDK-STIS 54 + A DFGVPQ RER+ II N F P+L D L E++D K T+ Sbjct: 146 LNAKDFGVPQNRERIIIIATQNKKFNFNSLKYTSPIPKLRDFLSPQGNFEYLDKKEYTLI 205 Query: 55 NK 56 + Sbjct: 206 DN 207 >gi|218902126|ref|YP_002449960.1| cytosine-specific methyltransferase NlaX [Bacillus cereus AH820] gi|218538919|gb|ACK91317.1| cytosine-specific methyltransferase NlaX [Bacillus cereus AH820] Length = 350 Score = 61.1 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 6/57 (10%) Query: 1 MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHI---DDKS 51 + + ++G VPQ RER+YI+ FL + +F FP P+ + L ++ + D+K Sbjct: 153 LNSMEYGNVPQNRERIYIVGFLENELTAKFDFPAPIPLTNTLNTVINRNSSINDEKY 209 >gi|163938820|ref|YP_001643704.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4] gi|163861017|gb|ABY42076.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4] Length = 350 Score = 61.1 bits (148), Expect = 6e-08, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 6/57 (10%) Query: 1 MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHI---DDKS 51 + + ++G VPQ RER+YI+ FL + +F FP P+ + L ++ + D+K Sbjct: 153 LNSMEYGNVPQNRERIYIVGFLENELTAKFDFPAPIPLTNTLNTVINRNSSINDEKY 209 >gi|257060181|ref|YP_003138069.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] gi|256590347|gb|ACV01234.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] Length = 336 Score = 60.7 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 10/81 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DF +P +RER++I+ F +P ++F + + L ILE ++ S ++ Sbjct: 167 LNALDFALPHKRERIFIVGFRDP-LQFTWKNSIIPMKSLEKILENNVAQSYYASQQIRAN 225 Query: 61 -HQKRKEN--------NKIAG 72 +K + ++ G Sbjct: 226 RLEKYQGKTYQEPTIWHENKG 246 >gi|331091845|ref|ZP_08340677.1| hypothetical protein HMPREF9477_01320 [Lachnospiraceae bacterium 2_1_46FAA] gi|330402744|gb|EGG82311.1| hypothetical protein HMPREF9477_01320 [Lachnospiraceae bacterium 2_1_46FAA] Length = 410 Score = 60.7 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 21/46 (45%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A DFGVPQ+RERL + N V F FP KP L D+L Sbjct: 227 LNAWDFGVPQKRERLITVGIRNDLVGKVSFSFPKEHDYKPVLRDVL 272 >gi|311064356|ref|YP_003971081.1| cytosine methyl transferase Dcm [Bifidobacterium bifidum PRL2010] gi|310866675|gb|ADP36044.1| Dcm Cytosine methyl transferase [Bifidobacterium bifidum PRL2010] Length = 326 Score = 60.7 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 27/108 (25%), Positives = 44/108 (40%), Gaps = 23/108 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK------PR-------LGDILEEH 46 + A D+GVPQ R+R+ I+ N VEF +P P K PR + DI + Sbjct: 154 LNAADYGVPQTRQRVIIVGVRNDLDVEFTYPQPTNSKEGKNGLPRWISVQEAIKDIPDPD 213 Query: 47 -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93 D S +N+ + K+ + + + + T+ AR Sbjct: 214 GPDADSVPNNEYSQY--------KVKPRNYTGHRITDPDKPSPTILAR 253 >gi|325270473|ref|ZP_08137075.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] gi|324987196|gb|EGC19177.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] Length = 365 Score = 60.7 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 26/98 (26%), Positives = 49/98 (50%), Gaps = 13/98 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK---PRLGDILEE--HIDDKSTIS 54 +KA ++G+PQRRER+ I+ + + +++P P+ + L +++E D K S Sbjct: 158 LKAVEYGIPQRRERVIIVGIRDDLTFNYEYPAPVCTEAEATPLSAVIDELAITDSKYYFS 217 Query: 55 NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 + +G K+ +NN G L+ S T++A Sbjct: 218 ERAVQG-VKKAKNNMKRG------LWQSLSQPCLTITA 248 >gi|238025826|ref|YP_002910057.1| DNA cytosine methyltransferase M.NgoMIII [Burkholderia glumae BGR1] gi|237875020|gb|ACR27353.1| DNA cytosine methyltransferase M.NgoMIII [Burkholderia glumae BGR1] Length = 407 Score = 60.7 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 11/69 (15%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ+RER++I+ F + V++ FP P L + ++ + + WE Sbjct: 182 VNAADYGVPQKRERVFIVGFRSDLDVDWSFPRPTHSYDSL--LRDQWVTGEY------WE 233 Query: 60 GHQ--KRKE 66 HQ +R Sbjct: 234 RHQVPRRAR 242 >gi|23100788|ref|NP_694255.1| cytosine-specific DNA-methyltransferase [Oceanobacillus iheyensis HTE831] gi|22779022|dbj|BAC15289.1| cytosine-specific DNA-methyltransferase [Oceanobacillus iheyensis HTE831] Length = 370 Score = 60.7 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55 M D+G +PQ RER++I+ F + +F++P +G+ + ++++ + DD + Sbjct: 177 MNTMDYGNIPQNRERIFIVGFKDEEKYNKFQWPQKIGLTKSIDNVIDRSKKQDDAYYYTE 236 >gi|166163613|gb|ABY83631.1| DNA methyltransferase Cfr42I [Citrobacter freundii] Length = 402 Score = 60.3 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 9/62 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+G+PQ+RER++I+ F + +E+ FP P L I ++ + W+ Sbjct: 181 VNAADYGIPQKRERVFIVGFRDDLEIEWSFPKPTHSYDAL--IYDQWVTGDY------WK 232 Query: 60 GH 61 H Sbjct: 233 RH 234 >gi|325678044|ref|ZP_08157681.1| putative DNA (cytosine-5-)-methyltransferase [Ruminococcus albus 8] gi|324110261|gb|EGC04440.1| putative DNA (cytosine-5-)-methyltransferase [Ruminococcus albus 8] Length = 324 Score = 60.3 bits (146), Expect = 9e-08, Method: Composition-based stats. Identities = 20/82 (24%), Positives = 36/82 (43%), Gaps = 13/82 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEEHIDD------K 50 + A D+GVPQ+RER+ ++ N + ++ FP P + L + + + Sbjct: 155 INAADYGVPQKRERVIMVGIRNDIFQKNGDYSFPQPTNEGKWVP--LSVAVPELAIENQR 212 Query: 51 STISNKLWEGHQKRKENNKIAG 72 S K +G + +NN G Sbjct: 213 YYFSEKAVQGMKN-AKNNMKRG 233 >gi|328946253|gb|EGG40397.1| modification methylase Sau96I [Streptococcus sanguinis SK1087] Length = 333 Score = 60.3 bits (146), Expect = 9e-08, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDIL 43 + A D+GV Q+RER+ ++ N + F++P P KP L DIL Sbjct: 151 LNAWDYGVAQKRERMIMVGIRNDLTDKITFEYPEPHDYKPVLKDIL 196 >gi|256821199|ref|YP_003142398.1| DNA-cytosine methyltransferase [Anaerococcus prevotii DSM 20548] gi|256799179|gb|ACV29833.1| DNA-cytosine methyltransferase [Anaerococcus prevotii DSM 20548] Length = 321 Score = 60.3 bits (146), Expect = 9e-08, Method: Composition-based stats. Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 7/85 (8%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+RER++++ F + F +P L + LE++I + T++ Sbjct: 151 LNAMDFGIPQKRERIFVVSQFGENNFSFNKLERKETRP-LSEFLEKNISELYTMTQPYML 209 Query: 60 GHQKRKENNKIAG-----KGFGYGL 79 + +N G K F Y + Sbjct: 210 KFLNKGIDNSFKGRLKVIKDFSYTI 234 >gi|307140960|ref|ZP_07500316.1| DNA-cytosine methyltransferase [Escherichia coli H736] gi|331645014|ref|ZP_08346131.1| DNA cytosine methyltransferase M.NgoMIII [Escherichia coli H736] gi|331035989|gb|EGI08227.1| DNA cytosine methyltransferase M.NgoMIII [Escherichia coli H736] Length = 413 Score = 60.3 bits (146), Expect = 9e-08, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGI 35 + A D+GVPQ+RER++I+ F + +E+ FP P Sbjct: 192 VNAADYGVPQKRERVFIVGFRDDLEIEWSFPKPTHS 227 >gi|113477918|ref|YP_723979.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101] gi|110168966|gb|ABG53506.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101] Length = 337 Score = 60.3 bits (146), Expect = 9e-08, Method: Composition-based stats. Identities = 24/102 (23%), Positives = 40/102 (39%), Gaps = 22/102 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-----IDDKSTISN 55 + DFGVPQ R+R+ +I EF FP L K +G+ LEE + K ++ Sbjct: 155 LNTVDFGVPQNRQRVIVIG---HKGEFTFPQVLDKKVTVGEALEEMAFHAPPESKF-LTP 210 Query: 56 KLWEGHQKRKENNKIAGKGFGYGLFFENSAT----TNTLSAR 93 + + +K ++ + TL+ R Sbjct: 211 SMDKYIEKYEKASSCK---------QPRDLYLDKPARTLTCR 243 >gi|313668596|ref|YP_004048880.1| DNA cytosine methyltransferase [Neisseria lactamica ST-640] gi|313006058|emb|CBN87519.1| DNA cytosine methyltransferase [Neisseria lactamica 020-06] Length = 393 Score = 60.3 bits (146), Expect = 1e-07, Method: Composition-based stats. Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 21/98 (21%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ+RER+ I+ + +++KFP + RL +K + + WE Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKETHSEDRLN-------WEKYV-TGEYWE 221 Query: 60 GH-------QKRKENNKIAGKGFGYGLFFENSATTNTL 90 H + E + YG+F T+ Sbjct: 222 KHNEPKRFNKDIAEKLQKK-----YGIFEPEKKPWQTV 254 >gi|332970702|gb|EGK09683.1| DNA (cytosine-5-)-methyltransferase [Kingella kingae ATCC 23330] Length = 197 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46 + A +FGVPQ+RER++I+ F + +F+FP L K L L+E Sbjct: 144 LNASEFGVPQKRERVFIVGFRDDEDFFKFQFPETLPEKIPLKYALDEQ 191 >gi|218900598|ref|YP_002449009.1| modification methylase HaeIII [Bacillus cereus G9842] gi|218544695|gb|ACK97089.1| modification methylase HaeIII [Bacillus cereus G9842] Length = 313 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 20/107 (18%), Positives = 44/107 (41%), Gaps = 17/107 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDI-----LEEHIDDKSTIS 54 + A D+GVPQ R+R++I+ + + +PTP + D+ L++ + +S Sbjct: 145 LNAADYGVPQTRQRVFIVGVRKDLDLTYSYPTPTHEESPTFDLFNLNALQKWVTIGEALS 204 Query: 55 N--------KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93 + L ++ G+ + + + T++AR Sbjct: 205 DIPEPDEAHNLLNHVYS---QYRLKFNGYIGHRVTDPNKPSPTITAR 248 >gi|167751358|ref|ZP_02423485.1| hypothetical protein EUBSIR_02344 [Eubacterium siraeum DSM 15702] gi|167655604|gb|EDR99733.1| hypothetical protein EUBSIR_02344 [Eubacterium siraeum DSM 15702] Length = 316 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Query: 2 KACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHI--DDKSTISN 55 ACD+G+PQ R R YI+ F + F+FP ++ L D++++ + D+ +S Sbjct: 144 DACDYGIPQHRTRTYIVAFKSQKACDSFRFPEKCELQKHLFDVIDKTVKGKDRYYVSE 201 >gi|195867949|ref|ZP_03079946.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] gi|195660345|gb|EDX53605.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 9 str. ATCC 33175] Length = 319 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + D+G VPQ RER+YI+ FL+ FK+P P+ + + D+++ Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEAFKYPCPITLTNTIRDVID 192 >gi|171920707|ref|ZP_02931926.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] gi|185179015|ref|ZP_02964765.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] gi|188024024|ref|ZP_02996783.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] gi|188518336|ref|ZP_03003849.1| cytosine-specific methyltransferase NlaX [Ureaplasma urealyticum serovar 11 str. ATCC 33695] gi|188524309|ref|ZP_03004347.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] gi|198273488|ref|ZP_03206024.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] gi|225550923|ref|ZP_03771872.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar 2 str. ATCC 27814] gi|225551062|ref|ZP_03772008.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar 8 str. ATCC 27618] gi|171903447|gb|EDT49736.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 13 str. ATCC 33698] gi|184209104|gb|EDU06147.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 5 str. ATCC 27817] gi|188019052|gb|EDU57092.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 7 str. ATCC 27819] gi|188997975|gb|EDU67072.1| cytosine-specific methyltransferase NlaX [Ureaplasma urealyticum serovar 11 str. ATCC 33695] gi|195660089|gb|EDX53469.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 12 str. ATCC 33696] gi|198250008|gb|EDY74788.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar 4 str. ATCC 27816] gi|225378877|gb|EEH01242.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar 8 str. ATCC 27618] gi|225380077|gb|EEH02439.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar 2 str. ATCC 27814] Length = 319 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + D+G VPQ RER+YI+ FL+ FK+P P+ + + D+++ Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEAFKYPCPITLTNTIRDVID 192 >gi|34451619|gb|AAQ72366.1| TspRI methylase [Thermus sp. R] Length = 431 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT----PLGIKPRLG 40 + A DFGVPQ R+R++ + P +EF++P PLG P + Sbjct: 215 LNAADFGVPQHRKRIFFVGVR-PGIEFRWPRPTHGPLGEHPWVS 257 >gi|2765225|emb|CAA73243.1| methylase [Lactococcus lactis subsp. cremoris] Length = 317 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 5/58 (8%) Query: 2 KACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE--EHIDDKSTIS 54 A ++G +PQ RER+YI+ F N F+ P + +K + D+++ + DDK + Sbjct: 146 NASEYGNIPQNRERIYIVAFKNKKDYANFELPKSIPLKTTIHDVIDFSKKQDDKFYYT 203 >gi|59801568|ref|YP_208280.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae FA 1090] gi|194097887|ref|YP_002000932.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae NCCP11945] gi|239998362|ref|ZP_04718286.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae 35/02] gi|240113683|ref|ZP_04728173.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae MS11] gi|240116425|ref|ZP_04730487.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae PID18] gi|240117164|ref|ZP_04731226.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae PID1] gi|240125114|ref|ZP_04738000.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae SK-92-679] gi|254494438|ref|ZP_05107609.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae 1291] gi|260441646|ref|ZP_05795462.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae DGI2] gi|268594223|ref|ZP_06128390.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae 35/02] gi|268599750|ref|ZP_06133917.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae MS11] gi|268602094|ref|ZP_06136261.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID18] gi|268602852|ref|ZP_06137019.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID1] gi|268683710|ref|ZP_06150572.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae SK-92-679] gi|291045024|ref|ZP_06570732.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae DGI2] gi|10444408|gb|AAG17898.1|AF297971_2 DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae] gi|59718463|gb|AAW89868.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae FA 1090] gi|193933177|gb|ACF29001.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae NCCP11945] gi|226513478|gb|EEH62823.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae 1291] gi|268547612|gb|EEZ43030.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae 35/02] gi|268583881|gb|EEZ48557.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae MS11] gi|268586225|gb|EEZ50901.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID18] gi|268586983|gb|EEZ51659.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID1] gi|268623994|gb|EEZ56394.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae SK-92-679] gi|291011027|gb|EFE03024.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae DGI2] gi|317163651|gb|ADV07192.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae TCDC-NG08107] Length = 377 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 21/98 (21%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ+RER+ I+ + +++KFP + RL +K + + WE Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKRTHSEDRLN-------WEKYV-TGEYWE 221 Query: 60 GH-------QKRKENNKIAGKGFGYGLFFENSATTNTL 90 H + E + YG+F T+ Sbjct: 222 KHNEPKRFNKDIAEKLQKK-----YGIFEPEKKPWQTV 254 >gi|254445875|ref|ZP_05059351.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae bacterium DG1235] gi|198260183|gb|EDY84491.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae bacterium DG1235] Length = 321 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 22/45 (48%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ R+RLYI+ S EFKFP G + RL D+L Sbjct: 147 LNASDYGVPQARKRLYIVGIRKDLGSGEFKFPETSGARVRLKDLL 191 >gi|261839203|gb|ACX98968.1| DNA-cytosine methyltransferase [Helicobacter pylori 52] Length = 309 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISN-K 56 + ++ +PQ RER+YI+ FL+ + F FP + + D+LE + ++ + Sbjct: 142 LNTYEYSTIPQNRERIYIVGFLDKNHYKRFHFPLKVNHTQSIKDLLEIKVGEEFYYKQYR 201 Query: 57 LWEGHQK 63 +E +K Sbjct: 202 FYETLKK 208 >gi|256544753|ref|ZP_05472125.1| type II restriction-modification system methylation subunit [Anaerococcus vaginalis ATCC 51170] gi|256399642|gb|EEU13247.1| type II restriction-modification system methylation subunit [Anaerococcus vaginalis ATCC 51170] Length = 320 Score = 59.9 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ + F +P L D LE+ + + T++ + Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSDFLEKDVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|314055145|ref|YP_004063483.1| putative cytosine-specific methyltransferase [Ostreococcus tauri virus 2] gi|313575036|emb|CBI70049.1| putative cytosine-specific methyltransferase [Ostreococcus tauri virus 2] Length = 349 Score = 59.5 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 27/43 (62%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 +KA + GVPQ+RERL+I+ + F+FP P + L DIL Sbjct: 152 LKAHEHGVPQKRERLFIVGSRDADFTFEFPEPSNNEVGLKDIL 194 >gi|322511205|gb|ADX06517.1| putative C-5 cytosine specific DNA methyltransferase [Organic Lake phycodnavirus] Length = 384 Score = 59.5 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Query: 1 MKACDF-GVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + D G+P RER+YI+ + +V +F P K ++ + LE I +K ++K Sbjct: 214 LNTADITGIPHHRERIYIVCIKSKNVFDKFNLDFPKINKKKISEFLEHDIPEKYYYTDK 272 >gi|309380076|emb|CBX21487.1| putative DNA cytosine methyltransferase [Neisseria lactamica Y92-1009] Length = 377 Score = 59.5 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 21/98 (21%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ+RER+ I+ + +++KFP + RL +K + + WE Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKETHSEDRLN-------WEKYV-TGEYWE 221 Query: 60 GH-------QKRKENNKIAGKGFGYGLFFENSATTNTL 90 H + E + YG+F T+ Sbjct: 222 KHNEPKRFNKDIAEKLQKK-----YGIFEPEKKPWQTV 254 >gi|322376119|ref|ZP_08050628.1| DNA modification methylase [Streptococcus sp. C300] gi|321278887|gb|EFX55931.1| DNA modification methylase [Streptococcus sp. C300] Length = 406 Score = 59.5 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55 + D+G +PQ RER+YI+ F F+FP + + L D++ + +D+ Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDSFEFPEEIKLTTSLQDVINFGDKLDEVYYYRE 217 >gi|157151353|ref|YP_001449946.1| cytosine-specific methyltransferase [Streptococcus gordonii str. Challis substr. CH1] gi|157076147|gb|ABV10830.1| cytosine-specific methyltransferase [Streptococcus gordonii str. Challis substr. CH1] Length = 406 Score = 59.5 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55 + D+G +PQ RER+YI+ F FKFP + + L D++ + +D+ + Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFKFPEAIKLTTSLQDVINFGDKLDEVYYYRD 217 >gi|94995093|ref|YP_603191.1| Type II restriction-modification system methylation subunit [Streptococcus pyogenes MGAS10750] gi|94548601|gb|ABF38647.1| Type II restriction-modification system methylation subunit [Streptococcus pyogenes MGAS10750] Length = 321 Score = 59.5 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ L + F F + R L + LE+++ + T++ + Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFDKLERKETRPLSEFLEKNVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|291549830|emb|CBL26092.1| DNA-methyltransferase (dcm) [Ruminococcus torques L2-14] Length = 410 Score = 59.5 bits (144), Expect = 2e-07, Method: Composition-based stats. Identities = 21/46 (45%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ+RERL I N F FP KP L DIL Sbjct: 227 LNAWDYGVPQKRERLITIGIRNDLVEKTSFTFPKEQEYKPVLRDIL 272 >gi|313890914|ref|ZP_07824537.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus SPIN 20026] gi|313120711|gb|EFR43827.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus SPIN 20026] Length = 316 Score = 59.2 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ + F +P L D LE+ + + T++ + Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSDFLEKDVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|193216537|ref|YP_001999779.1| cytosine-specific methyltransferase, related to HhaI [Mycoplasma arthritidis 158L3-1] gi|193001860|gb|ACF07075.1| cytosine-specific methyltransferase, related to HhaI [Mycoplasma arthritidis 158L3-1] Length = 327 Score = 59.2 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKP 37 + + +FGVPQ+RER+Y++ F F FP P + Sbjct: 152 LNSLNFGVPQKRERIYMVCFRRDLNIKNFSFPKPFKLST 190 >gi|77409601|ref|ZP_00786278.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae COH1] gi|77171795|gb|EAO74987.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae COH1] Length = 333 Score = 59.2 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 28/100 (28%), Positives = 40/100 (40%), Gaps = 27/100 (27%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A D+GV Q+RER+ ++ N V F++P P KP L DIL + S + Sbjct: 151 LNAWDYGVAQKRERMIMVGIRNDLVNMTSFEYPKPHDYKPVLRDILLDCPP-----SQGM 205 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97 QKRK + L Y+KD Sbjct: 206 QYSEQKRKI----------FELVPPGG---------YWKD 226 >gi|319779706|ref|YP_004130619.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9] gi|317109730|gb|ADU92476.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9] Length = 329 Score = 59.2 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + +CD+G+PQ R R++++ F EFKFP P + + DIL Sbjct: 152 LNSCDYGIPQSRARIFMVAFREDLKHQEFKFPAPKNLDKYVEDILLPD 199 >gi|153933427|ref|YP_001385281.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. ATCC 19397] gi|153933974|ref|YP_001384769.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. ATCC 19397] gi|153935154|ref|YP_001386762.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. Hall] gi|153935271|ref|YP_001386815.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. Hall] gi|153937696|ref|YP_001388073.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. Hall] gi|152929471|gb|ABS34971.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. ATCC 19397] gi|152930018|gb|ABS35518.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. ATCC 19397] gi|152931068|gb|ABS36567.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. Hall] gi|152931185|gb|ABS36684.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. Hall] gi|152933610|gb|ABS39109.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. Hall] Length = 315 Score = 59.2 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 11/93 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-PRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++ I L+ ++ F F K P + + LE+ ++K ++ + Sbjct: 149 LNALDFGLPQKRERVFTISCLDGTL-FNFNALERKKAPHIREFLEDTQEEKYIVTQPSML 207 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91 K+ + G FG G + +T++ Sbjct: 208 ------KKMHDKNGN-FG-GRVEVINDCCSTIT 232 >gi|209554428|ref|YP_002284952.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 10 str. ATCC 33699] gi|209541929|gb|ACI60158.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 10 str. ATCC 33699] Length = 319 Score = 59.2 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44 + D+G VPQ RER+YI+ FL+ FK+P P+ + + D+++ Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEVFKYPCPITLTNTIRDVID 192 >gi|169824652|ref|YP_001692263.1| cytosine-specific DNA-methyltransferase [Finegoldia magna ATCC 29328] gi|297588631|ref|ZP_06947274.1| type II restriction-modification system methylation subunit [Finegoldia magna ATCC 53516] gi|304440076|ref|ZP_07399968.1| type II restriction-modification system methylation subunit [Peptoniphilus duerdenii ATCC BAA-1640] gi|167831457|dbj|BAG08373.1| cytosine-specific DNA-methyltransferase [Finegoldia magna ATCC 29328] gi|297574004|gb|EFH92725.1| type II restriction-modification system methylation subunit [Finegoldia magna ATCC 53516] gi|304371443|gb|EFM25057.1| type II restriction-modification system methylation subunit [Peptoniphilus duerdenii ATCC BAA-1640] Length = 320 Score = 59.2 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 7/85 (8%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+RER++++ + F +P L + LE+ + + T++ Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209 Query: 60 GHQKRKENNKIAG-----KGFGYGL 79 + +N G K F Y + Sbjct: 210 KFLNKSIDNSFRGRLKVIKDFSYTI 234 >gi|326802740|ref|YP_004320558.1| DNA (cytosine-5-)-methyltransferase [Aerococcus urinae ACS-120-V-Col10a] gi|326651598|gb|AEA01781.1| DNA (cytosine-5-)-methyltransferase [Aerococcus urinae ACS-120-V-Col10a] Length = 321 Score = 59.2 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 7/85 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+RER++++ L + F F + R L + LE+ + T++ Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-SFSFDKLERKETRPLSEFLEKDVSGLYTMTQPYML 209 Query: 60 GHQKRKENNKIAG-----KGFGYGL 79 + +N G K F Y + Sbjct: 210 KFLNKGIDNSFKGRLKVIKDFSYTI 234 >gi|332362221|gb|EGJ40021.1| DNA methylase [Streptococcus sanguinis SK1056] Length = 412 Score = 58.8 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55 + D+G +PQ RER+YI+ F F+FP + + L D++ + +D+ Sbjct: 164 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTTLQDVINFGDQLDEVYYYRE 223 >gi|239812977|ref|YP_002941924.1| DNA-cytosine methyltransferase [Geobacillus sp. WCH70] gi|239809042|gb|ACS26105.1| DNA-cytosine methyltransferase [Geobacillus sp. WCH70] Length = 370 Score = 58.8 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 11/64 (17%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK---------PRLGDILEE-HIDD 49 + A D+GVPQ+RER++II N +++++FP P + +G++LE +++ Sbjct: 172 INAADYGVPQKRERVFIIGVRNDLNIQYEFPEPTHNEDGSDGKLPWVTVGEVLENLQVEE 231 Query: 50 KSTI 53 I Sbjct: 232 HHFI 235 >gi|307067513|ref|YP_003876479.1| site-specific DNA methylase [Streptococcus pneumoniae AP200] gi|306409050|gb|ADM84477.1| Site-specific DNA methylase [Streptococcus pneumoniae AP200] Length = 321 Score = 58.8 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ +L + F +P L + LE + + T++ + Sbjct: 151 LNAMDFGIPQKRERIFVVSYLGANNFSFNKLERKETRP-LSEFLENDVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|189339547|pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Score = 58.8 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RE +Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKRENIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|189096047|pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327 Score = 58.8 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+ ER+Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKNERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|195867543|ref|ZP_03079546.1| type II restriction-modification system methylation subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] gi|195867960|ref|ZP_03079957.1| type II restriction-modification system methylation subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] gi|195660356|gb|EDX53616.1| type II restriction-modification system methylation subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] gi|195660787|gb|EDX54041.1| type II restriction-modification system methylation subunit [Ureaplasma urealyticum serovar 9 str. ATCC 33175] Length = 323 Score = 58.8 bits (142), Expect = 3e-07, Method: Composition-based stats. Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 7/85 (8%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+RER++++ + F +P L + LE+ + + T++ Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209 Query: 60 GHQKRKENNKIAG-----KGFGYGL 79 + +N G K F Y + Sbjct: 210 KFLNKGIDNSFKGRLKVIKDFSYTI 234 >gi|294668765|ref|ZP_06733858.1| modification methylase BsuRI [Neisseria elongata subsp. glycolytica ATCC 29315] gi|291309282|gb|EFE50525.1| modification methylase BsuRI [Neisseria elongata subsp. glycolytica ATCC 29315] Length = 313 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 10/76 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG------IKPRLGDILEEHID---DK 50 + A D+GVPQ R+R++I+ N E+ FP P +G+ L D + Sbjct: 141 LNAADYGVPQLRKRIFIVGIRNDIGAEYTFPAPTHGTEGKPPHITIGEALRGMPDWPEGE 200 Query: 51 STISNKLWEGHQKRKE 66 W + + Sbjct: 201 YYDRPFHWYYLSRNRR 216 >gi|312902257|ref|ZP_07761465.1| helix-turn-helix protein [Enterococcus faecalis TX0635] gi|283466064|emb|CBG92839.1| hypothetical protein [Enterococcus casseliflavus] gi|310634316|gb|EFQ17599.1| helix-turn-helix protein [Enterococcus faecalis TX0635] Length = 470 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEEHIDD 49 + A ++GV Q+RER+ II N E FKFP +P L D+L++ Sbjct: 286 LNAWNYGVAQKRERIVIIGIRNDLFEQQQYSFKFPKEYTYQPVLRDVLKDVPKS 339 >gi|261840146|gb|ACX99911.1| cytosine-specific methyltransferase [Helicobacter pylori 52] Length = 343 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A + GV Q+RERL+I+ + F FP PL K L DIL Sbjct: 151 LNASNHGVAQKRERLFIVGIRKDLNRSFNFPKPLKNKKVLKDIL 194 >gi|257867246|ref|ZP_05646899.1| DNA methyltransferase [Enterococcus casseliflavus EC30] gi|257873580|ref|ZP_05653233.1| DNA methyltransferase [Enterococcus casseliflavus EC10] gi|257801302|gb|EEV30232.1| DNA methyltransferase [Enterococcus casseliflavus EC30] gi|257807744|gb|EEV36566.1| DNA methyltransferase [Enterococcus casseliflavus EC10] Length = 470 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEEHIDD 49 + A ++GV Q+RER+ II N E FKFP +P L D+L++ Sbjct: 286 LNAWNYGVAQKRERIVIIGIRNDLFEQQQYSFKFPKEYTYQPVLRDVLKDVPKS 339 >gi|209901299|ref|YP_002290938.1| putative DNA methylase [Clostridium phage phiCD27] gi|199612180|gb|ACH91353.1| putative DNA methylase [Clostridium phage phiCD27] Length = 276 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDI 42 + + +FGVPQ RER++I+ F S FP + L + Sbjct: 150 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSRKNLEQL 192 >gi|284051619|ref|ZP_06381829.1| DNA-cytosine methyltransferase [Arthrospira platensis str. Paraca] Length = 443 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILE 44 + A DFG+PQ R+R++I+ N F+FP PL P+L + +E Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206 >gi|313888225|ref|ZP_07821897.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus harei ACS-146-V-Sch2b] gi|312845756|gb|EFR33145.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus harei ACS-146-V-Sch2b] Length = 321 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 7/85 (8%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+RER++++ + F +P L + LE+ + + T++ Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209 Query: 60 GHQKRKENNKIAG-----KGFGYGL 79 + +N G K F Y + Sbjct: 210 KFLNKGIDNSFKGRLKVIKDFSYTI 234 >gi|126698504|ref|YP_001087401.1| putative DNA methylase [Clostridium difficile 630] gi|115249941|emb|CAJ67761.1| putative phage DNA modification methylase [Clostridium difficile] Length = 357 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDI 42 + + +FGVPQ RER++I+ F S FP + L + Sbjct: 150 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSRKNLEQL 192 >gi|307710826|ref|ZP_07647254.1| DNA-cytosine methyltransferase family protein [Streptococcus mitis SK321] gi|307617432|gb|EFN96604.1| DNA-cytosine methyltransferase family protein [Streptococcus mitis SK321] Length = 406 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55 + D+G +PQ RER+YI+ F F+FP + + L D++ + +D+ Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTSLQDVINFGDKLDEVYYYRE 217 >gi|291570812|dbj|BAI93084.1| cytosine-specific DNA methyltransferase [Arthrospira platensis NIES-39] Length = 443 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILE 44 + A DFG+PQ R+R++I+ N F+FP PL P+L + +E Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206 >gi|158431504|pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy Length = 327 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQ+RE +Y+I F N F+FP P + + D+L Sbjct: 152 LNALDYGIPQKREAIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199 >gi|254825117|ref|ZP_05230118.1| DNA-cytosine methyltransferase [Listeria monocytogenes FSL J1-194] gi|293594360|gb|EFG02121.1| DNA-cytosine methyltransferase [Listeria monocytogenes FSL J1-194] Length = 326 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + DFG+PQ+RER+Y + L+ P +F ++P + + LE +DD TI Sbjct: 149 LNPMDFGIPQKRERIYTVSVLSGPQFDFSKLKKEPMRP-INEFLETDVDDIYTIK 202 >gi|302380785|ref|ZP_07269249.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna ACS-171-V-Col3] gi|302311385|gb|EFK93402.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna ACS-171-V-Col3] Length = 321 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ L + F F + R L + LE+ + T++ + Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-SFSFDKLERKETRPLSEFLEKDVSGLYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|20385949|gb|AAM21516.1|AF438205_2 GST-M.SPRX methyltransferase fusion protein [Mutation screening vector pSPRX] Length = 659 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 21/85 (24%), Positives = 31/85 (36%), Gaps = 30/85 (35%) Query: 1 MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30 + + F VPQ RERLYII S F++ Sbjct: 375 LNSKFFNVPQNRERLYIIGIREDLIKNEEWSLDFKRKDILQKGKQRLVELDIKSFNFRWT 434 Query: 31 TPLGIKPRLGDILEEHIDDKSTISN 55 RL D+LEE++D+K ++ Sbjct: 435 AQSAATKRLKDLLEEYVDEKYYLNE 459 >gi|108563484|ref|YP_627800.1| type II DNA modification enzyme [Helicobacter pylori HPAG1] gi|107837257|gb|ABF85126.1| type II DNA modification enzyme [Helicobacter pylori HPAG1] Length = 313 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 19/72 (26%), Positives = 31/72 (43%), Gaps = 4/72 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK--L 57 + + DF + Q+RERLYI+ F F FP L D L+ ++ +N Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFNDFLDAD-NECYLDTNNATF 197 Query: 58 WEGHQKRKENNK 69 + R +N+ Sbjct: 198 QRYLRNRYNHNR 209 >gi|306824635|ref|ZP_07457980.1| DNA methylase [Streptococcus sp. oral taxon 071 str. 73H25AP] gi|304433203|gb|EFM36174.1| DNA methylase [Streptococcus sp. oral taxon 071 str. 73H25AP] Length = 410 Score = 58.4 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55 + D+G +PQ RER+YI+ F F+FP + + L D++ + +D+ Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTTLQDVINFGDKLDEVYYYRE 217 >gi|216171|gb|AAA32604.1| DNA methyltransferase [Bacillus phage SPR] Length = 439 Score = 58.4 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 21/85 (24%), Positives = 31/85 (36%), Gaps = 30/85 (35%) Query: 1 MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30 + + F VPQ RERLYII S F++ Sbjct: 149 LNSKFFNVPQNRERLYIIGIREDLIKNEEWSLDFKRKDILQKGKQRLVELDIKSFNFRWT 208 Query: 31 TPLGIKPRLGDILEEHIDDKSTISN 55 RL D+LEE++D+K ++ Sbjct: 209 AQSAATKRLKDLLEEYVDEKYYLNE 233 >gi|322392562|ref|ZP_08066022.1| DNA methylase [Streptococcus peroris ATCC 700780] gi|321144554|gb|EFX39955.1| DNA methylase [Streptococcus peroris ATCC 700780] Length = 406 Score = 58.4 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55 + D+G +PQ RER+YI+ F F+FP + + L D++ + +D+ Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTSLQDVINFGDQLDEVYYYRE 217 >gi|127431|sp|P00476|MTBS_BPSPR RecName: Full=Modification methylase SPRI; Short=M.SPRI; AltName: Full=Cytosine-specific methyltransferase SPRI gi|224091|prf||1010250A methyltransferase Length = 439 Score = 58.4 bits (141), Expect = 4e-07, Method: Composition-based stats. Identities = 21/85 (24%), Positives = 31/85 (36%), Gaps = 30/85 (35%) Query: 1 MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30 + + F VPQ RERLYII S F++ Sbjct: 149 LNSKFFNVPQNRERLYIIGIREDLIKNEEWSLDFKRKDILQKGKQRLVELDIKSFNFRWT 208 Query: 31 TPLGIKPRLGDILEEHIDDKSTISN 55 RL D+LEE++D+K ++ Sbjct: 209 AQSAATKRLKDLLEEYVDEKYYLNE 233 >gi|282883032|ref|ZP_06291633.1| type II restriction-modification system methylation subunit [Peptoniphilus lacrimalis 315-B] gi|281297089|gb|EFA89584.1| type II restriction-modification system methylation subunit [Peptoniphilus lacrimalis 315-B] Length = 312 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ + F +P L + LE+++ + T++ + Sbjct: 151 LNAVDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKNVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|228899601|ref|ZP_04063856.1| Modification methylase SinI [Bacillus thuringiensis IBL 4222] gi|228860031|gb|EEN04436.1| Modification methylase SinI [Bacillus thuringiensis IBL 4222] Length = 362 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 + A ++GVPQ+RER++II F+FP P + Sbjct: 171 LNAANYGVPQKRERVFIIGIRQDLKKTFEFPEPTHNE 207 >gi|134287405|ref|YP_001110788.1| putative cytosine-C5 specific DNA methylase [Clostridium phage phiC2] gi|93117243|gb|ABE99533.1| putative cytosine-C5 specific DNA methylase [Clostridium phage phiC2] Length = 316 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDI 42 + + +FGVPQ RER++I+ F S FP + L + Sbjct: 133 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSRKNLEQL 175 >gi|300813808|ref|ZP_07094115.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus sp. oral taxon 836 str. F0141] gi|300512098|gb|EFK39291.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus sp. oral taxon 836 str. F0141] Length = 321 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ + F +P L + LE+ + + T++ + Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|240128365|ref|ZP_04741026.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae SK-93-1035] gi|268686763|ref|ZP_06153625.1| DNA modification methylase [Neisseria gonorrhoeae SK-93-1035] gi|268627047|gb|EEZ59447.1| DNA modification methylase [Neisseria gonorrhoeae SK-93-1035] Length = 423 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + T S+ + Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 213 LLKKFPPSELYGK 225 >gi|79835495|gb|ABB52098.1| Mod [Arthrospira platensis] Length = 412 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILE 44 + A DFG+PQ R+R++I+ N F+FP PL P+L + +E Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206 >gi|59801103|ref|YP_207815.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae FA 1090] gi|121634967|ref|YP_975212.1| DNA modification methylase [Neisseria meningitidis FAM18] gi|194098793|ref|YP_002001855.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae NCCP11945] gi|239999085|ref|ZP_04719009.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae 35/02] gi|240014008|ref|ZP_04720921.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae DGI18] gi|240016449|ref|ZP_04722989.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae FA6140] gi|240080568|ref|ZP_04725111.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae FA19] gi|240113063|ref|ZP_04727553.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae MS11] gi|240115818|ref|ZP_04729880.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae PID18] gi|240118116|ref|ZP_04732178.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae PID1] gi|240121574|ref|ZP_04734536.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae PID24-1] gi|240123666|ref|ZP_04736622.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae PID332] gi|240125856|ref|ZP_04738742.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae SK-92-679] gi|254493863|ref|ZP_05107034.1| DNA modification methylase [Neisseria gonorrhoeae 1291] gi|260440365|ref|ZP_05794181.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae DGI2] gi|268594923|ref|ZP_06129090.1| DNA modification methylase [Neisseria gonorrhoeae 35/02] gi|268596698|ref|ZP_06130865.1| DNA modification methylase [Neisseria gonorrhoeae FA19] gi|268599147|ref|ZP_06133314.1| DNA modification methylase [Neisseria gonorrhoeae MS11] gi|268601493|ref|ZP_06135660.1| DNA modification methylase [Neisseria gonorrhoeae PID18] gi|268603831|ref|ZP_06137998.1| DNA modification methylase [Neisseria gonorrhoeae PID1] gi|268682295|ref|ZP_06149157.1| DNA modification methylase [Neisseria gonorrhoeae PID332] gi|268684453|ref|ZP_06151315.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679] gi|291043662|ref|ZP_06569378.1| DNA modification methylase [Neisseria gonorrhoeae DGI2] gi|293398965|ref|ZP_06643130.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|59717998|gb|AAW89403.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae FA 1090] gi|120866673|emb|CAM10425.1| DNA modification methylase [Neisseria meningitidis FAM18] gi|193934083|gb|ACF29907.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae NCCP11945] gi|226512903|gb|EEH62248.1| DNA modification methylase [Neisseria gonorrhoeae 1291] gi|268548312|gb|EEZ43730.1| DNA modification methylase [Neisseria gonorrhoeae 35/02] gi|268550486|gb|EEZ45505.1| DNA modification methylase [Neisseria gonorrhoeae FA19] gi|268583278|gb|EEZ47954.1| DNA modification methylase [Neisseria gonorrhoeae MS11] gi|268585624|gb|EEZ50300.1| DNA modification methylase [Neisseria gonorrhoeae PID18] gi|268587962|gb|EEZ52638.1| DNA modification methylase [Neisseria gonorrhoeae PID1] gi|268622579|gb|EEZ54979.1| DNA modification methylase [Neisseria gonorrhoeae PID332] gi|268624737|gb|EEZ57137.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679] gi|291012125|gb|EFE04114.1| DNA modification methylase [Neisseria gonorrhoeae DGI2] gi|291610379|gb|EFF39489.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|317164377|gb|ADV07918.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae TCDC-NG08107] Length = 423 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + T S+ + Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 213 LLKKFPPSELYGK 225 >gi|218768275|ref|YP_002342787.1| DNA modification methylase [Neisseria meningitidis Z2491] gi|121052283|emb|CAM08611.1| DNA modification methylase [Neisseria meningitidis Z2491] Length = 423 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + T S+ + Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 213 LLKKFPPSELYGK 225 >gi|308061704|gb|ADO03592.1| DNA-cytosine methyltransferase [Helicobacter pylori Cuz20] gi|308063214|gb|ADO05101.1| DNA-cytosine methyltransferase [Helicobacter pylori Sat464] gi|317180749|dbj|BAJ58535.1| DNA-cytosine methyltransferase [Helicobacter pylori F32] Length = 309 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISN-K 56 + ++ +PQ RER+YII FL+ + F FP + + D+LE + ++ + Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYYKQYR 201 Query: 57 LWEGHQK 63 +E +K Sbjct: 202 FYETLKK 208 >gi|227484740|ref|ZP_03915056.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus lactolyticus ATCC 51172] gi|227237262|gb|EEI87277.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus lactolyticus ATCC 51172] Length = 321 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ + F +P L + LE+ + + T++ + Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|188527161|ref|YP_001909848.1| DNA-cytosine methyltransferase [Helicobacter pylori Shi470] gi|188143401|gb|ACD47818.1| DNA-cytosine methyltransferase [Helicobacter pylori Shi470] Length = 309 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISN-K 56 + ++ +PQ RER+YII FL+ + F FP + + D+LE + ++ + Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYYKQYR 201 Query: 57 LWEGHQK 63 +E +K Sbjct: 202 FYETLKK 208 >gi|317181696|dbj|BAJ59480.1| DNA-cytosine methyltransferase [Helicobacter pylori F57] Length = 309 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISN-K 56 + ++ +PQ RER+YII FL+ + F FP + + D+LE + ++ + Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYYKQYR 201 Query: 57 LWEGHQK 63 +E +K Sbjct: 202 FYETLKK 208 >gi|325849320|ref|ZP_08170737.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis ACS-025-V-Sch4] gi|325480182|gb|EGC83251.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis ACS-025-V-Sch4] Length = 321 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ + F +P L + LE+ + + T++ + Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|317008995|gb|ADU79575.1| DNA-cytosine methyltransferase [Helicobacter pylori India7] Length = 309 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + ++ +PQ RER+YII FL+ + F FP + + D+LE + ++ Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDENHYKRFHFPLKINHTQSIKDLLEIKVGEEFYYK 198 >gi|168335325|ref|ZP_02693422.1| DNA-cytosine methyltransferase [Epulopiscium sp. 'N.t. morphotype B'] Length = 324 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GV Q R+R++ I F +++F+FP P KP L DIL Sbjct: 143 LNANDYGVAQDRKRVFYIGFRKDLNIKFEFPKPQEYKPVLRDIL 186 >gi|313677762|ref|YP_004055758.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] gi|312944460|gb|ADR23650.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] Length = 378 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 16/98 (16%) Query: 2 KACDFGVPQRRERLYIIDFLN--PSVEFKFPTPL---GIKPRLGDILEEHI--DDKSTIS 54 A ++GVPQ+RER++II F N F FP P K +L +++++ D+K S Sbjct: 166 NASEYGVPQKRERVFIIGFKNYEDFAYFNFPQPTTLNDSKVKLKEVIDKKANKDEKWFFS 225 Query: 55 NKLWEGHQK-RKENNKIAGKGFGYGLFFENSATTNTLS 91 + +G + +K+ NK + NT+S Sbjct: 226 QRAVDGMMRVQKKMNKGRDQN--------LEEPCNTIS 255 >gi|261400634|ref|ZP_05986759.1| DNA (cytosine-5-)-methyltransferase [Neisseria lactamica ATCC 23970] gi|313668389|ref|YP_004048673.1| DNA modification methylase [Neisseria lactamica ST-640] gi|1709164|sp|P50182|MTN4_NEILA RecName: Full=Modification methylase NlaIV; Short=M.NlaIV; AltName: Full=Cytosine-specific methyltransferase NlaIV gi|476227|gb|AAA53237.1| M.NlaIV [Neisseria lactamica] gi|269209540|gb|EEZ75995.1| DNA (cytosine-5-)-methyltransferase [Neisseria lactamica ATCC 23970] gi|313005851|emb|CBN87307.1| DNA modification methylase [Neisseria lactamica 020-06] Length = 423 Score = 58.0 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + T S+ + Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTPS--PKLKNILESGLP---TESSPFIKK 212 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 213 LLKKFPPSELYGK 225 >gi|210135280|ref|YP_002301719.1| type II R-M system methyltransferase [Helicobacter pylori P12] gi|210133248|gb|ACJ08239.1| type II R-M system methyltransferase [Helicobacter pylori P12] Length = 315 Score = 58.0 bits (140), Expect = 5e-07, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN-KLW 58 + + DF + Q RER+YI+ F F FP L D L+ + I+N Sbjct: 139 LNSADFQLAQNRERIYIVGFRKDLKHPFNFPLGLANDYYFKDFLDADNECYLDINNATFQ 198 Query: 59 EGHQKRKENNK 69 + + +N+ Sbjct: 199 KYLHNKYNHNR 209 >gi|304387455|ref|ZP_07369646.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC 13091] gi|304338548|gb|EFM04667.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC 13091] Length = 273 Score = 57.6 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + T S+ + Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 213 LLKKFPPSELYGK 225 >gi|254673505|emb|CBA08927.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha275] Length = 273 Score = 57.6 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + T S+ + Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 213 LLKKFPPSELYGK 225 >gi|325846341|ref|ZP_08169331.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis ACS-025-V-Sch4] gi|325481605|gb|EGC84644.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis ACS-025-V-Sch4] Length = 315 Score = 57.6 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ + F +P L + LE+++ + T++ + Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKNVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|303233873|ref|ZP_07320524.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna BVS033A4] gi|302495017|gb|EFL54772.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna BVS033A4] Length = 315 Score = 57.6 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+RER++++ + F +P L + LE+++ + T++ + Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKNVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|254410261|ref|ZP_05024041.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196183297|gb|EDX78281.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 384 Score = 57.6 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 6/62 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL------EEHIDDKSTIS 54 + + DFGVPQ RER+ I+ N F +L + L E D T+ Sbjct: 144 LNSKDFGVPQNRERIIIVATKNKQFNFNKLKKNKCVAKLKNFLFNSENFEYLEPDSYTLI 203 Query: 55 NK 56 +K Sbjct: 204 DK 205 >gi|261379604|ref|ZP_05984177.1| modification methylase EcoRII [Neisseria subflava NJ9703] gi|284798084|gb|EFC53431.1| modification methylase EcoRII [Neisseria subflava NJ9703] Length = 320 Score = 57.6 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 15/70 (21%), Positives = 31/70 (44%), Gaps = 7/70 (10%) Query: 1 MKACDF-GVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDK--STI 53 M ++ +PQ RER++I+ F +F FP + + + DIL++ + Sbjct: 149 MNTAEYANIPQNRERIFIVAFNKDHNFDTSKFDFPKKIKLTKSIHDILDKEKQEDIYYYD 208 Query: 54 SNKLWEGHQK 63 +K ++ Sbjct: 209 KSKYISQLKE 218 >gi|254671396|emb|CBA08870.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha153] Length = 157 Score = 57.6 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + T S+ + Sbjct: 42 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 96 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 97 LLKKFPPSELYGK 109 >gi|160934346|ref|ZP_02081733.1| hypothetical protein CLOLEP_03217 [Clostridium leptum DSM 753] gi|156867019|gb|EDO60391.1| hypothetical protein CLOLEP_03217 [Clostridium leptum DSM 753] Length = 433 Score = 57.6 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A D+GV Q+RERL I N ++F FP P KP L DIL Sbjct: 251 LNAWDYGVAQKRERLITIGIRNDLVQKIKFDFPAPHKYKPVLRDIL 296 >gi|309378580|emb|CBX22758.1| DNA cytosine methyltransferase M.NlaIV [Neisseria lactamica Y92-1009] Length = 380 Score = 57.6 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + T S+ + Sbjct: 115 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTPS--PKLKNILESGLP---TESSPFIKK 169 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 170 LLKKFPPSELYGK 182 >gi|161870123|ref|YP_001599293.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442] gi|225075874|ref|ZP_03719073.1| hypothetical protein NEIFLAOT_00897 [Neisseria flavescens NRL30031/H210] gi|296313674|ref|ZP_06863615.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC 43768] gi|161595676|gb|ABX73336.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442] gi|224952820|gb|EEG34029.1| hypothetical protein NEIFLAOT_00897 [Neisseria flavescens NRL30031/H210] gi|296839734|gb|EFH23672.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC 43768] Length = 423 Score = 57.6 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T L P+L +ILE + T S+ + Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLP---TESSPFIKK 212 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 213 LLKKFPPSELYGK 225 >gi|15676920|ref|NP_274067.1| modification methylase NlaIV [Neisseria meningitidis MC58] gi|7226272|gb|AAF41432.1| modification methylase NlaIV [Neisseria meningitidis MC58] gi|325136241|gb|EGC58849.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579] gi|325202033|gb|ADY97487.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149] gi|325208214|gb|ADZ03666.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis NZ-05/33] Length = 423 Score = 57.6 bits (139), Expect = 6e-07, Method: Composition-based stats. Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T L P+L +ILE + T S+ + Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLP---TESSPFIKK 212 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 213 LLKKFPPSELYGK 225 >gi|290343528|ref|YP_003494895.1| hypothetical protein OTV1_055 [Ostreococcus tauri virus 1] gi|260160943|emb|CAY39643.1| hypothetical protein OTV1_055 [Ostreococcus tauri virus 1] Length = 351 Score = 57.2 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 19/43 (44%), Positives = 25/43 (58%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 +KA + GVPQ+RERL+I+ + F FP P L DIL Sbjct: 154 LKAHEHGVPQKRERLFIVGSRDVDFTFDFPEPSANDVGLKDIL 196 >gi|77918034|ref|YP_355849.1| C-5 cytosine-specific DNA methylase [Pelobacter carbinolicus DSM 2380] gi|77544117|gb|ABA87679.1| C-5 cytosine-specific DNA methylase [Pelobacter carbinolicus DSM 2380] Length = 405 Score = 57.2 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 + A ++GVPQ RER++I+ + EF+FP P P Sbjct: 163 LNAANYGVPQVRERVFIVGSRDGK-EFQFPEPTHQNPE 199 >gi|325130383|gb|EGC53149.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304] Length = 425 Score = 57.2 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T L P+L +ILE + T S+ + Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLP---TESSPFIKK 212 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 213 LLKKFPPSELYGK 225 >gi|261838450|gb|ACX98216.1| type II m5C methylase [Helicobacter pylori 51] Length = 318 Score = 57.2 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + DF + Q+RERLYI+ F F FP L D L+ ++ +N Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAD-NECYLDTNN--A 201 Query: 60 GHQKR 64 Q+ Sbjct: 202 TFQRY 206 >gi|316984658|gb|EFV63622.1| modification methylase NlaIV [Neisseria meningitidis H44/76] Length = 171 Score = 57.2 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG+PQ R+R+Y+ L + F T P+L +ILE + T S+ + Sbjct: 56 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 110 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 111 LLKKFPPSELYGK 123 >gi|330998524|ref|ZP_08322345.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT 11841] gi|329568255|gb|EGG50071.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT 11841] Length = 379 Score = 57.2 bits (138), Expect = 8e-07, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 9/62 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQRRER+ I+ N +V + FP + E + DK + WE Sbjct: 171 LNAADYGVPQRRERVVIVGIRNDLNVAWNFPEGTHSQ-------EALLWDKYV-TGSYWE 222 Query: 60 GH 61 H Sbjct: 223 RH 224 >gi|254411906|ref|ZP_05025682.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196181628|gb|EDX76616.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 456 Score = 57.2 bits (138), Expect = 8e-07, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + + DFG+PQ R+R++I+ N S F FP PLG +L D++ Sbjct: 173 LNSYDFGLPQDRDRVFIVGIRNDIEKSKSFDFPKPLGKPIKLYDVI 218 >gi|15894505|ref|NP_347854.1| DNA-methyltransferase (cytosine-specific) [Clostridium acetobutylicum ATCC 824] gi|15024146|gb|AAK79194.1|AE007635_8 DNA-methyltransferase (cytosine-specific) [Clostridium acetobutylicum ATCC 824] gi|325508636|gb|ADZ20272.1| DNA-methyltransferase (cytosine-specific) [Clostridium acetobutylicum EA 2018] Length = 314 Score = 56.8 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Query: 1 MKACDFGVPQRRERLY-IIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + A DFG+PQRRER++ I +F ++P L L+ ++D+ T++ Sbjct: 154 LNAMDFGLPQRRERVFTISCLDGKKFDFDKLEHRKLRP-LSSFLQTNVDEYYTVT 207 >gi|325979448|ref|YP_004289164.1| DNA (cytosine-5-)-methyltransferase [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] gi|325179376|emb|CBZ49420.1| DNA (cytosine-5-)-methyltransferase [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] Length = 333 Score = 56.8 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A DFGV Q+RER+ ++ N F++P KP L D+L Sbjct: 151 LNAWDFGVAQKRERMIMVGIRNDLANKTSFEYPEAHAYKPVLRDVL 196 >gi|325478388|gb|EGC81503.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus prevotii ACS-065-V-Col13] Length = 321 Score = 56.8 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 7/85 (8%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+RER++++ + F +P L + LE + + T++ Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLENDVSELYTMTQPYML 209 Query: 60 GHQKRKENNKIAG-----KGFGYGL 79 + +N G K F Y + Sbjct: 210 KFLNKGIDNSFRGRLKVIKAFSYTI 234 >gi|291530357|emb|CBK95942.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3] Length = 317 Score = 56.8 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 10/99 (10%) Query: 2 KACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHI-DDKSTISNKLW 58 ACD+G+PQ R R YI+ F + SV F FP ++ + D++++ DKS + Sbjct: 144 DACDYGIPQHRTRTYIVAFRDFAKSVLFDFPQKQQLQKHIFDVIDKRTKADKSFYLDC-- 201 Query: 59 EGHQKRKENNKIAGKG----FG-YGLFFENSATTNTLSA 92 Q K I F YG+ TL A Sbjct: 202 NSRQYYKMKQSIDDNNQIYRFSDYGIQKSKDGICFTLKA 240 >gi|317177871|dbj|BAJ55660.1| Type II DNA modification enzyme [Helicobacter pylori F16] Length = 319 Score = 56.8 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + DF + Q+RERLYI+ F F FP L D L+ ++ +N Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHSFNFPLGLANDYCFKDFLDAD-NECYLDTNN--A 201 Query: 60 GHQKR 64 Q+ Sbjct: 202 AFQRY 206 >gi|306821027|ref|ZP_07454646.1| possible DNA (cytosine-5-)-methyltransferase [Eubacterium yurii subsp. margaretiae ATCC 43715] gi|304550968|gb|EFM38940.1| possible DNA (cytosine-5-)-methyltransferase [Eubacterium yurii subsp. margaretiae ATCC 43715] Length = 317 Score = 56.8 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51 + A DFG+PQ+RER++++ L + F F I + + + LE+ + + Sbjct: 156 LNAMDFGIPQKRERIFVVSILGKN-NFDFEKLEKIPTKHISEFLEKEVSEIY 206 >gi|297380299|gb|ADI35186.1| DNA-cytosine methyltransferase [Helicobacter pylori v225d] Length = 264 Score = 56.8 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + DF + Q+RERLYI+ F F FP L D L+ ++ +N Sbjct: 91 LNSADFQLAQKRERLYIVGFRKDLKHPFDFPLGLANDYCFKDFLDAD-NECYLDTNN--A 147 Query: 60 GHQKR 64 Q+ Sbjct: 148 AFQRY 152 >gi|317014507|gb|ADU81943.1| type II DNA modification (methyltransferase) [Helicobacter pylori Gambia94/24] Length = 318 Score = 56.8 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + DF + Q+RERLYI+ F F FP L D L+ D++ + + Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDA--DNEYYL-DVSNA 201 Query: 60 GHQKR 64 Q+ Sbjct: 202 TFQRY 206 >gi|163937935|ref|YP_001642821.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4] gi|163865790|gb|ABY46846.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4] Length = 444 Score = 56.8 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 18/83 (21%), Positives = 27/83 (32%), Gaps = 28/83 (33%) Query: 1 MKACDFGVPQRRERLYIIDFLNP----------------------------SVEFKFPTP 32 + + F V Q RER++++ S F FP Sbjct: 185 INSKYFDVAQNRERIFVVCVRKDLVQSEEWRIKGKNVVANCKRNLLNLGVQSFNFDFPAQ 244 Query: 33 LGIKPRLGDILEEHIDDKSTISN 55 + L DILEE +D + I Sbjct: 245 EDVNVSLIDILEESVDKRFYIKE 267 >gi|119512301|ref|ZP_01631388.1| DNA modification methylase [Nodularia spumigena CCY9414] gi|119463081|gb|EAW44031.1| DNA modification methylase [Nodularia spumigena CCY9414] Length = 502 Score = 56.8 bits (137), Expect = 1e-06, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 6/63 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL----EEHIDDKSTIS 54 + + D+GVPQ R R+YII F +F P K +LGDIL E+ ID++ Sbjct: 147 INSFDYGVPQNRIRVYIIGFHKQEYLEKFALPKQTDKKRKLGDILGITSEQKIDNQVIER 206 Query: 55 NKL 57 + Sbjct: 207 DIF 209 >gi|254779148|ref|YP_003057253.1| M. Hpy99XI, type II cytosine specific DNA methyltransferase [Helicobacter pylori B38] gi|254001059|emb|CAX29005.1| M. Hpy99XI, type II cytosine specific DNA methyltransferase [Helicobacter pylori B38] Length = 348 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQVRERVILVGVLKRFKQKFHFPKPIKTHFSLKDAL 188 >gi|172036128|ref|YP_001802629.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142] gi|171697582|gb|ACB50563.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142] Length = 349 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 13/101 (12%) Query: 1 MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A F +PQ RER+Y++ F L V+F FP + +E++I+ +IS Sbjct: 180 LDAALFDLPQVRERIYLVGFCREYLKERVDFTFPMGQTNDVYIDRFIEKNIEG-YSISKH 238 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96 L + + +K++ + + + S T + Y+K Sbjct: 239 LQQSYLFKKDDGR-------PQIVDQTSQVKVKTFVSTYHK 272 >gi|109947180|ref|YP_664408.1| C-5 cytosine-specific DNA methylase [Helicobacter acinonychis str. Sheeba] gi|109714401|emb|CAJ99409.1| C-5 cytosine-specific DNA methylase [Helicobacter acinonychis str. Sheeba] Length = 315 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + DF + Q+RERLYI+ F +F FP L D L+ ++ +N Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHQFNFPLGLANDYCFKDFLDAD-NECYLNTNN--A 195 Query: 60 GHQKR 64 Q+ Sbjct: 196 AFQRY 200 >gi|67920370|ref|ZP_00513890.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] gi|67857854|gb|EAM53093.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] Length = 339 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 7/70 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNK 56 + + DFGVPQ RERL ++ +F+FP + LG++ + + D ++ Sbjct: 157 LNSVDFGVPQNRERLMVVG---HRGKFQFPQISAKRITAGEALGELAFQVLPDSKFLTPS 213 Query: 57 LWEGHQKRKE 66 + + K ++ Sbjct: 214 MDKYIAKYEK 223 >gi|291525029|emb|CBK90616.1| DNA-methyltransferase (dcm) [Eubacterium rectale DSM 17629] Length = 337 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIK-PRLGDILEEHIDDKSTISN 55 + + VPQ R+R ++ N F FP P+L D LE+ + +K + + Sbjct: 182 NSKYWNVPQNRDRYAVVGTRNKKNLTFTFPKEQHEFVPKLSDYLEKDVPEKYYLPD 237 >gi|239625877|ref|ZP_04668908.1| methyltransferase [Clostridiales bacterium 1_7_47_FAA] gi|239520107|gb|EEQ59973.1| methyltransferase [Clostridiales bacterium 1_7_47FAA] Length = 338 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIK-PRLGDILEEHIDDKSTISN 55 + + VPQ R+R ++ N F FP P+L D LE+ + +K + + Sbjct: 182 NSKYWNVPQNRDRYAVVGTRNKKNLTFTFPKEQHEFVPKLSDYLEKDVPEKYYLPD 237 >gi|167043721|gb|ABZ08413.1| putative C-5 cytosine-specific DNA methylase [uncultured marine crenarchaeote HF4000_APKG3B16] Length = 377 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 7/57 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDK-STISN 55 + A D+G+PQ R+R++I+ EF+FP P G L+ ++ K I + Sbjct: 167 LDAKDYGLPQDRQRIFIVGVRKDLEYEFEFPKPTH-----GPGLKPYVTMKDYGIKD 218 >gi|170077805|ref|YP_001734443.1| Type II cytosine-5 DNA methyltransferase [Synechococcus sp. PCC 7002] gi|462645|sp|P34882|MTAA_SYNP2 RecName: Full=Modification methylase AquI subunit alpha; Short=M.AquI subunit alpha; Short=M.AquiA; AltName: Full=Cytosine-specific methyltransferase AquI subunit alpha gi|2126509|pir||I39659 modification methylase AquI, alpha protein - Synechococcus sp. (PCC 7002) gi|142180|gb|AAA22067.1| M.AquI alpha protein [Synechococcus sp. PCC 7002] gi|169885474|gb|ACA99187.1| DNA-cytosine methyltransferase [Synechococcus sp. PCC 7002] Length = 248 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 + A DFGVPQ RER++I+ F+FP P Sbjct: 161 LNAADFGVPQFRERVFIVG-NRLGKTFQFPEPTH 193 >gi|308062397|gb|ADO04285.1| type II DNA modification enzyme [Helicobacter pylori Cuz20] Length = 318 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + DF + Q+RERLYI+ F F FP L D L+ ++ +N Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAD-NECYLDTNN--A 201 Query: 60 GHQKR 64 Q+ Sbjct: 202 AFQRY 206 >gi|167920593|ref|ZP_02507684.1| cytosine-specific DNA methylase [Burkholderia pseudomallei BCC215] Length = 454 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 27/45 (60%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49 +FG+PQ RER+YI+ P F++P + + IL+++ DD Sbjct: 153 NFGIPQIRERVYIVGSTEPLTSFQWPEMIDATTSIETILDKNPDD 197 >gi|108562472|ref|YP_626788.1| cytosine specific DNA methyltransferase [Helicobacter pylori HPAG1] gi|107836245|gb|ABF84114.1| cytosine specific DNA methyltransferase [Helicobacter pylori HPAG1] Length = 355 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 19/35 (54%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +FK P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFKLLEPSQS 187 >gi|261839852|gb|ACX99617.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori 52] Length = 319 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q RERLYI+ F F FP L D L+ Sbjct: 145 LNSADFQLAQNRERLYIVGFRKDLKHHFVFPLGLANDYCFKDFLDAD 191 >gi|325912423|ref|ZP_08174818.1| modification methylase HhaI [Lactobacillus iners UPII 143-D] gi|325475765|gb|EGC78936.1| modification methylase HhaI [Lactobacillus iners UPII 143-D] Length = 314 Score = 56.5 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDIL 43 + D+GVPQ+RER+Y++ F N F FP P + + D L Sbjct: 131 LNPVDYGVPQKRERIYMLCFRNDINREVFTFPRPFKLNKFVEDFL 175 >gi|188527268|ref|YP_001909955.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori Shi470] gi|188143508|gb|ACD47925.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori Shi470] Length = 348 Score = 56.1 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDAL 188 >gi|320326171|gb|EFW82226.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea str. B076] Length = 404 Score = 56.1 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKS 51 + A D+GVPQ+RER+++I F + VE+ FP P L I ++ + Sbjct: 181 VNAADYGVPQKRERVFLIGFRDDLEVEWSFPAPTHSYDAL--IHDQWVTGSY 230 >gi|317182374|dbj|BAJ60158.1| Type II DNA modification enzyme [Helicobacter pylori F57] Length = 318 Score = 56.1 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + DF + Q+RERLYI+ F F FP L D L+ ++ +N Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAD-NECYLDTNN--A 201 Query: 60 GHQKR 64 Q+ Sbjct: 202 AFQRY 206 >gi|309776146|ref|ZP_07671137.1| CPG DNA methylase [Erysipelotrichaceae bacterium 3_1_53] gi|308916097|gb|EFP61846.1| CPG DNA methylase [Erysipelotrichaceae bacterium 3_1_53] Length = 456 Score = 56.1 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + A D G+PQ RER ++I L ++FP + ++ D+LEE +D + + Sbjct: 224 VDAADHGIPQHRERCFMISILGE-YSYRFPAGRKLHIQMKDLLEEKVDIRYFQT 276 >gi|90592696|ref|YP_529611.1| hypothetical protein CDBPCV119_gp60 [Clostridium phage phi CD119] gi|71482543|gb|AAX53484.1| hypothetical protein [Clostridium phage phi CD119] Length = 260 Score = 56.1 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDI 42 + + +FGVPQ RER++I+ F S FP L + Sbjct: 157 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSGKNLEQL 199 >gi|308063322|gb|ADO05209.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori Sat464] Length = 348 Score = 56.1 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDAL 188 >gi|332673919|gb|AEE70736.1| C-5 cytosine-specific DNA methylase [Helicobacter pylori 83] Length = 319 Score = 56.1 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + DF + Q+RERLYI+ F F FP L D L+ + ++ +N Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAN-NECYLDTNN--A 201 Query: 60 GHQKR 64 Q+ Sbjct: 202 AFQRY 206 >gi|317180853|dbj|BAJ58639.1| Type II DNA modification enzyme [Helicobacter pylori F32] Length = 312 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 30/72 (41%), Gaps = 4/72 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK--L 57 + + DF + Q+RERLYI+ F F FP L D L+ ++ +N Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAD-NECYLDTNNAAF 197 Query: 58 WEGHQKRKENNK 69 + +N+ Sbjct: 198 QRYLHNKYNHNR 209 >gi|331002102|ref|ZP_08325621.1| hypothetical protein HMPREF0491_00483 [Lachnospiraceae oral taxon 107 str. F0167] gi|330411196|gb|EGG90612.1| hypothetical protein HMPREF0491_00483 [Lachnospiraceae oral taxon 107 str. F0167] Length = 309 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51 + A DFG+PQ+RER++++ L + F F KP+ + + LE+ + Sbjct: 145 LNAMDFGIPQKRERIFVVSILGKN-NFDFNKLNKTKPKDISEFLEKDVSSVY 195 >gi|254409526|ref|ZP_05023307.1| DNA-cytosine methyltransferase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196183523|gb|EDX78506.1| DNA-cytosine methyltransferase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 437 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 19/76 (25%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF------PT-------------PLGIKPRLGD 41 + + FG+PQ R RLY++ L S +F+ P PL + D Sbjct: 148 LNSAHFGLPQNRVRLYMVGILGASPKFELISDLGPPDSHSYNCQQLSLFNPLTQPVAVAD 207 Query: 42 ILEEHIDDKSTISNKL 57 ILE++ D K S + Sbjct: 208 ILEDNPDSKYDCSPEF 223 >gi|317057160|ref|YP_004105627.1| XRE family transcriptional regulator [Ruminococcus albus 7] gi|315449429|gb|ADU22993.1| transcriptional regulator, XRE family [Ruminococcus albus 7] Length = 407 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDIL 43 + A D+GV Q+RERL I N + F FPTP KP L D+L Sbjct: 224 LNAWDYGVAQKRERLITIGIRNNLTDKISFSFPTPHEYKPVLRDVL 269 >gi|227539355|ref|ZP_03969404.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium spiritivorum ATCC 33300] gi|227240668|gb|EEI90683.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium spiritivorum ATCC 33300] Length = 386 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 18/40 (45%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40 + + DFGVPQ RER++ + ++ K P Sbjct: 171 LNSLDFGVPQHRERIFFVGIRRKILDKKIVEPSSFGKWFP 210 >gi|217034658|ref|ZP_03440063.1| hypothetical protein HP9810_901g5 [Helicobacter pylori 98-10] gi|216942866|gb|EEC22357.1| hypothetical protein HP9810_901g5 [Helicobacter pylori 98-10] Length = 312 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 4/72 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK--L 57 + + DF + Q+RERLYI+ F F FP L D L+ ++ +N Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLVNDYCFKDFLDAD-NECYLDTNNAAF 197 Query: 58 WEGHQKRKENNK 69 + + +N+ Sbjct: 198 QRYLRNKYNHNR 209 >gi|42783651|ref|NP_980898.1| DNA-cytosine methyltransferase family protein [Bacillus cereus ATCC 10987] gi|42739580|gb|AAS43506.1| DNA-cytosine methyltransferase family protein [Bacillus cereus ATCC 10987] Length = 362 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 + A ++GVPQ+RER++II F FP P + Sbjct: 171 LNAANYGVPQKRERVFIIGVRQDLEKTFVFPEPTHNE 207 >gi|317181803|dbj|BAJ59587.1| Type II DNA modification enzyme [Helicobacter pylori F57] Length = 351 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDAL 188 >gi|212639806|ref|YP_002316326.1| Site-specific DNA methylase [Anoxybacillus flavithermus WK1] gi|212561286|gb|ACJ34341.1| Site-specific DNA methylase [Anoxybacillus flavithermus WK1] Length = 469 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 7/52 (13%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLG------IKPRLGDILEE 45 +KA D+GVPQ RER+++I + F++P P +GD L + Sbjct: 212 LKASDYGVPQHRERIFLIGINRDYDATFRYPLPTHGPDRTFPYVTVGDALFD 263 >gi|111607698|gb|ABH10736.1| DNA methyltransferase [Flavobacterium sp. 4H] Length = 408 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 6/60 (10%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDK--STISNK 56 A VPQ RER++I+ F V +F+FP P+ + + D L++ D + Sbjct: 241 ATHANVPQNRERIFIVAFDPKQVKNYSKFEFPKPIKLTKTIHDFLDKEKQDDIFYYKKDH 300 >gi|315586449|gb|ADU40830.1| possible DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 35A] Length = 351 Score = 56.1 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDAL 188 >gi|308184861|ref|YP_003928994.1| type II DNA modification enzyme [Helicobacter pylori SJM180] gi|308060781|gb|ADO02677.1| type II DNA modification enzyme [Helicobacter pylori SJM180] Length = 318 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q RERLYI+ F F FP L D L+ Sbjct: 145 LNSADFQLAQNRERLYIVGFRKDLKYPFNFPLGLANDYCFNDFLDAD 191 >gi|188526860|ref|YP_001909547.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori Shi470] gi|188143100|gb|ACD47517.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori Shi470] Length = 355 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|160939011|ref|ZP_02086362.1| hypothetical protein CLOBOL_03905 [Clostridium bolteae ATCC BAA-613] gi|158437974|gb|EDP15734.1| hypothetical protein CLOBOL_03905 [Clostridium bolteae ATCC BAA-613] Length = 226 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIK-PRLGDILEEHIDDKSTISN 55 + + VPQ R+R ++ N F FP P+L D LE+ + +K + + Sbjct: 3 NSKYWNVPQNRDRYAVVGTRNKKNLSFTFPKEQHEFVPKLSDYLEKDVPEKYYLPD 58 >gi|261837515|gb|ACX97281.1| cytosine-methyltransferase [Helicobacter pylori 51] Length = 355 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|317179558|dbj|BAJ57346.1| cytosine specific DNA methyltransferase [Helicobacter pylori F30] Length = 355 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|260886138|ref|ZP_05736578.2| modification methylase EcoRII [Prevotella tannerae ATCC 51259] gi|260850757|gb|EEX70626.1| modification methylase EcoRII [Prevotella tannerae ATCC 51259] Length = 427 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51 + A DFGVPQ RER+ II L F KP L D L+E D + Sbjct: 247 LNAADFGVPQNRERIIIIGSLKQPFVFSRLVKQPRKP-LVDFLDESGDFEY 296 >gi|261838928|gb|ACX98693.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori 52] Length = 355 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|210134246|ref|YP_002300685.1| cytosine specific DNA methyltransferase [Helicobacter pylori P12] gi|210132214|gb|ACJ07205.1| cytosine specific DNA methyltransferase [Helicobacter pylori P12] Length = 355 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|308062920|gb|ADO04807.1| cytosine specific DNA methyltransferase [Helicobacter pylori Sat464] Length = 355 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|17225517|gb|AAL37447.1|AF328915_1 cytosine-specific DNA methyltransferase [Helicobacter pylori] Length = 361 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|317176866|dbj|BAJ54655.1| cytosine specific DNA methyltransferase [Helicobacter pylori F16] Length = 215 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 13 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 47 >gi|217032842|ref|ZP_03438321.1| hypothetical protein HPB128_165g1 [Helicobacter pylori B128] gi|298737011|ref|YP_003729541.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8] gi|216945425|gb|EEC24089.1| hypothetical protein HPB128_165g1 [Helicobacter pylori B128] gi|298356205|emb|CBI67077.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8] Length = 361 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|119484300|ref|ZP_01618917.1| modification methylase NlaIV [Lyngbya sp. PCC 8106] gi|119457774|gb|EAW38897.1| modification methylase NlaIV [Lyngbya sp. PCC 8106] Length = 449 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 19/76 (25%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-------------------PRLGD 41 + + +FG+PQ R R+Y+I LN S +F + LG K P++ D Sbjct: 146 LNSVNFGLPQNRVRVYMIGVLNASPQFNLISDLGPKDSHSYNAVQLNLFSLQHFPPKVKD 205 Query: 42 ILEEHIDDKSTISNKL 57 ILEE+ D S + Sbjct: 206 ILEENPDSSFDCSPEF 221 >gi|15644682|ref|NP_206852.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori 26695] gi|2313124|gb|AAD07117.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori 26695] Length = 355 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|167630879|ref|YP_001681378.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1] gi|167593619|gb|ABZ85367.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1] Length = 319 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ R R+ + N + +F FPT + P +G+IL Sbjct: 145 LNASDYGVPQLRPRVVFVAIRNDLAADFTFPTEIMHAPTVGEIL 188 >gi|317009105|gb|ADU79685.1| type II DNA modification [Helicobacter pylori India7] Length = 348 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFYFPKPIKTHFSLKDAL 188 >gi|308061350|gb|ADO03238.1| cytosine specific DNA methyltransferase [Helicobacter pylori Cuz20] Length = 355 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|297379273|gb|ADI34160.1| Modification methylase [Helicobacter pylori v225d] Length = 222 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 20 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 54 >gi|268607976|ref|ZP_06141707.1| cytosine-specific DNA-methyltransferase Sau96I [Ruminococcus flavefaciens FD-1] Length = 407 Score = 55.7 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A D+GV Q+RERL I N ++F FPTP KP L D+L Sbjct: 224 LNAWDYGVAQKRERLITIGIRNDLTNQIKFTFPTPHEYKPVLRDVL 269 >gi|17225496|gb|AAL37432.1|AF328909_1 putative cytosine-specific DNA methyltransferase [Helicobacter pylori] gi|17225522|gb|AAL37451.1|AF328916_1 cytosine-specific DNA methyltransferase [Helicobacter pylori] Length = 361 Score = 55.3 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|289167263|ref|YP_003445530.1| type II DNA modification enzyme (methyltransferase cytosine-specific) [Streptococcus mitis B6] gi|288906828|emb|CBJ21662.1| type II DNA modification enzyme (methyltransferase cytosine-specific) [Streptococcus mitis B6] Length = 387 Score = 55.3 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 9/51 (17%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFK--FPT------PLGIKPRLGDI 42 + A D+GVPQ RER+++I N ++EF+ FP P ++ +GD+ Sbjct: 169 LNAKDYGVPQNRERVFLIGVRNDLNIEFEWSFPEKCTSENPFNLRDAIGDL 219 >gi|308183851|ref|YP_003927984.1| cytosine specific DNA methyltransferase [Helicobacter pylori SJM180] gi|308059771|gb|ADO01667.1| cytosine specific DNA methyltransferase [Helicobacter pylori SJM180] Length = 355 Score = 55.3 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|17225547|gb|AAL37468.1|AF328924_1 cytosine-specific DNA methyltransferase [Helicobacter pylori] Length = 234 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 32 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 66 >gi|319412045|emb|CBY91978.1| C-5-cytosine-specific DNA methylase [Streptococcus pneumoniae] Length = 452 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFP 30 + + DFGVPQ RER++II F FP Sbjct: 148 LNSKDFGVPQNRERVFIIGHFRKKGTRLLFP 178 >gi|308172812|ref|YP_003919517.1| DNA (cytosine-5-)-methyltransferase [Bacillus amyloliquefaciens DSM 7] gi|307605676|emb|CBI42047.1| DNA (cytosine-5-)-methyltransferase [Bacillus amyloliquefaciens DSM 7] Length = 406 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 25/102 (24%), Positives = 40/102 (39%), Gaps = 24/102 (23%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG-------IKPRLGDILEEHIDDKST 52 M A D+GV Q+RER++I+ F+FP PL ++ +GD+ E D Sbjct: 246 MSAWDYGVAQKRERVFIVGIRKDLGFTFEFPKPLEGDYQTRVLRDVIGDLPEPERQDC-- 303 Query: 53 ISNKLW--EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 K W + + N+ +NT+ A Sbjct: 304 --GKYWTPKSEYTYGQANR----------VQSLDKPSNTIPA 333 >gi|29028380|gb|AAO64731.1| EcoT38I methyltransferase [Escherichia coli] Length = 363 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG----IKPRLGDILEE 45 + + DFGVPQ RER++ I F + + + + + P +G+I+ Sbjct: 147 LNSKDFGVPQNRERMFFIGFRSENDVKRVEAAIKKYQYLSPTVGEIIRP 195 >gi|145638078|ref|ZP_01793692.1| putative type II 5-cytosoine methyltransferase [Haemophilus influenzae PittHH] gi|145268726|gb|EDK08715.1| putative type II 5-cytosoine methyltransferase [Haemophilus influenzae PittHH] Length = 226 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + A D+GVPQ R+R+ I+ ++F+FP K D L+ + K IS Sbjct: 147 LNAADYGVPQTRQRVIIVGIRKDLDIQFEFPKQTHSKNG-NDGLKRWVSIKEAIS 200 >gi|12229863|sp|Q59605|MTB5_NEIGO RecName: Full=Modification methylase NgoBV; Short=M.NgoBV; AltName: Full=Cytosine-specific methyltransferase NgoBV; Short=M.NgoV gi|1165242|gb|AAA86268.1| M.NgoV DNA methylase [Neisseria gonorrhoeae] Length = 423 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +FG+PQ R+R+Y+ L + F T P+L +ILE + T S+ + Sbjct: 158 LNAKEFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212 Query: 61 HQKRKENNKIAGK 73 K+ +++ GK Sbjct: 213 LLKKFPPSELYGK 225 >gi|296114087|ref|YP_003628025.1| cytosine-specific methyltransferase [Moraxella catarrhalis RH4] gi|295921781|gb|ADG62132.1| cytosine-specific methyltransferase [Moraxella catarrhalis RH4] gi|326560672|gb|EGE11040.1| cytosine-specific methyltransferase [Moraxella catarrhalis 46P47B1] Length = 318 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 9/77 (11%) Query: 1 MKACDF-GVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEEHIDDK--STIS 54 M ++ +PQ RER++II F S+ F+FP + + + DIL+ D+ Sbjct: 147 MNTSEYANIPQNRERIFIIAFDKNIFKSINFEFPNKIPLTKTIHDILDNKKQDESFYYHK 206 Query: 55 NKLWEGHQKRKENNKIA 71 +K HQK K + Sbjct: 207 SK---YHQKLKLEMQNK 220 >gi|212695555|ref|ZP_03303683.1| hypothetical protein ANHYDRO_00072 [Anaerococcus hydrogenalis DSM 7454] gi|212677433|gb|EEB37040.1| hypothetical protein ANHYDRO_00072 [Anaerococcus hydrogenalis DSM 7454] Length = 321 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 1 MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58 + A DFG+PQ+R+R++++ + F P L +ILE+++ + T++ + Sbjct: 151 LNAMDFGIPQKRDRIFVVSCLGANNFSFNKLERKETSP-LSEILEKNVSELYTMTQPYML 209 Query: 59 EGHQK 63 + K Sbjct: 210 KFLNK 214 >gi|85703012|ref|ZP_01034116.1| DNA cytosine methyltransferase M.NgoMIII [Roseovarius sp. 217] gi|85671940|gb|EAQ26797.1| DNA cytosine methyltransferase M.NgoMIII [Roseovarius sp. 217] Length = 387 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIK 36 + + ++GVPQRRER++++ F + +E+ FP P + Sbjct: 180 LNSANYGVPQRRERVFLVGFRADTGIEWHFPKPTHSR 216 >gi|308182232|ref|YP_003926359.1| cytosine specific DNA methyltransferase [Helicobacter pylori PeCan4] gi|308064417|gb|ADO06309.1| cytosine specific DNA methyltransferase [Helicobacter pylori PeCan4] Length = 281 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 79 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113 >gi|311221492|gb|ADP76553.1| DNA methyltransferase [Helicobacter pylori] Length = 587 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187 >gi|217034606|ref|ZP_03440014.1| hypothetical protein HP9810_903g31 [Helicobacter pylori 98-10] gi|216942961|gb|EEC22446.1| hypothetical protein HP9810_903g31 [Helicobacter pylori 98-10] Length = 281 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 79 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113 >gi|317010732|gb|ADU84479.1| type II DNA modification (methyltransferase) [Helicobacter pylori SouthAfrica7] Length = 348 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P + L D L Sbjct: 145 LNALDYGVPQMRERVILVGVLKSFKQKFYFPKPTKMHFSLKDAL 188 >gi|9622224|gb|AAF89681.1| cytosine-specific methyltransferase [Bacillus sp. LU11] Length = 365 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A D+GVPQRR+R++I+ ++F FP P + Sbjct: 146 LNAADYGVPQRRKRIFIVG-TREGIKFNFPLPTHNE 180 >gi|317181351|dbj|BAJ59135.1| cytosine specific DNA methyltransferase [Helicobacter pylori F57] Length = 281 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 79 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113 >gi|315586055|gb|ADU40436.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 35A] Length = 281 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 79 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113 >gi|308071385|ref|YP_003872990.1| Modification methylase AquI alpha subunit (cytosine-specific methyltransferase AquI alpha subunit) [Paenibacillus polymyxa E681] gi|305860664|gb|ADM72452.1| Modification methylase AquI alpha subunit (Cytosine-specific methyltransferase AquI alpha subunit) [Paenibacillus polymyxa E681] Length = 366 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 + A D+GVPQ+RER++++ + F FP P + Sbjct: 172 VNAADYGVPQKRERVFLVGMRRDLNRTFLFPEPTHNE 208 >gi|127420|sp|P19888|MTBA_BACAR RecName: Full=Modification methylase BanI; Short=M.BanI; AltName: Full=Cytosine-specific methyltransferase BanI gi|216242|dbj|BAA00613.1| BanI modification methylase [Aneurinibacillus aneurinilyticus] Length = 428 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 23/102 (22%), Positives = 37/102 (36%), Gaps = 27/102 (26%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-----------------IKPRLGDIL 43 + + FGVPQ R R+YI+ L + + +G + DIL Sbjct: 147 LNSSTFGVPQNRVRIYILGILGSKPKLTLTSNVGAADSHKYKNEQISLFDESYATVKDIL 206 Query: 44 EEHIDDKSTISNKLWEGHQKRKENNKIAGKGF----GYGLFF 81 E+ +K S++ +K+ G F GY L Sbjct: 207 EDSPSEKYRCSDEFIGQL------SKVVGNNFELLHGYRLID 242 >gi|332672853|gb|AEE69670.1| possible DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 83] Length = 281 Score = 55.3 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 79 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113 >gi|317179856|dbj|BAJ57642.1| cytosine specific DNA methyltransferase [Helicobacter pylori F32] Length = 281 Score = 54.9 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 79 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113 >gi|15645735|ref|NP_207912.1| cytosine specific DNA methyltransferase (BSP6IM) [Helicobacter pylori 26695] gi|2314272|gb|AAD08164.1| cytosine specific DNA methyltransferase (BSP6IM) [Helicobacter pylori 26695] Length = 312 Score = 54.9 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q RERLYI+ F F FP L D L+ Sbjct: 139 LNSADFQLAQNRERLYIVGFRKDLKHPFNFPLGLANDYYFKDFLDAD 185 >gi|254421659|ref|ZP_05035377.1| C-5 cytosine-specific DNA methylase superfamily [Synechococcus sp. PCC 7335] gi|196189148|gb|EDX84112.1| C-5 cytosine-specific DNA methylase superfamily [Synechococcus sp. PCC 7335] Length = 427 Score = 54.9 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 15/103 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNK 56 + A ++G+PQ RERL+++ N + +P PL P LGD+ ++ ++ NK Sbjct: 161 LNARNYGIPQNRERLFLVGARNNTCLPIYPKPLKHSPTCTHALGDL--PDVEQFHSLINK 218 Query: 57 ------LWEGHQKRKEN---NKIAGKGFGYGLFFENSATTNTL 90 L + H G +GY ++ S TN++ Sbjct: 219 GEVIVCLSQPHSAYAARLRCQSRRGWYYGYRRQWDPSLLTNSI 261 >gi|320326214|gb|EFW82269.1| cytosine-specific DNA-methyltransferase [Pseudomonas syringae pv. glycinea str. B076] Length = 448 Score = 54.9 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 26/45 (57%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49 +FG+PQ RER+YI+ L P +F +P + +L++H D Sbjct: 153 NFGIPQIRERVYIVGSLIPLEDFSWPKKTDAPTSIDTVLDDHPAD 197 >gi|207093118|ref|ZP_03240905.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori HPKX_438_AG0C1] Length = 199 Score = 54.9 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ S +F P Sbjct: 32 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 66 >gi|48243617|gb|AAT40769.1| putative DNA methylase [Haemophilus influenzae] Length = 293 Score = 54.9 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + A D+GVPQ R+R+ I+ ++F+FP K D L+ + K IS Sbjct: 146 LNAADYGVPQTRQRVIIVGIRKDLDIQFEFPKQTHSKNG-NDGLKRWVSIKEAIS 199 >gi|208435018|ref|YP_002266684.1| type II DNA modification enzyme [Helicobacter pylori G27] gi|208432947|gb|ACI27818.1| type II DNA modification enzyme [Helicobacter pylori G27] Length = 318 Score = 54.9 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LW 58 + + DF + Q+RERLYI+ F F FP L D L+ + I+N Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDADNECYLDINNVAFQ 204 Query: 59 EGHQKRKENNK 69 R +N+ Sbjct: 205 RYLHNRYNHNR 215 >gi|313667088|gb|ADR72987.1| M2.BsmFI [Geobacillus stearothermophilus] Length = 365 Score = 54.9 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A D+GVPQRR+R++I+ V+F FP P + Sbjct: 146 LNAADYGVPQRRKRIFIVG-TREGVKFNFPLPTHNE 180 >gi|188527903|ref|YP_001910590.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori Shi470] gi|188144143|gb|ACD48560.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori Shi470] gi|308063905|gb|ADO05792.1| type II DNA modification enzyme [Helicobacter pylori Sat464] Length = 320 Score = 54.9 bits (132), Expect = 4e-06, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q+RERLYI+ F F FP L D L+ Sbjct: 147 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANNYCFKDFLDAD 193 >gi|317011319|gb|ADU85066.1| type II DNA modification enzyme [Helicobacter pylori SouthAfrica7] Length = 321 Score = 54.5 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q+RERLYI+ F F FP L D L+ Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHSFHFPLGLANDYCFKDFLDAD 191 >gi|210610944|ref|ZP_03288669.1| hypothetical protein CLONEX_00859 [Clostridium nexile DSM 1787] gi|210152244|gb|EEA83251.1| hypothetical protein CLONEX_00859 [Clostridium nexile DSM 1787] Length = 278 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHID 48 + A D+GVPQ+RERL I N ++F FP KP L D+L + D Sbjct: 95 LNAWDYGVPQKRERLITIGIRNDLVNRIKFHFPEAHDYKPVLRDVLLDCPD 145 >gi|307637790|gb|ADN80240.1| DNA-cytosine methyl transferase [Helicobacter pylori 908] gi|325996388|gb|ADZ51793.1| DNA-cytosine methyltransferase [Helicobacter pylori 2018] gi|325997976|gb|ADZ50184.1| Type II DNA modification enzyme/ methyltransferase [Helicobacter pylori 2017] Length = 318 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q+RERLYI+ F F FP L D L+ Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKRPFSFPLGLANDYCFNDFLDAD 191 >gi|321156918|emb|CBW38908.1| putative DNA methylase [Streptococcus pneumoniae] Length = 452 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 23/92 (25%), Positives = 34/92 (36%), Gaps = 18/92 (19%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50 + + DFGVPQ RER++II S FP + +IL + + K Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKSTRLLFPFRREGQATNSEILKTLGNLNPSKSGMSGK 207 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82 S L + GKG G+ + Sbjct: 208 VYYSEGLAPTLVR--------GKGEGFKIAIP 231 >gi|208434405|ref|YP_002266071.1| type II DNA modification enzyme [Helicobacter pylori G27] gi|208432334|gb|ACI27205.1| type II DNA modification enzyme [Helicobacter pylori G27] Length = 348 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGTLKRFKQKFHFPKPIKTHFSLKDAL 188 >gi|315587009|gb|ADU41390.1| C-5 cytosine-specific DNA methylase [Helicobacter pylori 35A] Length = 313 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + DF + Q+RERLYI+ F F FP L D L+ ++ +N Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAG-NECYLDTNN--A 195 Query: 60 GHQKR 64 Q+ Sbjct: 196 AFQRY 200 >gi|308183225|ref|YP_003927352.1| type II DNA modification enzyme [Helicobacter pylori PeCan4] gi|308065410|gb|ADO07302.1| type II DNA modification enzyme [Helicobacter pylori PeCan4] Length = 318 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q+RERLYI+ F F FP L D L+ Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKRPFNFPLGLANDYCFKDFLDAD 191 >gi|327474139|gb|EGF19549.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus sanguinis SK408] Length = 480 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 23/92 (25%), Positives = 34/92 (36%), Gaps = 18/92 (19%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50 + + DFGVPQ RER++II S FP + +IL + + K Sbjct: 176 LNSKDFGVPQNRERVFIIGHSRKKSTRLLFPFRREGQATNSEILKTLGNLNPSKSGMSGK 235 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82 S L + GKG G+ + Sbjct: 236 VYYSEGLAPTLVR--------GKGEGFKIAIP 259 >gi|317012898|gb|ADU83506.1| type II DNA modification enzyme [Helicobacter pylori Lithuania75] Length = 318 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q+RERLYI+ F F FP L D L+ Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHHFVFPLGLANDYCFKDFLDAD 191 >gi|254779672|ref|YP_003057778.1| M.HpyAVIII, a type II cytosine specific DNA methyltransferase [Helicobacter pylori B38] gi|254001584|emb|CAX29633.1| M.HpyAVIII, a type II cytosine specific DNA methyltransferase [Helicobacter pylori B38] Length = 318 Score = 54.5 bits (131), Expect = 5e-06, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q+RERLYI+ F F FP L D L+ Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFNDFLDAD 191 >gi|227540760|ref|ZP_03970809.1| DNA-cytosine methyltransferase [Corynebacterium glucuronolyticum ATCC 51866] gi|227183472|gb|EEI64444.1| DNA-cytosine methyltransferase [Corynebacterium glucuronolyticum ATCC 51866] Length = 387 Score = 54.1 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRL 39 + A D+GVPQ R R++I+ F + + + FP P L Sbjct: 180 VDAADYGVPQHRHRVFIVGFRSDINAGWNFPQPTHSGAAL 219 >gi|296126560|ref|YP_003633812.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563] gi|296018376|gb|ADG71613.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563] Length = 311 Score = 54.1 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 7/66 (10%) Query: 1 MKACDF-GVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDK--STI 53 + + ++ +PQ RER++I F V FKFP P+ + + D ++ D Sbjct: 141 LNSAEYSNIPQNRERIFIAAFSKEKVCSYSNFKFPEPVELTKTIHDFIDHEKQDDIYYYN 200 Query: 54 SNKLWE 59 S K ++ Sbjct: 201 STKYYK 206 >gi|315222617|ref|ZP_07864506.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211] gi|315188303|gb|EFU22029.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211] Length = 348 Score = 54.1 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45 + A D+GVPQ R+R++ + F +++F+ P P K D + + Sbjct: 150 LNASDYGVPQDRKRVFYVGFRKDLNIKFEPPKPYESKLTFKDAIFD 195 >gi|323487872|ref|ZP_08093130.1| cytosine-specific methyltransferase [Planococcus donghaensis MPA1U2] gi|323398606|gb|EGA91394.1| cytosine-specific methyltransferase [Planococcus donghaensis MPA1U2] Length = 367 Score = 54.1 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 20/26 (76%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + + DFGVPQ+RER++ I FLN ++ Sbjct: 149 LNSADFGVPQKRERVFFIGFLNKDID 174 >gi|169826094|ref|YP_001696252.1| modification methylase BsuRI [Lysinibacillus sphaericus C3-41] gi|168990582|gb|ACA38122.1| Modification methylase BsuRI [Lysinibacillus sphaericus C3-41] Length = 426 Score = 54.1 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHI 47 + + DFGVPQ RER+++I + FK+P P +P GD L+ ++ Sbjct: 227 VNSRDFGVPQLRERVFLIGVHKEKIAEKYGFKYPKP---QPTHGDGLKPYV 274 >gi|15612115|ref|NP_223767.1| type II DNA modification (methyltransferase [Helicobacter pylori J99] gi|4155654|gb|AAD06642.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter pylori J99] Length = 321 Score = 54.1 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q+RERLYI+ F F FP L D L+ Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKRPFNFPLGLANDYCFKDFLDAD 191 >gi|317127845|ref|YP_004094127.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522] gi|315472793|gb|ADU29396.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522] Length = 363 Score = 54.1 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID-DKSTISNKLWE 59 + A D+GVPQ R R++ + L+ F+FP D L + +K S+ +E Sbjct: 152 LNAADYGVPQHRHRVFFVGVLD--GAFEFPRKKNEVISTKDALSDLPSLEKFEGSDVEFE 209 Query: 60 GHQK 63 H K Sbjct: 210 YHVK 213 >gi|328947436|ref|YP_004364773.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] gi|328447760|gb|AEB13476.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] Length = 439 Score = 54.1 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 12/90 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL--- 57 + + DF +PQ+RER Y + FL+ +F FP I L DI++ D+S K Sbjct: 240 LSSLDFELPQKRERWYCVGFLS-KTDFVFPAGTKIHKNLRDIIDLDNQDESLKLPKFELD 298 Query: 58 -WEGHQKRKENNKIAGKGFGYGLFFENSAT 86 H + +N K +NS Sbjct: 299 RIAYHFEMAKNKTDRVK-------HDNSKY 321 >gi|291544225|emb|CBL17334.1| DNA-methyltransferase (dcm) [Ruminococcus sp. 18P13] Length = 407 Score = 54.1 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A ++GV Q+RERL I N ++F FPTP KP L D+L Sbjct: 224 LNAWNYGVAQKRERLITIGIRNDLTNQIKFTFPTPHEYKPVLRDVL 269 >gi|125974805|ref|YP_001038715.1| DNA-cytosine methyltransferase [Clostridium thermocellum ATCC 27405] gi|125715030|gb|ABN53522.1| DNA-cytosine methyltransferase [Clostridium thermocellum ATCC 27405] Length = 334 Score = 54.1 bits (130), Expect = 7e-06, Method: Composition-based stats. Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 5/75 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNK-L 57 + A D+GVPQ R R+ + F +FKFP P K L + + + + K S+ Sbjct: 155 VNAADYGVPQDRWRVILYGFRKDLEVKDFKFPEPFPYKVTLREAIGDMPEPK--QSDICH 212 Query: 58 WEGHQKRKENNKIAG 72 + N+ G Sbjct: 213 ASYSSRYMSRNRKRG 227 >gi|158320884|ref|YP_001513391.1| DNA-cytosine methyltransferase [Alkaliphilus oremlandii OhILAs] gi|158141083|gb|ABW19395.1| DNA-cytosine methyltransferase [Alkaliphilus oremlandii OhILAs] Length = 329 Score = 53.8 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGD 41 + A DF VPQ R+R++ I F +FKFP P+ + L D Sbjct: 145 LNANDFQVPQDRKRVFYIGFRKDLGIADFKFPKPIEPRLTLKD 187 >gi|289423024|ref|ZP_06424844.1| putative site-specific DNA-methyltransferase [Peptostreptococcus anaerobius 653-L] gi|289156598|gb|EFD05243.1| putative site-specific DNA-methyltransferase [Peptostreptococcus anaerobius 653-L] Length = 706 Score = 53.8 bits (129), Expect = 8e-06, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 8/62 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKP------RLGDILEEHIDDKSTI 53 + A +FGVPQ RER+ I+ LN + +F I+ ++ D E + TI Sbjct: 147 LNARNFGVPQNRERIIIVGNLNGRAFDFTKLKTNTIETMKPFLDKVAD-FEILPKESYTI 205 Query: 54 SN 55 + Sbjct: 206 LD 207 >gi|317180646|dbj|BAJ58432.1| Type II DNA modification enzyme [Helicobacter pylori F32] Length = 348 Score = 53.8 bits (129), Expect = 8e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDAL 188 >gi|317483873|ref|ZP_07942812.1| C-5 cytosine-specific DNA methylase [Bilophila wadsworthia 3_1_6] gi|316924890|gb|EFV46037.1| C-5 cytosine-specific DNA methylase [Bilophila wadsworthia 3_1_6] Length = 401 Score = 53.8 bits (129), Expect = 8e-06, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGI 35 + A D+G+PQRRER++I+ F + V + FP Sbjct: 178 VNAADYGIPQRRERVFIVGFRHDLGVRWSFPETTHS 213 >gi|317179147|dbj|BAJ56935.1| Type II DNA modification enzyme [Helicobacter pylori F30] Length = 351 Score = 53.8 bits (129), Expect = 8e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDAL 188 >gi|308061739|gb|ADO03627.1| DNA-cytosine methyltransferase [Helicobacter pylori Cuz20] Length = 704 Score = 53.8 bits (129), Expect = 9e-06, Method: Composition-based stats. Identities = 19/73 (26%), Positives = 30/73 (41%), Gaps = 14/73 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLG---------DILEEHIDDK 50 + A +F VPQ RER+ I+ +L V F F P + +ILE + + Sbjct: 143 LNAKNFSVPQNRERIIIVGYLGSQV-FDFNPIKTNPITDMQNFLDKSGHFEILEPY---E 198 Query: 51 STISNKLWEGHQK 63 T+ + Q Sbjct: 199 YTLLDNQLLKRQN 211 >gi|328766176|gb|EGF76234.1| hypothetical protein BATDEDRAFT_28720 [Batrachochytrium dendrobatidis JAM81] Length = 373 Score = 53.4 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 + A D+GVPQ+RER++II N E+ FP P + Sbjct: 181 VNARDYGVPQQRERVFIIGIRNDIEFEYDFPAPTHGE 217 >gi|261839303|gb|ACX99068.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori 52] Length = 348 Score = 53.4 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDAL 188 >gi|291618717|ref|YP_003521459.1| HsdRM [Pantoea ananatis LMG 20103] gi|291153747|gb|ADD78331.1| HsdRM [Pantoea ananatis LMG 20103] Length = 313 Score = 53.4 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLG 34 + A D+GVPQ R+R++I+ N +VE+ FP P Sbjct: 141 LNAMDYGVPQERKRIFIVGIKDNINVEYSFPEPTH 175 >gi|317009733|gb|ADU80313.1| type II DNA modification enzyme [Helicobacter pylori India7] Length = 318 Score = 53.4 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45 + + DF + Q+RERLYI+ F F FP L D L+ Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFNDFLDA 190 >gi|160947479|ref|ZP_02094646.1| hypothetical protein PEPMIC_01413 [Parvimonas micra ATCC 33270] gi|158446613|gb|EDP23608.1| hypothetical protein PEPMIC_01413 [Parvimonas micra ATCC 33270] Length = 348 Score = 53.4 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45 + A D+GVPQ R+R++ + F V+F+ P P K D + + Sbjct: 150 LNASDYGVPQDRKRVFYVGFRKDLKVKFEPPKPYETKLTFKDTIFD 195 >gi|227485931|ref|ZP_03916247.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus lactolyticus ATCC 51172] gi|227235976|gb|EEI85991.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus lactolyticus ATCC 51172] Length = 318 Score = 53.4 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK----FPTPLGIKPRLGDILEEHIDDKSTIS 54 + A ++G+PQ R R Y + E FP ++ L D+++ + IS Sbjct: 142 LNAKNYGIPQNRNRWYCVGVDKNHKELNLDDVFPGICELRYTLKDVIDCEYKEDYQIS 199 >gi|217033040|ref|ZP_03438509.1| hypothetical protein HPB128_193g7 [Helicobacter pylori B128] gi|298736593|ref|YP_003729119.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8] gi|216945239|gb|EEC23921.1| hypothetical protein HPB128_193g7 [Helicobacter pylori B128] gi|298355783|emb|CBI66655.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8] Length = 351 Score = 53.4 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDAL 188 >gi|321312120|ref|YP_004204407.1| cytosine-specific methyltransferase [Bacillus subtilis BSn5] gi|320018394|gb|ADV93380.1| cytosine-specific methyltransferase [Bacillus subtilis BSn5] Length = 380 Score = 53.4 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 19/26 (73%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + + FGVPQ+RER++ + FL +V+ Sbjct: 149 LNSSHFGVPQKRERIFFVGFLEKNVD 174 >gi|322376648|ref|ZP_08051141.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus sp. M334] gi|321282455|gb|EFX59462.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus sp. M334] Length = 452 Score = 53.4 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 21/85 (24%), Positives = 31/85 (36%), Gaps = 16/85 (18%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50 + + DFGVPQ RER++II FP + +IL + + K Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSEILKTLGNLNPSKSGMSGK 207 Query: 51 STISNKLWEGHQKRKENNKIAGKGF 75 S L + G+GF Sbjct: 208 VYYSEGLAPTLVR------GKGEGF 226 >gi|261837889|gb|ACX97655.1| type II m5C methylase [Helicobacter pylori 51] Length = 348 Score = 53.4 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGTLKSFKQKFHFPKPIKAHFSLKDAL 188 >gi|332530473|ref|ZP_08406414.1| DNA cytosine methyltransferase M.NgoMIII [Hylemonella gracilis ATCC 19624] gi|332040042|gb|EGI76427.1| DNA cytosine methyltransferase M.NgoMIII [Hylemonella gracilis ATCC 19624] Length = 413 Score = 53.4 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 15/76 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLW 58 + A ++GVPQRRER++I+ F +++ FP L +L + + + W Sbjct: 187 VNAANYGVPQRRERVFIVGFRRDLPIQWSFPRETHS---LDALLHDQWVTGEY------W 237 Query: 59 EGH----QKRKENNKI 70 E H + R + +K Sbjct: 238 ERHGVAKRARPQPHKS 253 >gi|317010127|gb|ADU80707.1| DNA-cytosine methyltransferase [Helicobacter pylori India7] Length = 703 Score = 53.4 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLGDILEE 45 + A DF VPQ RER+ I+ +L V F F P + + L++ Sbjct: 143 LNAKDFSVPQNRERIIIVGYLGSQV-FDFNPIKKNPIISMQNFLDK 187 >gi|207091758|ref|ZP_03239545.1| putative site-specific DNA-methyltransferase [Helicobacter pylori HPKX_438_AG0C1] Length = 703 Score = 53.4 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLGDILEE 45 + A DF VPQ RER+ I+ +L V F F P + + L++ Sbjct: 143 LNAKDFSVPQNRERIIIVGYLGSQV-FDFNPIKKNPIISMQNFLDK 187 >gi|312872570|ref|ZP_07732638.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF 2062A-h1] gi|311091932|gb|EFQ50308.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF 2062A-h1] Length = 336 Score = 53.4 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + D L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVEDFLLPD 199 >gi|309803758|ref|ZP_07697844.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV 11V1-d] gi|308164167|gb|EFO66428.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV 11V1-d] Length = 336 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + D L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERELFVFPQPFKLNRFVEDFLLPD 199 >gi|241666957|ref|YP_002985041.1| DNA-cytosine methyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240862414|gb|ACS60079.1| DNA-cytosine methyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 393 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 10/67 (14%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A + GVPQRRER+ + F + +++ FP L +L + + W+ Sbjct: 181 LNAANHGVPQRRERVVFVGFRSDLDIKWAFPAETHS---LDALLWDQVHGDY------WD 231 Query: 60 GHQKRKE 66 H+ RK Sbjct: 232 RHRVRKA 238 >gi|329920363|ref|ZP_08277095.1| modification methylase HhaI [Lactobacillus iners SPIN 1401G] gi|328936039|gb|EGG32492.1| modification methylase HhaI [Lactobacillus iners SPIN 1401G] Length = 336 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + D L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDVERESFVFPQPFKLNRFVEDFLLPD 199 >gi|309807025|ref|ZP_07701007.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV 03V1-b] gi|308166645|gb|EFO68842.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV 03V1-b] Length = 336 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + D L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERELFVFPQPFKLNRFVEDFLLPD 199 >gi|315604954|ref|ZP_07880010.1| modification methylase [Actinomyces sp. oral taxon 180 str. F0310] gi|315313349|gb|EFU61410.1| modification methylase [Actinomyces sp. oral taxon 180 str. F0310] Length = 322 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTP-LGIKPRLGDILEE 45 + A DFGVPQ R R+ + F + + F++P+P P +G+ L + Sbjct: 147 LNASDFGVPQLRPRVIAVGFRHDTAPSFEYPSPFQNAAPTVGETLAD 193 >gi|309804726|ref|ZP_07698791.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV 09V1-c] gi|312871535|ref|ZP_07731628.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF 3008A-a] gi|325913106|ref|ZP_08175476.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B] gi|308166118|gb|EFO68336.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV 09V1-c] gi|311092930|gb|EFQ51281.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF 3008A-a] gi|325477527|gb|EGC80669.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B] Length = 336 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + D L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERELFVFPQPFKLNRFVEDFLLPD 199 >gi|256819660|ref|YP_003140939.1| DNA-cytosine methyltransferase [Capnocytophaga ochracea DSM 7271] gi|256581243|gb|ACU92378.1| DNA-cytosine methyltransferase [Capnocytophaga ochracea DSM 7271] Length = 318 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 5/57 (8%) Query: 1 MKACDF-GVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKST 52 + ++ +PQ RER++I+ F V EF+FP + + + LE+ + Sbjct: 148 LNTMEYANIPQNRERIFIVAFDPKQVPNYKEFQFPEKIKLTKTIHSFLEKGKQNDYF 204 >gi|297379680|gb|ADI34567.1| DNA-cytosine methyltransferase [Helicobacter pylori v225d] Length = 265 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 59 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDAL 102 >gi|196037189|ref|ZP_03104504.1| modification methylase HaeIII [Bacillus cereus W] gi|195990293|gb|EDX54346.1| modification methylase HaeIII [Bacillus cereus W] Length = 415 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 6/58 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + + D+GVPQ RER++I+ N F++ P +P G+ ++ K TISN Sbjct: 231 VNSRDYGVPQLRERVFIVGIRNDIHEKYGFEYEVP---EPTHGEGKIPYVTLKDTISN 285 >gi|237742048|ref|ZP_04572529.1| site-specific DNA-methyltransferase [Fusobacterium sp. 4_1_13] gi|229429696|gb|EEO39908.1| site-specific DNA-methyltransferase [Fusobacterium sp. 4_1_13] Length = 440 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 5/72 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A ++GVPQ R RL +I F N E K+P K L + L + + + NK Sbjct: 189 LNASNYGVPQNRHRLILIGFRNDMKEPKYPKEFKQKVTLREALSDLTN--YELDNK---K 243 Query: 61 HQKRKENNKIAG 72 +Q + + Sbjct: 244 YQNSSKKGRTKN 255 >gi|331677320|ref|ZP_08377999.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591] gi|331075055|gb|EGI46371.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591] Length = 415 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 17/72 (23%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-----------------IKPRLGDIL 43 + +FGVPQ R R+YII L V P LG + ++ DIL Sbjct: 146 LNTSNFGVPQNRVRIYIIASLEKEVTLTIPNDLGAKDTHNYKPSKGGHDFYTESKVSDIL 205 Query: 44 EEHIDDKSTISN 55 E+ D+ S+ Sbjct: 206 EDSPDESYDCSD 217 >gi|269114810|ref|YP_003302573.1| Cytosine-specific DNA methyltransferase/Type II site-specific deoxyribonuclease [Mycoplasma hominis] gi|268322435|emb|CAX37170.1| Cytosine-specific DNA methyltransferase/Type II site-specific deoxyribonuclease [Mycoplasma hominis ATCC 23114] Length = 553 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDI 42 + A DFGVPQ+RERL I + F+FP KP + D+ Sbjct: 151 LNAWDFGVPQKRERLITIGVRQDLLSKISFEFPMEHSYKPTMRDV 195 >gi|171911881|ref|ZP_02927351.1| DNA-cytosine methyltransferase [Verrucomicrobium spinosum DSM 4136] Length = 330 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 28/70 (40%), Gaps = 7/70 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE----EHIDDKSTISNK 56 + + FGVPQ+RERL ++ F FP P D LE + ++ Sbjct: 156 LNSVHFGVPQKRERLVVVG---HLGGFVFPAPSAKVWTSADALEGMLYATPPESRFLTPS 212 Query: 57 LWEGHQKRKE 66 + + ++ Sbjct: 213 MDKYIANYEK 222 >gi|291528318|emb|CBK93904.1| DNA-methyltransferase (dcm) [Eubacterium rectale M104/1] Length = 344 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHID 48 + A ++GVPQ+RERL I N E++FP KP L D+L + D Sbjct: 152 LNAWNYGVPQKRERLITIGIRNDLVGKTEYRFPKAHSYKPVLRDVLLDCPD 202 >gi|208434021|ref|YP_002265687.1| cytosine specific DNA methyltransferase (putative type II) [Helicobacter pylori G27] gi|208431950|gb|ACI26821.1| cytosine specific DNA methyltransferase (putative type II) [Helicobacter pylori G27] Length = 281 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + D+GVPQ RER +I+ S +FK P Sbjct: 79 LNVKDYGVPQNRERAFIVGASRFSFDFKLLEPSQS 113 >gi|323650698|gb|ADX97433.1| M1.BspACI [Bacillus psychrodurans] Length = 320 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Query: 1 MKACDFGVPQRRERLYIID-----FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 M A +GVPQ R R Y + F + FP ++ + +E+++ +S Sbjct: 144 MNAKYYGVPQNRNRWYCVGYDASQFSKIDIHNIFPEEENLETFIDSYIEKNVSQDYQMS 202 >gi|218135211|ref|ZP_03464015.1| hypothetical protein BACPEC_03116 [Bacteroides pectinophilus ATCC 43243] gi|217990596|gb|EEC56607.1| hypothetical protein BACPEC_03116 [Bacteroides pectinophilus ATCC 43243] Length = 344 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHID 48 + A ++GVPQ+RERL I N E++FP KP L D+L + D Sbjct: 152 LNAWNYGVPQKRERLITIGIRNDLVGKTEYRFPKAHSYKPVLRDVLLDCPD 202 >gi|319639604|ref|ZP_07994351.1| cytosine-specific methyltransferase [Neisseria mucosa C102] gi|317399175|gb|EFV79849.1| cytosine-specific methyltransferase [Neisseria mucosa C102] Length = 348 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 6/54 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-----LGIKPRLGDILEEHIDD 49 + A D+GVPQ R+R + + F N ++ F+FP + +K + D+ + +DD Sbjct: 155 LMASDYGVPQNRKRAFFVGFKNGTI-FEFPKQTVNQYVTVKQAISDLPDYSVDD 207 >gi|15611502|ref|NP_223153.1| type II DNA modification (methyltransferase [Helicobacter pylori J99] gi|4154963|gb|AAD06007.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter pylori J99] Length = 351 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQVRERVILVGALKSFKQKFYFPKPIKTHFSLKDAL 188 >gi|252957|gb|AAA09969.1| methyltransferase [Herpetosiphon aurantiacus] Length = 437 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE 44 + + D+GV Q R+R++II +F FP + RL DIL+ Sbjct: 146 LNSFDYGVAQNRDRVFIIGIQQKLGVPDFSFPEYSESEQRLYDILD 191 >gi|302383143|ref|YP_003818966.1| DNA-cytosine methyltransferase [Brevundimonas subvibrioides ATCC 15264] gi|302193771|gb|ADL01343.1| DNA-cytosine methyltransferase [Brevundimonas subvibrioides ATCC 15264] Length = 377 Score = 53.0 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLG 40 + A + GVPQ+RER++I+ F + S E+ FP L Sbjct: 170 LNAANHGVPQKRERVFIVGFRSDLSTEWNFPAETHSARALA 210 >gi|119716511|ref|YP_923476.1| DNA-cytosine methyltransferase [Nocardioides sp. JS614] gi|119537172|gb|ABL81789.1| DNA-cytosine methyltransferase [Nocardioides sp. JS614] Length = 399 Score = 53.0 bits (127), Expect = 2e-05, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 6/58 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A D+GVPQ R R+ ++ F + + FP P G +L + + S++ Sbjct: 202 VNAADYGVPQNRWRVVLVGFRKDLGISWSFPDPTHSA---GALLRAQLSGEY--SDRH 254 >gi|227540659|ref|ZP_03970708.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium spiritivorum ATCC 33300] gi|227239483|gb|EEI89498.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium spiritivorum ATCC 33300] Length = 386 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 16/26 (61%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + + DFGVPQ RER++ + ++ Sbjct: 171 LNSLDFGVPQHRERIFFVGIRKEFLD 196 >gi|282899236|ref|ZP_06307209.1| C-5 cytosine-specific DNA methylase [Cylindrospermopsis raciborskii CS-505] gi|281195872|gb|EFA70796.1| C-5 cytosine-specific DNA methylase [Cylindrospermopsis raciborskii CS-505] Length = 422 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 16/81 (19%), Positives = 32/81 (39%), Gaps = 23/81 (28%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK----------------------FPTPLGIKPR 38 + + +FGVPQ R R+YI+ L + FP + + Sbjct: 146 LNSSNFGVPQNRVRIYILGLLGKNPRLTINSDKGATDSHSFKEQFYQLSLFPDSYSV-VK 204 Query: 39 LGDILEEHIDDKSTISNKLWE 59 + +ILE+ + + +S + + Sbjct: 205 VKNILEQKVSENYYLSKRFQQ 225 >gi|321310707|ref|YP_004193036.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str. Langford 1] gi|319802551|emb|CBY93197.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str. Langford 1] Length = 340 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Query: 1 MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILEEHIDD 49 + + D+GV Q+RERL +I + FK+P KP L D+L + + Sbjct: 156 LNSWDYGVAQKRERLILIGIRSDFREKISFKYPKKHRYKPVLSDVLNDVPES 207 >gi|127435|sp|P25264|MTC2_HERAU RecName: Full=Modification methylase HgiCII; Short=M.HgiCII; AltName: Full=Cytosine-specific methyltransferase HgiCII gi|43464|emb|CAA38935.1| methyltransferase [Herpetosiphon aurantiacus] Length = 437 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE 44 + + D+GV Q R+R++II +F FP + RL DIL+ Sbjct: 146 LNSFDYGVAQNRDRVFIIGIQQKLGVPDFSFPEYSESEQRLYDILD 191 >gi|317178577|dbj|BAJ56365.1| Type II DNA modification enzyme [Helicobacter pylori F30] Length = 318 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + DF + Q+RERLYI+ F F FP L D L+ ++ +N Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYYFEDFLDAG-NECYLDTNN--N 201 Query: 60 GHQKR 64 Q+ Sbjct: 202 AFQRY 206 >gi|317013900|gb|ADU81336.1| type II DNA modification (methyltransferase) [Helicobacter pylori Gambia94/24] Length = 351 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F FP P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFYFPKPIKTHFSLKDAL 188 >gi|967022|emb|CAA62381.1| DNA (cytosine-5-)-methyltransferase [Geobacillus stearothermophilus] gi|1262297|gb|AAA96793.1| m5C-multispecific methyltransferase [Geobacillus stearothermophilus] gi|1589631|prf||2211376A cytosine-C5-DNA methyltransferase Length = 534 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 8/53 (15%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPR-------LGDILEE 45 + A D+GV Q+RER++I+ + F+FP P R +GD+ E Sbjct: 155 INAWDYGVAQKRERVFIVGIRADLGFAFEFPEPRPGDYRTQVLRDVIGDLPEP 207 >gi|207109252|ref|ZP_03243414.1| putative site-specific DNA-methyltransferase [Helicobacter pylori HPKX_438_CA4C1] Length = 210 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF 29 + A DF VPQ RER+ I+ +L V F F Sbjct: 171 LNAKDFSVPQNRERIIIVGYLGSQV-FDF 198 >gi|127486|sp|P23737|MTS9_STAAU RecName: Full=Modification methylase Sau96I; Short=M.Sau96I; AltName: Full=Cytosine-specific methyltransferase Sau96I gi|581567|emb|CAA37260.1| Sau96I DNA methyltransferase [Staphylococcus aureus] gi|329730456|gb|EGG66846.1| DNA-binding helix-turn-helix protein [Staphylococcus aureus subsp. aureus 21193] Length = 430 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 6/62 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEEHIDDKST-IS 54 + + ++ V Q+RER+ II V+ F+FP KP L D+L++ K T S Sbjct: 245 LNSWNYDVAQKRERIVIIGIREDLVKEQKYPFRFPLAQVYKPVLKDVLKDVPKSKVTAYS 304 Query: 55 NK 56 +K Sbjct: 305 DK 306 >gi|213053466|ref|ZP_03346344.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] Length = 320 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 7/45 (15%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEE 45 +PQ RER+ ++ F N +F +P L ++LE Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEP 320 >gi|207108548|ref|ZP_03242710.1| type II DNA modification enzyme [Helicobacter pylori HPKX_438_CA4C1] Length = 171 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q RERLYI+ F F FP L D L+ Sbjct: 99 LNSADFQLAQNRERLYIVGFRKDLKHHFVFPLGLANDYHFEDFLDAD 145 >gi|168207191|ref|ZP_02633196.1| modification methylase ScrFIB [Clostridium perfringens E str. JGS1987] gi|170661387|gb|EDT14070.1| modification methylase ScrFIB [Clostridium perfringens E str. JGS1987] Length = 310 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-PRLGDILEEHIDDKST 52 + A DFG+PQ R R++ I L ++ F F + P + + LEE +D+K Sbjct: 149 LNAMDFGLPQDRNRVFTISILGENL-FDFDKLEKKETPHIKEFLEEIVDEKYI 200 >gi|119511191|ref|ZP_01630308.1| C-5 cytosine-specific DNA methylase [Nodularia spumigena CCY9414] gi|119464179|gb|EAW45099.1| C-5 cytosine-specific DNA methylase [Nodularia spumigena CCY9414] Length = 432 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL--GIKPRLGDILEEHIDDKSTISNKLW 58 + A FGVPQ RERL+I+ N +P + KP+ L ++ +S +W Sbjct: 157 LNAAHFGVPQNRERLFILGCRNDLELPNYPEAITQRAKPK-KSGLPHELN----LSPTVW 211 Query: 59 EGHQK 63 E Q Sbjct: 212 EALQD 216 >gi|302347057|ref|YP_003815355.1| putative modification methylase HhaI [Prevotella melaninogenica ATCC 25845] gi|302150379|gb|ADK96640.1| putative modification methylase HhaI [Prevotella melaninogenica ATCC 25845] Length = 453 Score = 52.6 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Query: 5 DFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61 +FG+PQ R+R+YI+ F FP + DI+E + D I+ E H Sbjct: 154 EFGIPQHRKRIYIVCIRKDLGLLDNFTFPKGNKPVCDVNDIIEANAKD---ITPIKEETH 210 Query: 62 QK 63 + Sbjct: 211 YQ 212 >gi|258593909|emb|CAA33765.2| DNA(cytosine-5)methyltransferase [Lysinibacillus sphaericus] Length = 396 Score = 52.2 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL-----GIKPRLGDILEEHIDD 49 + A D+GVPQ RER+ I+ N +++P G+KP + LEE I D Sbjct: 198 LNARDYGVPQIRERVIIVGVRNDIDFNYEYPEITHGNEEGLKPYVT--LEEAIGD 250 >gi|282899425|ref|ZP_06307392.1| DNA-cytosine methyltransferase [Cylindrospermopsis raciborskii CS-505] gi|281195689|gb|EFA70619.1| DNA-cytosine methyltransferase [Cylindrospermopsis raciborskii CS-505] Length = 384 Score = 52.2 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/74 (22%), Positives = 29/74 (39%), Gaps = 20/74 (27%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A ++G+PQRRER++I+ ++ + FP P L LW Sbjct: 176 LDAANYGIPQRRERVFIVGIRQDLNINWSFPQPSHSYDSL-----------------LWS 218 Query: 60 GH--QKRKENNKIA 71 E ++I Sbjct: 219 QFVSYDYWERHQIK 232 >gi|315644199|ref|ZP_07897369.1| DNA-cytosine methyltransferase [Paenibacillus vortex V453] gi|315280574|gb|EFU43863.1| DNA-cytosine methyltransferase [Paenibacillus vortex V453] Length = 485 Score = 52.2 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 8/57 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-------LGIKPRLGDILEEHIDD 49 + + D+GVPQ RER+ ++ N ++++P P L L D + + ++D Sbjct: 225 LNSRDYGVPQLRERVILVGVRNDIDFDYEYPEPSHGEGLGLNPYVTLRDAIGDLVED 281 >gi|294678239|ref|YP_003578854.1| cytosine-specific DNA-methyltransferase [Rhodobacter capsulatus SB 1003] gi|294477059|gb|ADE86447.1| site-specific DNA-methyltransferase (cytosine-specific) [Rhodobacter capsulatus SB 1003] Length = 451 Score = 52.2 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Query: 6 FGVPQRRERLYIIDFLNPSVEFKFPTPLGI--KPRLGDILEEHIDDKSTISNKLWEGH 61 FGVPQ RER I+ F +P P + + +L+E + + + + Sbjct: 149 FGVPQVRERAIIVGSRTGLRHFSWPEPTHQLDQVTIKSVLDEKPKEARPLGPRFIQYL 206 >gi|224543136|ref|ZP_03683675.1| hypothetical protein CATMIT_02336 [Catenibacterium mitsuokai DSM 15897] gi|224523923|gb|EEF93028.1| hypothetical protein CATMIT_02336 [Catenibacterium mitsuokai DSM 15897] Length = 430 Score = 52.2 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/83 (24%), Positives = 32/83 (38%), Gaps = 14/83 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNKL 57 + A FG+PQ R+R+YI+ + + L D+LE +D K T +L Sbjct: 159 LNAKYFGIPQERKRIYIVGTKKEKPNLE--KFHRLDCSLADVLETGIPTMDSKFT---RL 213 Query: 58 WEGHQK------RKENNKIAGKG 74 H + +K G Sbjct: 214 LLKHYSVEELFGKAIKDKRGGNN 236 >gi|331002097|ref|ZP_08325616.1| hypothetical protein HMPREF0491_00478 [Lachnospiraceae oral taxon 107 str. F0167] gi|330411191|gb|EGG90607.1| hypothetical protein HMPREF0491_00478 [Lachnospiraceae oral taxon 107 str. F0167] Length = 706 Score = 52.2 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 8/60 (13%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHID------DKSTI 53 + A +FGVPQ RER+ I+ +F ++ + L++ D D TI Sbjct: 147 LNARNFGVPQNRERIIIVGNIDGRIFDFTKLKMNTVET-MKPFLDKAADFEILPRDSYTI 205 >gi|119510471|ref|ZP_01629604.1| DNA cytosine methylase [Nodularia spumigena CCY9414] gi|119464893|gb|EAW45797.1| DNA cytosine methylase [Nodularia spumigena CCY9414] Length = 727 Score = 52.2 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 20/43 (46%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 + + DFG+PQ RER+ + + FK P L + L Sbjct: 146 VNSRDFGLPQNRERVVFVATKDKKFNFKTLQKSHPVPTLREFL 188 >gi|293371777|ref|ZP_06618187.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f] gi|292633229|gb|EFF51800.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f] Length = 459 Score = 52.2 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 6/51 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG-----IKPRLGDILEE 45 + A D+ +PQ R R++I+ F+ + FKFP P ++ +GDI EE Sbjct: 143 LNAADYCIPQDRFRVFIVGFIKELNGAFKFPEPSQKPLVTLQKAIGDITEE 193 >gi|298286911|sp|P13906|MTB1_BACSH RecName: Full=Modification methylase BspRI; Short=M.BspRI; AltName: Full=Cytosine-specific methyltransferase BspRI gi|258593908|emb|CAA33764.2| DNA(cytosine-5)methyltransferase [Lysinibacillus sphaericus] Length = 424 Score = 52.2 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL-----GIKPRLGDILEEHIDD 49 + A D+GVPQ RER+ I+ N +++P G+KP + LEE I D Sbjct: 226 LNARDYGVPQIRERVIIVGVRNDIDFNYEYPEITHGNEEGLKPYVT--LEEAIGD 278 >gi|632681|gb|AAB31678.1| DNA (cytosine-5)-methyltransferase, m5C-MTase {BspRI restriction-modification system} [Escherichia coli, Peptide, 424 aa] Length = 424 Score = 52.2 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL-----GIKPRLGDILEEHIDD 49 + A D+GVPQ RER+ I+ N +++P G+KP + LEE I D Sbjct: 226 LNARDYGVPQIRERVIIVGVRNDIDFNYEYPEITHGNEEGLKPYVT--LEEAIGD 278 >gi|6272296|gb|AAF06073.1|AF072715_4 putative methylase [Mycoplasma mycoides subsp. capri] Length = 390 Score = 52.2 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + + D+G Q RER++ I +L+ F FP PL K + I++ D K N L + Sbjct: 229 VNSTDYGSCQNRERVFCISYLDKQKNFTFPKPLITKKEIDSIIKNDDDMKEC--NHLLKY 286 Query: 61 H 61 Sbjct: 287 L 287 >gi|226324849|ref|ZP_03800367.1| hypothetical protein COPCOM_02636 [Coprococcus comes ATCC 27758] gi|225207297|gb|EEG89651.1| hypothetical protein COPCOM_02636 [Coprococcus comes ATCC 27758] Length = 473 Score = 52.2 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + + DFGVPQ RER +I+ L K FP Sbjct: 176 LNSKDFGVPQNRERCFIVGHLRGRGSAKVFP 206 >gi|270686639|ref|ZP_06222860.1| modification methylase DsaV [Haemophilus influenzae HK1212] gi|270316163|gb|EFA28145.1| modification methylase DsaV [Haemophilus influenzae HK1212] Length = 225 Score = 52.2 bits (125), Expect = 3e-05, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDI 42 +KA D+G+PQ R R ++I F + V F FP P+ +K + D+ Sbjct: 18 LKASDYGLPQLRPRAFMIGFRDDHVLGNFSFPEPIPLKFTMSDV 61 >gi|257062089|ref|YP_003139977.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] gi|256592255|gb|ACV03142.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] Length = 456 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILE 44 + + DFG+ Q R+R++I+ +F FP PL + P+L + +E Sbjct: 173 LNSYDFGLSQDRDRVFIVGIHQQIENAAQFSFPEPLNLSPKLYEFIE 219 >gi|328946815|gb|EGG40952.1| modification methylase DdeI [Streptococcus sanguinis SK1087] Length = 387 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP--LGIKPRLGDILEE 45 + A DFGVPQ RER+++I E+ FP L + L D + + Sbjct: 169 INAKDFGVPQNRERVFLIGIRKDLKIKFEWTFPEETTLNNEITLRDAISD 218 >gi|225862883|ref|YP_002748261.1| DNA (cytosine-5-)-methyltransferase [Bacillus cereus 03BB102] gi|225787129|gb|ACO27346.1| DNA (cytosine-5-)-methyltransferase [Bacillus cereus 03BB102] Length = 367 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A D+GVPQ R+R++ + L+ F++P K Sbjct: 152 LNAADYGVPQNRQRVFFVGVLD--GHFEYPELDENK 185 >gi|535137|emb|CAA56493.1| type II DNA-methyltransferase [Bacillus phage phi3T] Length = 326 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34 + A D+GV Q+RER++I+ N +F FP PL Sbjct: 155 VNAWDYGVAQKRERVFIVGVRNDLGFKFDFPNPLE 189 >gi|317010333|gb|ADU84080.1| cytosine specific DNA methyltransferase [Helicobacter pylori SouthAfrica7] Length = 361 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 19/35 (54%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ + S +F P Sbjct: 153 LNAKDYGVPQSRERAFIVGATHFSFDFDLLEPSQS 187 >gi|315611977|ref|ZP_07886895.1| C-5 cytosine-specific DNA methylase [Streptococcus sanguinis ATCC 49296] gi|315315966|gb|EFU64000.1| C-5 cytosine-specific DNA methylase [Streptococcus sanguinis ATCC 49296] Length = 359 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + DFGVPQ RER++I+ Sbjct: 147 LNSKDFGVPQNRERVFIVG 165 >gi|157961098|ref|YP_001501132.1| DNA-cytosine methyltransferase [Shewanella pealeana ATCC 700345] gi|157846098|gb|ABV86597.1| DNA-cytosine methyltransferase [Shewanella pealeana ATCC 700345] Length = 406 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 + A +GVPQ RER++I+ FK P+P + + Sbjct: 161 VNASSYGVPQHRERVFIVA-NRDGGTFKMPSPTHSDSKDPTL 201 >gi|260579295|ref|ZP_05847178.1| modification methylase NaeI (cytosine-specificmethyltransferase NaeI) (M.NaeI) [Corynebacterium jeikeium ATCC 43734] gi|258602594|gb|EEW15888.1| modification methylase NaeI (cytosine-specificmethyltransferase NaeI) (M.NaeI) [Corynebacterium jeikeium ATCC 43734] Length = 372 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEE 45 A DFGVPQ R R ++ P + F +P PL + +G+ L Sbjct: 180 AADFGVPQLRPRFVLVALREPYADYFAWPEPLDTRVTVGEALHS 223 >gi|68536951|ref|YP_251655.1| putative DNA restriction-modification system, DNA methylase [Corynebacterium jeikeium K411] gi|68264550|emb|CAI38038.1| putative DNA restriction-modification system, DNA methylase [Corynebacterium jeikeium K411] Length = 341 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEE 45 A DFGVPQ R R ++ P + F +P PL + +G+ L Sbjct: 149 AADFGVPQLRPRFVLVALREPYADYFAWPEPLDTRVTVGEALHS 192 >gi|325955715|ref|YP_004293189.1| modification methylase BsuRI [Lactobacillus acidophilus 30SC] gi|325334695|gb|ADZ08248.1| modification methylase BsuRI [Lactobacillus acidophilus 30SC] Length = 406 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKF--PTPLG 34 + A D+GVPQ RER++++ N + F++ P P Sbjct: 224 VNAKDYGVPQSRERVFLVGVRNDIADKFQYTVPEPTN 260 >gi|225856779|ref|YP_002738290.1| methyl transferase [Streptococcus pneumoniae P1031] gi|225724445|gb|ACO20297.1| methyl transferase [Streptococcus pneumoniae P1031] Length = 452 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL 43 + + DFGVPQ RER++II FP + + L Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQTTNSETL 191 >gi|127417|sp|P25262|MTB1_HERAU RecName: Full=Modification methylase HgiBI; Short=M.HgiBI; AltName: Full=Cytosine-specific methyltransferase HgiBI gi|43478|emb|CAA38927.1| methyltransferase [Herpetosiphon aurantiacus] Length = 437 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE 44 + + DFGV Q R+R++I+ F FP + RL IL+ Sbjct: 146 LNSFDFGVAQNRDRVFIVGIQQKLDLNGFSFPEYTESEQRLYHILD 191 >gi|183217290|gb|ACC59209.1| methyltransferase [Streptococcus pneumoniae] gi|321156848|emb|CBW38835.1| putative DNA methylase [Streptococcus pneumoniae] Length = 452 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 23/92 (25%), Positives = 32/92 (34%), Gaps = 18/92 (19%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP---TPLGIKPRLGDIL------EEHIDDK 50 + + DFGVPQ RER++II FP P IL + + K Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQATNPETLKILGNLNPSKSGMSGK 207 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82 S L + GKG G+ + Sbjct: 208 VYYSEGLAPTLVR--------GKGEGFKIAIP 231 >gi|313884351|ref|ZP_07818113.1| putative modification methylase BanI [Eremococcus coleocola ACS-139-V-Col8] gi|312620429|gb|EFR31856.1| putative modification methylase BanI [Eremococcus coleocola ACS-139-V-Col8] Length = 335 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Query: 1 MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51 + A FGV Q+R+RL +I ++F++P G L D+L++ D Sbjct: 146 LNAAYFGVGQKRQRLIVIGIRSDLKDKIDFEYPKEDGEMTILRDVLKDVPDSPY 199 >gi|67458529|ref|YP_246153.1| site-specific DNA methylase [Rickettsia felis URRWXCal2] gi|67004062|gb|AAY60988.1| Site-specific DNA methylase [Rickettsia felis URRWXCal2] Length = 171 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 5/59 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPR--LGDILEEHIDDKSTIS 54 + A FGVPQ RER+Y + K+ P R LGDILE+ +D I+ Sbjct: 2 LNASLFGVPQARERVYFVCLRKDFSSEYILKYVKPKESYERIFLGDILEKEVDKSLYIN 60 >gi|218249004|ref|YP_002374375.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] gi|218169482|gb|ACK68219.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] Length = 456 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILE 44 + + DFG+ Q R+R++I+ +F FP PL + P+L + +E Sbjct: 173 LNSYDFGLSQDRDRVFIVGIHQQIENAAQFSFPEPLNLSPKLYEFIE 219 >gi|295110826|emb|CBL24779.1| DNA-methyltransferase (dcm) [Ruminococcus obeum A2-162] Length = 312 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 20/76 (26%), Positives = 31/76 (40%), Gaps = 22/76 (28%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK---------------------PR 38 + A D+GVPQ R+R+ II N + E+ +P P K P Sbjct: 142 LNAADYGVPQTRQRVIIIGVRNDINFEYIYPLPTNSKNGKDGLPEWISVSEAMAHIPDPD 201 Query: 39 LGDILEEHIDDKSTIS 54 L + L H+ K ++ Sbjct: 202 LPNDLPNHVYSKYKLN 217 >gi|52788777|gb|AAU87368.1| MnlI m5C-methyltransferase [Moraxella nonliquefaciens] Length = 351 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 18/28 (64%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK 28 + A D+GVPQ RER++II N +F Sbjct: 150 LNAKDYGVPQSRERIFIIATKNQPFDFD 177 >gi|23428398|gb|AAL15430.1| DNA methyltransferase A [Moraxella nonliquefaciens] Length = 351 Score = 51.8 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 18/28 (64%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK 28 + A D+GVPQ RER++II N +F Sbjct: 150 LNAKDYGVPQSRERIFIIATKNQPFDFD 177 >gi|323650438|gb|ADX97294.1| M.Cac8I [Clostridium acetobutylicum] Length = 398 Score = 51.5 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDK 50 + A +FGVPQ RER+ I+ N + + P +K + + + K Sbjct: 181 LNAYNFGVPQNRERVIIVGIRNDLRDRYIIPQKPAVKNKRKTLFVKPTHSK 231 >gi|228473386|ref|ZP_04058140.1| Cytosine-specific methyltransferase HphIA [Capnocytophaga gingivalis ATCC 33624] gi|228275288|gb|EEK14086.1| Cytosine-specific methyltransferase HphIA [Capnocytophaga gingivalis ATCC 33624] Length = 358 Score = 51.5 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + A D+GVPQ R R +++ +EF+FP P K + + Sbjct: 149 LWASDYGVPQNRNRFFMVG-NRHGIEFEFPEPFEKKITVEE 188 >gi|284803522|emb|CBJ23522.1| putative methyltransferase [Streptococcus pneumoniae] Length = 372 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 23/92 (25%), Positives = 32/92 (34%), Gaps = 18/92 (19%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP---TPLGIKPRLGDIL------EEHIDDK 50 + + DFGVPQ RER++II FP P IL + + K Sbjct: 2 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQATNPETLKILGNLNPSKSGMSGK 61 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82 S L + GKG G+ + Sbjct: 62 VYYSEGLAPTLVR--------GKGEGFKIAIP 85 >gi|228478395|ref|ZP_04063003.1| modification methylase HaeIII [Streptococcus salivarius SK126] gi|228250074|gb|EEK09344.1| modification methylase HaeIII [Streptococcus salivarius SK126] Length = 387 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A DFGVPQ RER+++I E+ FP + + L + I D + N Sbjct: 169 INAKDFGVPQNRERVFLIGVRKDLKIKSEWIFPEETSLNNEIT--LRDAISDLPILGNNE 226 Query: 58 WEGHQ 62 + + Sbjct: 227 QKYNY 231 >gi|4063721|gb|AAC98421.1| methyl transferase [Streptococcus pneumoniae] Length = 452 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 23/92 (25%), Positives = 32/92 (34%), Gaps = 18/92 (19%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP---TPLGIKPRLGDIL------EEHIDDK 50 + + DFGVPQ RER++II FP P IL + + K Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLGFPFRREGQATNPETLKILGNLNPSKSGMSGK 207 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82 S L + GKG G+ + Sbjct: 208 VYYSEGLAPTLVR--------GKGEGFKIAIP 231 >gi|307294815|ref|ZP_07574657.1| DNA-cytosine methyltransferase [Sphingobium chlorophenolicum L-1] gi|306879289|gb|EFN10507.1| DNA-cytosine methyltransferase [Sphingobium chlorophenolicum L-1] Length = 394 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGI 35 + A ++GVPQRRER+ F + +E+ FP P Sbjct: 187 LNAANYGVPQRRERVVFAGFRADLGIEWSFPEPTHS 222 >gi|239627884|ref|ZP_04670915.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA] gi|239518030|gb|EEQ57896.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA] Length = 325 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53 +KA D+G R+R+Y + F +F FP + D L + +D+ I Sbjct: 144 LKASDYGCATIRKRIYFVCFRKDLKAKFSFPESFESNIAVEDFLNQEVDEHYYI 197 >gi|49476997|ref|YP_035183.1| modification methylase DdeI; cytosine-specific methyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] gi|49328553|gb|AAT59199.1| modification methylase DdeI; possible cytosine-specific methyltransferase [Bacillus thuringiensis serovar konkukian str. 97-27] Length = 450 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLG 34 + ++GVPQ RER++I+ N + F +P Sbjct: 193 LNCANYGVPQNRERVFIVGINNKYENTYFSYPQQTH 228 >gi|298735876|ref|YP_003728401.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8] gi|298355065|emb|CBI65937.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8] Length = 312 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q+RERLYI+ F F FP L D L+ Sbjct: 139 LNSTDFQLAQKRERLYIVGFRKDLKHPFHFPLGLANDYYFEDFLDAD 185 >gi|257438608|ref|ZP_05614363.1| modification methylase NgoMIV [Faecalibacterium prausnitzii A2-165] gi|257198937|gb|EEU97221.1| modification methylase NgoMIV [Faecalibacterium prausnitzii A2-165] Length = 293 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFP-TPLGIKPRLGDIL 43 + A D+GVPQ R R+ I+ F++P P +G+ L Sbjct: 124 LNASDYGVPQLRPRVVIVGIRKDQAGAFEYPQEHPRESPTVGETL 168 >gi|256545597|ref|ZP_05472956.1| modification methylase HaeIII (cytosine-specificmethyltransferase HaeIII) [Anaerococcus vaginalis ATCC 51170] gi|256398722|gb|EEU12340.1| modification methylase HaeIII (cytosine-specificmethyltransferase HaeIII) [Anaerococcus vaginalis ATCC 51170] Length = 340 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 18/74 (24%), Positives = 29/74 (39%), Gaps = 13/74 (17%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + A D+GVPQ R+R++ + F ++ F P P K D + + + Sbjct: 142 LNASDYGVPQDRKRVFYVGFRKDLNISFDLPPKPYDYKLTFRDAI-------YDLKDNAI 194 Query: 59 EGHQKRKENNKIAG 72 E NK G Sbjct: 195 PAL----EKNKTNG 204 >gi|281491831|ref|YP_003353811.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp. lactis KF147] gi|281375542|gb|ADA65048.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp. lactis KF147] Length = 347 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 20/40 (50%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40 + A DFGVPQ+R R+ + N +F FP + + Sbjct: 153 LVASDFGVPQKRRRIVFVGLQNDVFDFNFPEFGMVTTEMA 192 >gi|237728463|ref|ZP_04558944.1| DNA-cytosine methyltransferase [Citrobacter sp. 30_2] gi|226909941|gb|EEH95859.1| DNA-cytosine methyltransferase [Citrobacter sp. 30_2] Length = 318 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK-PRLGDILEE 45 + A D+GV Q R R+ + + F +P PL + P +G++L + Sbjct: 145 LNASDYGVSQLRPRVVFVGIRKDLAAGFSWPEPLKTEPPTVGELLHD 191 >gi|462651|sp|P34906|MTF1_FUSNU RecName: Full=Modification methylase FnuDI; Short=M.FnuDI; AltName: Full=Cytosine-specific methyltransferase FnuDI gi|2961231|gb|AAC05695.1| FnuDI DNA modification methyltransferase [Fusobacterium nucleatum] Length = 344 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 19/75 (25%), Positives = 31/75 (41%), Gaps = 15/75 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + A D+GV Q RER++ + F F+FP P+ K R K + + +W Sbjct: 142 LNAFDYGVAQDRERVFYVGFRKDLNISNFEFPYPISEKER-----------KY-LKDSIW 189 Query: 59 EGHQKRKENNKIAGK 73 + + K K Sbjct: 190 D-LKDNALPGKDKNK 203 >gi|322510870|gb|ADX06184.1| putative C-5 cytosine-specific DNA methyltransferase [Organic Lake phycodnavirus 1] Length = 465 Score = 51.5 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDIL 43 + A + VPQ+RER++I+ L N F+FP K L D+L Sbjct: 288 LDASKYDVPQKRERVFIVGVLKNIDRSFEFPNESLTKKVLKDVL 331 >gi|182684309|ref|YP_001836056.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus pneumoniae CGSP14] gi|221232093|ref|YP_002511246.1| DNA methylase [Streptococcus pneumoniae ATCC 700669] gi|182629643|gb|ACB90591.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus pneumoniae CGSP14] gi|220674554|emb|CAR69117.1| putative DNA methylase [Streptococcus pneumoniae ATCC 700669] Length = 452 Score = 51.1 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 33/92 (35%), Gaps = 18/92 (19%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50 + + DFGVPQ RER++II + FP + + L + + K Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGIRLLFPFRREGQATNSETLKTLGNLNPSKSGMSGK 207 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82 S L + GKG G+ + Sbjct: 208 VYYSEGLAPTLVR--------GKGEGFKIAIP 231 >gi|168185144|ref|ZP_02619808.1| modification methylase SinI [Clostridium botulinum Bf] gi|182671812|gb|EDT83773.1| modification methylase SinI [Clostridium botulinum Bf] Length = 363 Score = 51.1 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 + A D+G+ Q+RER++I+ + +F+FP K Sbjct: 172 INAADYGIAQKRERVFIVGIRKDLNKKFEFPEKTHNK 208 >gi|325912401|ref|ZP_08174796.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 143-D] gi|325475743|gb|EGC78914.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 143-D] Length = 336 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + + L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIKRESFVFPQPFKLNRFVENFLLPD 199 >gi|309809622|ref|ZP_07703479.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners SPIN 2503V10-D] gi|308170103|gb|EFO72139.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners SPIN 2503V10-D] Length = 336 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + + L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVENFLLPD 199 >gi|259500984|ref|ZP_05743886.1| modification methylase EcoRII [Lactobacillus iners DSM 13335] gi|302190566|ref|ZP_07266820.1| DNA-cytosine methyltransferase [Lactobacillus iners AB-1] gi|259167678|gb|EEW52173.1| modification methylase EcoRII [Lactobacillus iners DSM 13335] Length = 336 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + + L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVENFLLPD 199 >gi|169832810|ref|YP_001694558.1| methyl transferase [Streptococcus pneumoniae Hungary19A-6] gi|168995312|gb|ACA35924.1| methyl transferase [Streptococcus pneumoniae Hungary19A-6] Length = 452 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 20/85 (23%), Positives = 30/85 (35%), Gaps = 16/85 (18%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50 + + DFGVPQ RER++II FP + + L + + K Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKILGNLNPSKSGMSGK 207 Query: 51 STISNKLWEGHQKRKENNKIAGKGF 75 S L + G+GF Sbjct: 208 VYYSEGLAPTLVR------SKGEGF 226 >gi|315222611|ref|ZP_07864500.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211] gi|315188297|gb|EFU22023.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211] Length = 317 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51 + A DFG+PQ+RER++++ L + F F + I+ + + LEE + + Sbjct: 153 LNAMDFGIPQKRERIFVVSILGENY-FNFSSLEKIEAKDISKFLEEDVSNLY 203 >gi|293975|gb|AAB59071.1| cytosine methylase [Neisseria gonorrhoeae] Length = 341 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 A D+GV Q R+R++ I F ++F FP G +E+ DK T+ + +W+ Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPK--------GSTVEDK--DKITLKDVIWD 204 >gi|289423000|ref|ZP_06424820.1| modification methylase ScrFIB [Peptostreptococcus anaerobius 653-L] gi|289156574|gb|EFD05219.1| modification methylase ScrFIB [Peptostreptococcus anaerobius 653-L] Length = 329 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 16/76 (21%), Positives = 32/76 (42%), Gaps = 6/76 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLWE 59 + A +FG+PQ+RER++++ L + F F + R + + LE+ + E Sbjct: 165 LNAIEFGIPQKRERIFVVSIL-GNNSFDFAKLEKTQTRDISEFLEKDASNLY---EVRQE 220 Query: 60 GHQKRKENNKIAGKGF 75 + + F Sbjct: 221 SMLRY-IRGEPKNNNF 235 >gi|322372404|ref|ZP_08046940.1| modification methylase DdeI [Streptococcus sp. C150] gi|321277446|gb|EFX54515.1| modification methylase DdeI [Streptococcus sp. C150] Length = 387 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A DFGVPQ RER+++I E+ FP + + + L + I D + N Sbjct: 169 INAKDFGVPQNRERVFLIGVRKDLKIKSEWIFPEAMTLNNEIT--LRDAISDLPILGNNE 226 Query: 58 WEGHQ 62 + + Sbjct: 227 QKYNY 231 >gi|212632918|ref|YP_002309443.1| site-specific DNA-methyltransferase [Shewanella piezotolerans WP3] gi|212554402|gb|ACJ26856.1| Site-specific DNA-methyltransferase (cytosine-specific) [Shewanella piezotolerans WP3] Length = 412 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 6/71 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEH--IDDKSTISN 55 +KA + VPQ+RERL ++ S +F +P+P L D E+ D K S Sbjct: 221 LKAIFYKVPQKRERLILVGVRKDLATSAKFSWPSPYKRIMTLKDAFEKGELFDSKVEESP 280 Query: 56 KLWEGHQKRKE 66 E Q++KE Sbjct: 281 G-QEYPQRKKE 290 >gi|254003164|ref|YP_003052630.1| C-5 cytosine-specific DNA methylase [Methylovorus sp. SIP3-4] gi|253987247|gb|ACT52103.1| C-5 cytosine-specific DNA methylase [Methylovorus sp. SIP3-4] Length = 550 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 24/101 (23%), Positives = 45/101 (44%), Gaps = 10/101 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP-RLGDILEEHIDDKSTISNKLW 58 + ++G + R+R ++ + +F P +P RLGD+LEE + + W Sbjct: 285 LNGKEWGTLENRDRWVMVAVTHGIEFDFSQLIPPDARPMRLGDVLEEVP-----LDDPRW 339 Query: 59 ---EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 + + ++ + GK F +F E+S TL+ Y K Sbjct: 340 NKMQYLKDKEVRDAAEGKNFKMQIFTEDSEHIGTLTKGYAK 380 >gi|83854666|ref|ZP_00948196.1| DNA modification methylase M.NGOI [Sulfitobacter sp. NAS-14.1] gi|83842509|gb|EAP81676.1| DNA modification methylase M.NGOI [Sulfitobacter sp. NAS-14.1] Length = 254 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDILEE 45 + A D+GVPQ R R+ I+ + F +P P P +G+ L++ Sbjct: 80 LNASDYGVPQLRPRVVIVALPKDRADFFDWPEPNPHNPPTVGETLKD 126 >gi|281420197|ref|ZP_06251196.1| modification methylase HgiDII [Prevotella copri DSM 18205] gi|281405692|gb|EFB36372.1| modification methylase HgiDII [Prevotella copri DSM 18205] Length = 353 Score = 51.1 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGD 41 + A D+GVPQRR+R+ I+ F++P P K + + Sbjct: 157 LDAQDYGVPQRRKRVVIVGERKDHKIPLFEYPKPQEHKITVRE 199 >gi|323691274|ref|ZP_08105549.1| cytosine-specific methyltransferase [Clostridium symbiosum WAL-14673] gi|323504614|gb|EGB20401.1| cytosine-specific methyltransferase [Clostridium symbiosum WAL-14673] Length = 324 Score = 51.1 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51 + A +FG+PQ RER++ + LN +F+F + R L + LE+ + D Sbjct: 164 LDAREFGLPQARERVFTVSVLNGE-KFEFDDLIRTPMRNLQEFLEDDVPDIY 214 >gi|330891417|gb|EGH24078.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. mori str. 301020] Length = 201 Score = 51.1 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDILEE 45 + A DFGV Q R R+ + E F +P P L I P +G++L + Sbjct: 152 LNASDFGVTQLRPRVVFVGIRKDLAEGFSWPEPKLIIPPTVGELLHD 198 >gi|315653956|ref|ZP_07906872.1| modification methylase EcoRII [Lactobacillus iners ATCC 55195] gi|315488652|gb|EFU78298.1| modification methylase EcoRII [Lactobacillus iners ATCC 55195] Length = 336 Score = 51.1 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + + L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIKRESFVFPQPFKLNRFVENFLLPD 199 >gi|312874304|ref|ZP_07734336.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF 2052A-d] gi|311090177|gb|EFQ48589.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF 2052A-d] Length = 336 Score = 51.1 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + + L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVENFLLPD 199 >gi|59802113|ref|YP_208825.1| DcmB [Neisseria gonorrhoeae FA 1090] gi|268593822|ref|ZP_06127989.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria gonorrhoeae 35/02] gi|268597735|ref|ZP_06131902.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria gonorrhoeae FA19] gi|291042825|ref|ZP_06568566.1| site-specific DNA-methyltransferase M.NgoPII [Neisseria gonorrhoeae DGI2] gi|293398154|ref|ZP_06642359.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|44873|emb|CAA30038.1| unnamed protein product [Neisseria gonorrhoeae] gi|44888|emb|CAA36888.1| NgoPII restriction and modification [Neisseria gonorrhoeae] gi|293960|gb|AAA17019.1| cytosine methylase [Neisseria gonorrhoeae] gi|59719008|gb|AAW90413.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria gonorrhoeae FA 1090] gi|268547211|gb|EEZ42629.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria gonorrhoeae 35/02] gi|268551523|gb|EEZ46542.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria gonorrhoeae FA19] gi|291013259|gb|EFE05225.1| site-specific DNA-methyltransferase M.NgoPII [Neisseria gonorrhoeae DGI2] gi|291611417|gb|EFF40487.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|227054|prf||1613419B NgoPII methylase Length = 341 Score = 51.1 bits (122), Expect = 6e-05, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 A D+GV Q R+R++ I F ++F FP G +E+ DK T+ + +W+ Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPK--------GSTVEDK--DKITLKDVIWD 204 >gi|312874943|ref|ZP_07734962.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF 2053A-b] gi|311089688|gb|EFQ48113.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF 2053A-b] Length = 336 Score = 50.7 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46 + ++G+PQ+RER+Y++ F N F FP P + + + L Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIKRESFVFPQPFKLNRFVENFLLPD 199 >gi|1399076|gb|AAB03209.1| NgoII cytosine methylase M.NgoII [Neisseria gonorrhoeae] Length = 341 Score = 50.7 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 A D+GV Q R+R++ I F ++F FP G +E+ DK T+ + +W+ Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPK--------GSTVEDK--DKITLKDVIWD 204 >gi|17548155|ref|NP_521557.1| DNA modification cytosine-specific methyltransferase [Ralstonia solanacearum GMI1000] gi|17430462|emb|CAD16935.1| probable site-specific dna methylase protein [Ralstonia solanacearum GMI1000] Length = 364 Score = 50.7 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 14/70 (20%), Positives = 29/70 (41%), Gaps = 6/70 (8%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKF--PTPLGIKPRLGDILEEHIDDKST---IS 54 + A ++ VPQ RERL ++ F + + + P P + + + + + ++ Sbjct: 154 LNAANYSVPQNRERLIMVGFNRDLYPDLTWLPPGPKNARLTVREAIGALPEPTYFQRNLT 213 Query: 55 NKLWEGHQKR 64 NK H Sbjct: 214 NKDIPHHPNH 223 >gi|225863800|ref|YP_002749178.1| cytosine-specific methyltransferase NlaX [Bacillus cereus 03BB102] gi|225788166|gb|ACO28383.1| cytosine-specific methyltransferase NlaX [Bacillus cereus 03BB102] Length = 576 Score = 50.7 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FP---TPLGIKPRLGDILEEHIDDKSTISNK 56 + + DFGVPQ RER++II L + + FP G +G + E + D + K Sbjct: 148 LNSKDFGVPQNRERVFIIGHLRGTCGREVFPIRRKNEGSINIVGYLSEGYKDVNYVLDPK 207 >gi|219871000|ref|YP_002475375.1| cytosine specific DNA methyltransferase (BSP6IM) [Haemophilus parasuis SH0165] gi|219691204|gb|ACL32427.1| cytosine specific DNA methyltransferase (BSP6IM) [Haemophilus parasuis SH0165] Length = 295 Score = 50.7 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 10/75 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTI----S 54 + + +GVPQ RER+Y + F+FPTP IK DI E I+++ I + Sbjct: 121 LDSQFYGVPQMRERIYFVGIRKDIKHKPFEFPTPEPIK----DIAECLIEERDYIFDENN 176 Query: 55 NKLWEGHQKRKENNK 69 + + NNK Sbjct: 177 PTFQKYLHNKYNNNK 191 >gi|194099965|ref|YP_002003104.1| Modification methylase NgoPII [Neisseria gonorrhoeae NCCP11945] gi|239997973|ref|ZP_04717897.1| Modification methylase NgoPII [Neisseria gonorrhoeae 35/02] gi|240015049|ref|ZP_04721962.1| Modification methylase NgoPII [Neisseria gonorrhoeae DGI18] gi|240017498|ref|ZP_04724038.1| Modification methylase NgoPII [Neisseria gonorrhoeae FA6140] gi|240122118|ref|ZP_04735080.1| Modification methylase NgoPII [Neisseria gonorrhoeae PID24-1] gi|240124411|ref|ZP_04737367.1| Modification methylase NgoPII [Neisseria gonorrhoeae PID332] gi|240124717|ref|ZP_04737603.1| Modification methylase NgoPII [Neisseria gonorrhoeae SK-92-679] gi|254494673|ref|ZP_05107844.1| modification methylase HaeIII [Neisseria gonorrhoeae 1291] gi|260439589|ref|ZP_05793405.1| Modification methylase NgoPII [Neisseria gonorrhoeae DGI2] gi|268599983|ref|ZP_06134150.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae MS11] gi|268602320|ref|ZP_06136487.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae PID18] gi|268683040|ref|ZP_06149902.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae PID332] gi|268683292|ref|ZP_06150154.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae SK-92-679] gi|268687469|ref|ZP_06154331.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae SK-93-1035] gi|462655|sp|P08455|MTP2_NEIGO RecName: Full=Modification methylase NgoPII; Short=M.NgoPII; AltName: Full=Cytosine-specific methyltransferase NgoPII gi|193935255|gb|ACF31079.1| Modification methylase NgoPII [Neisseria gonorrhoeae NCCP11945] gi|226513713|gb|EEH63058.1| modification methylase HaeIII [Neisseria gonorrhoeae 1291] gi|268584114|gb|EEZ48790.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae MS11] gi|268586451|gb|EEZ51127.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae PID18] gi|268623324|gb|EEZ55724.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae PID332] gi|268623576|gb|EEZ55976.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae SK-92-679] gi|268627753|gb|EEZ60153.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae SK-93-1035] gi|317165417|gb|ADV08958.1| DcmB [Neisseria gonorrhoeae TCDC-NG08107] Length = 330 Score = 50.7 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 A D+GV Q R+R++ I F ++F FP G +E+ DK T+ + +W+ Sbjct: 145 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPK--------GSTVEDK--DKITLKDVIWD 193 >gi|240081638|ref|ZP_04726181.1| DcmB [Neisseria gonorrhoeae FA19] gi|240113919|ref|ZP_04728409.1| DcmB [Neisseria gonorrhoeae MS11] gi|240116652|ref|ZP_04730714.1| DcmB [Neisseria gonorrhoeae PID18] gi|240129088|ref|ZP_04741749.1| DcmB [Neisseria gonorrhoeae SK-93-1035] Length = 325 Score = 50.7 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 A D+GV Q R+R++ I F ++F FP G +E+ DK T+ + +W+ Sbjct: 140 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPK--------GSTVEDK--DKITLKDVIWD 188 >gi|332075476|gb|EGI85945.1| modification methylase HpaII [Streptococcus pneumoniae GA41301] Length = 452 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 32/92 (34%), Gaps = 18/92 (19%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50 + + DFGVPQ RER++II FP + + L + + K Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKTLGNLNPSKSGMSGK 207 Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82 S L + GKG G+ + Sbjct: 208 VYYSEGLAPTLVR--------GKGEGFKIAIP 231 >gi|217032692|ref|ZP_03438178.1| hypothetical protein HPB128_202g26 [Helicobacter pylori B128] gi|216945622|gb|EEC24273.1| hypothetical protein HPB128_202g26 [Helicobacter pylori B128] Length = 211 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46 + + DF + Q+RERLYI+ F F FP L D L+ Sbjct: 139 LNSTDFQLAQKRERLYIVGFRKDLKHPFHFPLGLANDYYFEDFLDAD 185 >gi|217964683|ref|YP_002350361.1| cytosine-specific methyltransferase [Listeria monocytogenes HCC23] gi|217333953|gb|ACK39747.1| cytosine-specific methyltransferase [Listeria monocytogenes HCC23] Length = 340 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKP 37 + + DFGVPQ RER++II L + + FP + Sbjct: 148 LNSKDFGVPQNRERVFIIGHLRGAGGREIFPLAEASRT 185 >gi|332361999|gb|EGJ39801.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus sanguinis SK49] Length = 480 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEE 45 + + DFGVPQ RER++II FP + + L+E Sbjct: 176 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKE 221 >gi|319639602|ref|ZP_07994349.1| cytosine-specific methyltransferase [Neisseria mucosa C102] gi|317399173|gb|EFV79847.1| cytosine-specific methyltransferase [Neisseria mucosa C102] Length = 327 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 25/104 (24%), Positives = 43/104 (41%), Gaps = 19/104 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFP-TPLGIKPRLGD----ILEEHI------D 48 + A +FG+PQ+RER++++ + FP +P L LE+ I + Sbjct: 157 LLAANFGIPQKRERVFMVGVRKDIQKHYTFPMETHAEQPNLYQKPFVKLEKIITTLAIDN 216 Query: 49 DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92 K S K G + +NN G L+ + T++A Sbjct: 217 PKYYFSEKAVLGMKN-AKNNMKRG------LYQDLQGQCLTITA 253 >gi|148555377|ref|YP_001262959.1| DNA-cytosine methyltransferase [Sphingomonas wittichii RW1] gi|148500567|gb|ABQ68821.1| DNA-cytosine methyltransferase [Sphingomonas wittichii RW1] Length = 412 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 + A FGVPQ RER++I+ FKFP P Sbjct: 169 LNAASFGVPQLRERVFIVASREGK-NFKFPQPTH 201 >gi|329768652|ref|ZP_08260136.1| hypothetical protein HMPREF0428_01833 [Gemella haemolysans M341] gi|328836366|gb|EGF86031.1| hypothetical protein HMPREF0428_01833 [Gemella haemolysans M341] Length = 427 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 8/51 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDK 50 + + +FGVPQ RER++I+ L +K FP K E + K Sbjct: 148 LNSKNFGVPQNRERVFIVGHLRGGCTYKVFPIQGENK-------EPDFEPK 191 >gi|308229518|gb|ADO24171.1| M.AciI [Arthrobacter citreus] Length = 703 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 9/63 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--------SVEFKFPTPLGIKPRLGDILEEHIDDKST 52 M A D+GVPQ R R Y + N + EF FP + + +E Sbjct: 525 MNAKDYGVPQNRNRWYCVGINNDLGVVSTSMNSEF-FPEKEELTTFIDSFIETTFLPTYE 583 Query: 53 ISN 55 +S Sbjct: 584 VSE 586 Score = 39.9 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 17/86 (19%), Positives = 31/86 (36%), Gaps = 29/86 (33%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLG------------------- 40 + + + G+PQ R+R YI+ + P+ +F+ L Sbjct: 165 INSNEAGLPQNRDRTYIVGIKDFPTEKFEEDKRSKKISCLKKELNELEFHGFNFFNNVNF 224 Query: 41 --------DILEEHIDDKSTI-SNKL 57 DIL++ +D K S K+ Sbjct: 225 YNESQIISDILDDIVDKKYYFNSEKM 250 >gi|268604583|ref|ZP_06138750.1| cytosine methylase [Neisseria gonorrhoeae PID1] gi|268588714|gb|EEZ53390.1| cytosine methylase [Neisseria gonorrhoeae PID1] Length = 341 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 11/59 (18%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 A D+GV Q R+R++ I F ++F FP ++ + DK T+ + +W+ Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVENK----------DKITLKDVIWD 204 >gi|307570754|emb|CAR83933.1| C-5 cytosine-specific DNA methylase [Listeria monocytogenes L99] gi|307572166|emb|CAR85345.1| C-5 cytosine-specific DNA methylase [Listeria monocytogenes L99] Length = 426 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKP 37 + + DFGVPQ RER++II L + + FP + Sbjct: 148 LNSKDFGVPQNRERVFIIGHLRGAGGREIFPLAEASRT 185 >gi|268680341|ref|YP_003304772.1| DNA-cytosine methyltransferase [Sulfurospirillum deleyianum DSM 6946] gi|268618372|gb|ACZ12737.1| DNA-cytosine methyltransferase [Sulfurospirillum deleyianum DSM 6946] Length = 335 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+ VPQ R+RL+ + F ++ F+FP +K L D++ Sbjct: 143 LNAHDYKVPQDRQRLFFVGFRKDLNMTFEFPKAFPLKRYLKDVI 186 >gi|10955252|ref|NP_052188.1| DNA-methyltransferase [Escherichia coli] gi|1237268|gb|AAC37145.1| eco29kIM [Escherichia coli] gi|2660513|emb|CAA04944.1| DNA-methyltransferase [Escherichia coli] Length = 382 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51 + A D+GVPQ RER+ I+ + + ++ FP+ + +L + E+H+ Sbjct: 170 INAADYGVPQIRERVIIVGVRSDLNKKWSFPSVTHTQEKL--LWEQHVTGDY 219 >gi|19718332|ref|NP_604405.1| plasmid encoded methyltransferase Pem [Salmonella enteritidis] gi|19526586|gb|AAL87019.1| plasmid encoded methyltransferase Pem [Salmonella enterica subsp. enterica serovar Enteritidis] Length = 382 Score = 50.7 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51 + A D+GVPQ RER+ I+ + + ++ FP+ + +L + E+H+ Sbjct: 170 INAADYGVPQIRERVIIVGVRSDLNKKWSFPSVTHTQEKL--LWEQHVTGDY 219 >gi|296313785|ref|ZP_06863726.1| modification methylase NgoPII [Neisseria polysaccharea ATCC 43768] gi|296839714|gb|EFH23652.1| modification methylase NgoPII [Neisseria polysaccharea ATCC 43768] Length = 330 Score = 50.7 bits (121), Expect = 8e-05, Method: Composition-based stats. Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 19/91 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW- 58 + A D+GV Q R+R++ I F ++F FPT + D +DK T+ + +W Sbjct: 144 VNAKDYGVAQERKRVFYIGFRKDLKIKFSFPTGS----TVKD------EDKITLKDIIWD 193 Query: 59 -------EGHQKRKENNKIAGKGFGYGLFFE 82 Q + N I + G F Sbjct: 194 LQDTAVPAAFQNKANPNAINNNEYFIGSFSP 224 >gi|240118874|ref|ZP_04732936.1| DcmB [Neisseria gonorrhoeae PID1] Length = 325 Score = 50.3 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 11/59 (18%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 A D+GV Q R+R++ I F ++F FP ++ + DK T+ + +W+ Sbjct: 140 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVENK----------DKITLKDVIWD 188 >gi|312386601|emb|CBY05924.1| putative DNA methylase [Streptococcus pneumoniae] Length = 452 Score = 50.3 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + DFGVPQ RER++II FP Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFP 178 >gi|297621903|ref|YP_003710040.1| C-5 cytosine-specific DNA methylase [Waddlia chondrophila WSU 86-1044] gi|297377204|gb|ADI39034.1| C-5 cytosine-specific DNA methylase [Waddlia chondrophila WSU 86-1044] Length = 410 Score = 50.3 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56 +K+ + VPQ+RERL+I+ N +FK+P+P L D L++ + D ++ Sbjct: 220 LKSIFYQVPQKRERLFIVGVRNDLVKKAKFKWPSPFKKVLTLKDALKQGSLYDSDVPTSN 279 Query: 57 LWEGHQKRKE 66 Q++KE Sbjct: 280 GQLYPQRKKE 289 >gi|313891845|ref|ZP_07825450.1| putative modification methylase HhaI [Dialister microaerophilus UPII 345-E] gi|313119839|gb|EFR43026.1| putative modification methylase HhaI [Dialister microaerophilus UPII 345-E] Length = 394 Score = 50.3 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKST 52 + D+GVPQ RER+YI+ L + P + L +++ D+ Sbjct: 153 NSKDYGVPQNRERVYIVGHLGERCGRELLPVARKSERALKKVIDGSQGDRVY 204 >gi|167854495|ref|ZP_02477276.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus parasuis 29755] gi|219872138|ref|YP_002476513.1| DNA-cytosine methyltransferase/C-5 cytosine-specific DNA methylase [Haemophilus parasuis SH0165] gi|167854250|gb|EDS25483.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus parasuis 29755] gi|219692342|gb|ACL33565.1| DNA-cytosine methyltransferase/C-5 cytosine-specific DNA methylase [Haemophilus parasuis SH0165] Length = 320 Score = 50.3 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFP 30 + ++GVPQ RER+ I+ N + EF FP Sbjct: 158 LNTANYGVPQTRERVIIVGVRNDLTSEFFFP 188 >gi|315917403|ref|ZP_07913643.1| type II restriction-modification system methylation subunit [Fusobacterium gonidiaformans ATCC 25563] gi|313691278|gb|EFS28113.1| type II restriction-modification system methylation subunit [Fusobacterium gonidiaformans ATCC 25563] Length = 320 Score = 50.3 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51 + A DFG+PQ+RER++++ L + F F + R + + +E+ + Sbjct: 154 LNAMDFGIPQKRERIFVVSIL-GNNSFDFAKLEKTQTRDISEFIEKDASNLY 204 >gi|257466246|ref|ZP_05630557.1| Type II restriction-modification system methylation subunit [Fusobacterium gonidiaformans ATCC 25563] Length = 327 Score = 50.3 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51 + A DFG+PQ+RER++++ L + F F + R + + +E+ + Sbjct: 161 LNAMDFGIPQKRERIFVVSIL-GNNSFDFAKLEKTQTRDISEFIEKDASNLY 211 >gi|289167633|ref|YP_003445902.1| methyl transferase [Streptococcus mitis B6] gi|288907200|emb|CBJ22035.1| methyl transferase [Streptococcus mitis B6] Length = 452 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + DFGVPQ RER++II FP Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFP 178 >gi|118577457|ref|YP_899696.1| DNA-cytosine methyltransferase [Pelobacter propionicus DSM 2379] gi|118504962|gb|ABL01443.1| DNA-cytosine methyltransferase [Pelobacter propionicus DSM 2379] Length = 313 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 A D+GVPQ RER++I+ +F P P+ K Sbjct: 162 AADYGVPQTRERVFIVGTRPDVQKFIPPKPVCSK 195 >gi|91201234|emb|CAJ74294.1| similar to site-specific DNA-methyltransferase (cytosine-specific) [Candidatus Kuenenia stuttgartiensis] Length = 313 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 A D+GVPQ RER++I+ F P P+ K Sbjct: 162 AEDYGVPQTRERVFIVGTRPDVSRFTPPEPVCDK 195 >gi|326563801|gb|EGE14052.1| type II DNA modification enzyme [Moraxella catarrhalis 46P47B1] gi|326566814|gb|EGE16953.1| type II DNA modification enzyme [Moraxella catarrhalis 103P14B1] gi|326576727|gb|EGE26634.1| type II DNA modification enzyme [Moraxella catarrhalis 101P30B1] Length = 327 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 4/72 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKS-TISNKL 57 + + +GVPQ R+R+Y + FKFP P+ KP + D L + D + + Sbjct: 144 LDSQYYGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTF 202 Query: 58 WEGHQKRKENNK 69 + + N+ Sbjct: 203 QKYLASKYNKNQ 214 >gi|322412375|gb|EFY03283.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae subsp. dysgalactiae ATCC 27957] Length = 401 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + DF VPQ RER++II F FP Sbjct: 98 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 128 >gi|218900599|ref|YP_002449010.1| modification methylase HaeIII [Bacillus cereus G9842] gi|218543463|gb|ACK95857.1| modification methylase HaeIII [Bacillus cereus G9842] Length = 313 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 16/106 (15%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKST-ISNKLWE 59 D+GVPQ+RER+ I N + E++FP P + D+ ++ + IS L Sbjct: 143 NLADYGVPQKRERVIFIGVRNDMNFEYEFPMPTHEENPTFDLFNQNALQRWVSISEVL-A 201 Query: 60 GHQKRKENNK-----------IAGKGF-GYGLFFENSATTNTLSAR 93 G + E++K I K F G+ + + + T+ AR Sbjct: 202 GLPEPSEDSKILNHVCSNYKIIENKNFTGHRMINPDKP-SPTILAR 246 >gi|109946722|ref|YP_663950.1| cytosine specific DNA methyltransferase fragment 2 [Helicobacter acinonychis str. Sheeba] gi|109713943|emb|CAJ98951.1| cytosine specific DNA methyltransferase fragment 2 [Helicobacter acinonychis str. Sheeba] Length = 101 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 19/35 (54%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ RER +I+ + S +F P Sbjct: 45 LNAKDYGVPQSRERAFIVGATHFSFDFNLLEPSQS 79 >gi|332523411|ref|ZP_08399663.1| modification methylase HpaII [Streptococcus porcinus str. Jelinkova 176] gi|332314675|gb|EGJ27660.1| modification methylase HpaII [Streptococcus porcinus str. Jelinkova 176] Length = 451 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + DF VPQ RER++II F FP Sbjct: 148 LNSKDFQVPQNRERIFIIGHSRRFRPRFLFP 178 >gi|86137701|ref|ZP_01056277.1| DNA modification methylase M.NGOI [Roseobacter sp. MED193] gi|85825293|gb|EAQ45492.1| DNA modification methylase M.NGOI [Roseobacter sp. MED193] Length = 319 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDIL 43 + A DFGVPQ R R+ I+ + F +P P P +G+ L Sbjct: 145 LNASDFGVPQLRPRVAIVALRKEYSDQFNWPDPLPHNPPTVGETL 189 >gi|326567346|gb|EGE17461.1| type II DNA modification enzyme [Moraxella catarrhalis BC1] Length = 327 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 4/72 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKS-TISNKL 57 + + +GVPQ R+R+Y + FKFP P+ KP + D L + D + + Sbjct: 144 LDSQYYGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTF 202 Query: 58 WEGHQKRKENNK 69 + + N+ Sbjct: 203 QKYLASKYNKNQ 214 >gi|326560963|gb|EGE11328.1| type II DNA modification enzyme [Moraxella catarrhalis 7169] gi|326575187|gb|EGE25115.1| type II DNA modification enzyme [Moraxella catarrhalis CO72] Length = 322 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 4/72 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKS-TISNKL 57 + + +GVPQ R+R+Y + FKFP P+ KP + D L + D + + Sbjct: 139 LDSQYYGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTF 197 Query: 58 WEGHQKRKENNK 69 + + N+ Sbjct: 198 QKYLASKYNKNQ 209 >gi|306833678|ref|ZP_07466805.1| DNA (cytosine-5-)-methyltransferase [Streptococcus bovis ATCC 700338] gi|304424448|gb|EFM27587.1| DNA (cytosine-5-)-methyltransferase [Streptococcus bovis ATCC 700338] Length = 451 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42 + + DF VPQ RER++II F FP P RLG+I Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRNRSRFLFPLRGEDSPAHLERLGNI 194 >gi|258406639|ref|YP_003199380.1| transcriptional regulator, XRE family [Desulfohalobium retbaense DSM 5692] gi|257798866|gb|ACV69802.1| transcriptional regulator, XRE family [Desulfohalobium retbaense DSM 5692] Length = 468 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A D+GVPQ RER+ + N Sbjct: 268 INAKDYGVPQHRERIIFVAVRND 290 >gi|291320302|ref|YP_003515564.1| cytosine specific methyltransferase [Mycoplasma agalactiae] gi|290752635|emb|CBH40608.1| Cytosine specific methyltransferase [Mycoplasma agalactiae] Length = 339 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A D+ V Q+RERL +I N ++F FPT K L DIL Sbjct: 153 LNALDYNVAQKRERLIVIGIRNDIVNKIKFSFPTKSKNKLVLKDIL 198 >gi|194396841|ref|YP_002037999.1| Tn5253 C-5 cytosine-specific DNA methylase [Streptococcus pneumoniae G54] gi|194356508|gb|ACF54956.1| Tn5253 C-5 cytosine-specific DNA methylase [Streptococcus pneumoniae G54] Length = 452 Score = 50.3 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + DFGVPQ RER++II FP Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFP 178 >gi|127447|sp|P25266|MTE1_HERAU RecName: Full=Modification methylase HgiEI; Short=M.HgiEI; AltName: Full=Cytosine-specific methyltransferase HgiEI gi|43471|emb|CAA38944.1| methyltransferase [Herpetosiphon aurantiacus] Length = 437 Score = 50.3 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE 44 + + DFGV Q R+R++I+ F FP RL IL+ Sbjct: 146 LNSFDFGVAQNRDRVFIVGIQQKLDLNGFSFPEYAESDQRLYHILD 191 >gi|258514794|ref|YP_003191016.1| DNA-cytosine methyltransferase [Desulfotomaculum acetoxidans DSM 771] gi|257778499|gb|ACV62393.1| DNA-cytosine methyltransferase [Desulfotomaculum acetoxidans DSM 771] Length = 402 Score = 50.3 bits (120), Expect = 1e-04, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 13/70 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKST--ISNKL 57 + A D+GVPQ R R+ I+ F N + + FP + L + + IS + Sbjct: 180 VNAADYGVPQSRHRVIIVGFRNDLNANWSFPDATHSQDAL----------RYSKWISGEY 229 Query: 58 WEGHQKRKEN 67 WE H+ K Sbjct: 230 WEEHKIAKAK 239 >gi|309809233|ref|ZP_07703103.1| modification methylase HaeIII [Lactobacillus iners SPIN 2503V10-D] gi|308170467|gb|EFO72490.1| modification methylase HaeIII [Lactobacillus iners SPIN 2503V10-D] Length = 340 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/74 (24%), Positives = 29/74 (39%), Gaps = 13/74 (17%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + A D+GVPQ R+R++ + F ++ F P P K D + + + Sbjct: 142 LNASDYGVPQDRKRVFYVGFRKDLNINFDIPPKPYDYKLTFRDAI-------YDLKDNAI 194 Query: 59 EGHQKRKENNKIAG 72 E NK G Sbjct: 195 PAL----EKNKTNG 204 >gi|294673665|ref|YP_003574281.1| prophage PRU01 DNA methylase, C-5 cytosine-specific family [Prevotella ruminicola 23] gi|294471747|gb|ADE81136.1| prophage PRU01, DNA methylase, C-5 cytosine-specific family [Prevotella ruminicola 23] Length = 330 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDIL 43 + A D+GV Q R+R++ I F N +++FKFP K L DI+ Sbjct: 144 VNAKDYGVAQERKRVFYIGFRNDLNIDFKFPEGSTRDDKKKITLRDII 191 >gi|319757724|gb|ADV69666.1| DNA-cytosine methyltransferase [Streptococcus suis JS14] Length = 451 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42 + + DF VPQ RER++II F FP P RLG+I Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFLFPLKRENSPAHLERLGNI 194 >gi|332361316|gb|EGJ39120.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus sanguinis SK1056] Length = 454 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + DF VPQ RER++II F FP Sbjct: 151 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 181 >gi|168490143|ref|ZP_02714342.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus pneumoniae SP195] gi|183571468|gb|EDT91996.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus pneumoniae SP195] gi|321157174|emb|CBW39159.1| Cytosine-specific DNA methyltransferase [Streptococcus phage 11865] Length = 360 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF 29 + + +FGVPQ RER++II L +F Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRRERTRRF 175 >gi|269214273|ref|ZP_05986228.2| modification methylase NgoPII [Neisseria lactamica ATCC 23970] gi|269210330|gb|EEZ76785.1| modification methylase NgoPII [Neisseria lactamica ATCC 23970] Length = 330 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 A D+GV Q R+R++ I F ++F FP G +E+ DK T+ + +W+ Sbjct: 145 NAKDYGVAQERKRVFYIGFRKDLEIQFSFPK--------GSTVEDK--DKITLRDVIWD 193 >gi|304311589|ref|YP_003811187.1| C-5 cytosine-specific DNA methylase [gamma proteobacterium HdN1] gi|301797322|emb|CBL45542.1| C-5 cytosine-specific DNA methylase [gamma proteobacterium HdN1] Length = 387 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 9/68 (13%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ RER+ II + ++ + FP P + RL + + H+ + WE Sbjct: 170 INAADYGVPQVRERVIIIGLRSDLNLNWSFPEPTHSQDRL--LWDIHVSGEY------WE 221 Query: 60 GHQKRKEN 67 H+ + Sbjct: 222 QHRVSAKE 229 >gi|240143270|ref|ZP_04741871.1| modification methylase BspRI [Roseburia intestinalis L1-82] gi|257204748|gb|EEV03033.1| modification methylase BspRI [Roseburia intestinalis L1-82] Length = 432 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 16/80 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF--PTPLG------------IKPRLGDILEEH 46 + + ++GVPQ RER+ ++ N ++F++ P P ++ +GD LE++ Sbjct: 226 LNSAEYGVPQIRERVILVGVRND-IDFEYVHPEPTHGYGVEGLKEVVTLRDAIGD-LEDN 283 Query: 47 IDDKSTISNKLWEGHQKRKE 66 D T S + RK+ Sbjct: 284 PGDYFTGSYSTIFMSRNRKK 303 >gi|219724141|ref|YP_002477179.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Borrelia burgdorferi 156a] gi|225575842|ref|YP_002724642.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 118a] gi|219693145|gb|ACL34349.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Borrelia burgdorferi 156a] gi|225546742|gb|ACN92742.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 118a] Length = 311 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 5/58 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-----EFKFPTPLGIKPRLGDILEEHIDDKSTI 53 + A +FGVPQ RER+Y + ++ P K L DILE+ + I Sbjct: 142 LNASNFGVPQARERVYFACLRKDTGTSEKLKYSKPKETFKKIYLEDILEKDVPKSMYI 199 >gi|224796590|ref|YP_002641667.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 64b] gi|223929176|gb|ACN23896.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 64b] gi|312149869|gb|ADQ29935.1| DNA-cytosine methyltransferase [Borrelia burgdorferi N40] Length = 324 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 5/58 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-----EFKFPTPLGIKPRLGDILEEHIDDKSTI 53 + A +FGVPQ RER+Y + ++ P K L DILE+ + I Sbjct: 155 LNASNFGVPQARERVYFACLRKDTGTSEKLKYSKPKETFKKIYLEDILEKDVPKSMYI 212 >gi|319778406|ref|YP_004129319.1| DNA (cytosine-5-)-methyltransferase [Taylorella equigenitalis MCE9] gi|317108430|gb|ADU91176.1| DNA (cytosine-5-)-methyltransferase [Taylorella equigenitalis MCE9] Length = 160 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 10/20 (50%), Positives = 16/20 (80%) Query: 1 MKACDFGVPQRRERLYIIDF 20 + + +FGVPQ R+R+YI+ F Sbjct: 141 LNSKNFGVPQNRKRIYIVAF 160 >gi|146318633|ref|YP_001198345.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 05ZYH33] gi|146320840|ref|YP_001200551.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 98HAH33] gi|253751755|ref|YP_003024896.1| C-5 cytosine-specific DNA methylase [Streptococcus suis SC84] gi|253755540|ref|YP_003028680.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407] gi|145689439|gb|ABP89945.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 05ZYH33] gi|145691646|gb|ABP92151.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 98HAH33] gi|251816044|emb|CAZ51664.1| C-5 cytosine-specific DNA methylase [Streptococcus suis SC84] gi|251818004|emb|CAZ55786.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407] Length = 451 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42 + + DF VPQ RER++II F FP P RLG+I Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRPRFLFPLRRENSPAHLERLGNI 194 >gi|319744417|gb|EFV96775.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus agalactiae ATCC 13813] Length = 450 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + DF VPQ RER++II F FP Sbjct: 151 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 181 >gi|288906872|emb|CBJ21706.1| type II DNA modification methyltransferase [Streptococcus mitis B6] Length = 380 Score = 49.9 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + + +FGVPQ RER++II L + K FP Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRGTSGRKVFP 177 >gi|225869346|ref|YP_002745294.1| C-5 cytosine-specific DNA methylase [Streptococcus equi subsp. zooepidemicus] gi|225702622|emb|CAX00673.1| C-5 cytosine-specific DNA methylase [Streptococcus equi subsp. zooepidemicus] Length = 451 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + DF VPQ RER++II F FP Sbjct: 148 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 178 >gi|294651999|ref|ZP_06729281.1| DNA (cytosine-5-)-methyltransferase [Acinetobacter haemolyticus ATCC 19194] gi|292822115|gb|EFF81036.1| DNA (cytosine-5-)-methyltransferase [Acinetobacter haemolyticus ATCC 19194] Length = 336 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDK 50 + A D+G+ Q R+R+ + F +V + FP P+ K L DI+ + ++DK Sbjct: 145 LNATDYGIAQDRKRVIFLGFRKDLNVHYTFPEPIVKKLVLKDII-KDLEDK 194 >gi|168494837|ref|ZP_02718980.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus pneumoniae CDC3059-06] gi|168494899|ref|ZP_02719042.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus pneumoniae CDC3059-06] gi|168494952|ref|ZP_02719095.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus pneumoniae CDC3059-06] gi|168494999|ref|ZP_02719142.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus pneumoniae CDC3059-06] gi|183575153|gb|EDT95681.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus pneumoniae CDC3059-06] gi|183575203|gb|EDT95731.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus pneumoniae CDC3059-06] gi|183575231|gb|EDT95759.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus pneumoniae CDC3059-06] gi|183575300|gb|EDT95828.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus pneumoniae CDC3059-06] Length = 360 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFP 30 + + +FGVPQ RER++II FP Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRRERTRRIFP 177 >gi|229187780|ref|ZP_04314910.1| Cytosine-specific methyltransferase [Bacillus cereus BGSC 6E1] gi|228595683|gb|EEK53373.1| Cytosine-specific methyltransferase [Bacillus cereus BGSC 6E1] Length = 365 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + DFGVPQ RER++II Sbjct: 150 LNSKDFGVPQNRERVFIIG 168 >gi|227874220|ref|ZP_03992420.1| DNA (cytosine-5-)-methyltransferase [Oribacterium sinus F0268] gi|227839928|gb|EEJ50358.1| DNA (cytosine-5-)-methyltransferase [Oribacterium sinus F0268] Length = 336 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDIL 43 + A D+GV Q+RERL I ++++FP KP L DIL Sbjct: 152 LNAWDYGVAQKRERLITIGIRKDLEDKIKYEFPKVYEYKPLLKDIL 197 >gi|225858823|ref|YP_002740333.1| methyl transferase [Streptococcus pneumoniae 70585] gi|225720620|gb|ACO16474.1| methyl transferase [Streptococcus pneumoniae 70585] Length = 451 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42 + + DF VPQ RER++II F FP P RLG+I Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFLFPLRRENSPAHLERLGNI 194 >gi|186683211|ref|YP_001866407.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102] gi|14594714|gb|AAK68647.1| cytosine-specific DNA methyltransferase [Nostoc punctiforme PCC 73102] gi|186465663|gb|ACC81464.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102] Length = 421 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A ++GVPQ RERL++I K+P P+ KP L + L +S +W+ Sbjct: 161 LNAANYGVPQSRERLFLIGAREDVELPKYPQPI-TKPALPNNLTSKKISNIPLSPTVWD 218 >gi|223933016|ref|ZP_03625010.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591] gi|223898333|gb|EEF64700.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591] Length = 451 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42 + + DF VPQ RER++II F FP P RLG+I Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRPRFLFPLRGENSPAHLERLGNI 194 >gi|322411604|gb|EFY02512.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae subsp. dysgalactiae ATCC 27957] Length = 451 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + DF VPQ RER++II F FP Sbjct: 148 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 178 >gi|226223282|ref|YP_002757389.1| type II DNA modification enzyme (methyltransferase) [Listeria monocytogenes Clip81459] gi|225875744|emb|CAS04447.1| Putative type II DNA modification enzyme (methyltransferase) [Listeria monocytogenes serotype 4b str. CLIP 80459] Length = 389 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPL 33 + A FGVPQ RER++++ ++FP L Sbjct: 169 LNAKHFGVPQNRERVFLLGIRKDLEIKQNWEFPERL 204 >gi|1709163|sp|P50188|MTN1_NOCAE RecName: Full=Modification methylase NaeI; Short=M.NaeI; AltName: Full=Cytosine-specific methyltransferase NaeI gi|775103|gb|AAC43325.1| NaeI modification methyltransferase [Lechevalieria aerocolonigenes] Length = 413 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEE 45 + A DFGVPQ R R ++ N F +P P G P +G+ L++ Sbjct: 148 LHASDFGVPQLRPRFVLVALQNKFAPYFTWPEPTGAAPTVGETLKD 193 >gi|268610192|ref|ZP_06143919.1| cytosine-specific DNA methylase [Ruminococcus flavefaciens FD-1] Length = 475 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 22/95 (23%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-------------SVEFKFPTPLGIKPRLGD---ILE 44 + DFG+PQ RER+YI+ + + K ++GD ILE Sbjct: 204 LSPSDFGIPQIRERVYILGIRRDIRNQQILTNGFIHIEDLQLDKHFK-KCKMGDAWSILE 262 Query: 45 EHIDDKSTISNK----LWEGHQKRKENNKIAGKGF 75 + +DD IS + + + RK N I GF Sbjct: 263 DEVDDSYIISEEKEQMILAWEEFRKATN-IKVIGF 296 >gi|223932228|ref|ZP_03624232.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591] gi|223899209|gb|EEF65566.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591] Length = 451 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42 + + DF VPQ RER++II F FP P RLG+I Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRRENSPAHLERLGNI 194 >gi|319744643|gb|EFV96990.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus agalactiae ATCC 13813] Length = 451 Score = 49.5 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42 + + DF VPQ RER++II F FP P RLG+I Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRRENSPAHLERLGNI 194 >gi|157419765|gb|ABV55454.1| DNA methylase [Streptococcus dysgalactiae subsp. equisimilis] Length = 451 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42 + + DF VPQ RER++II F FP P RLG+I Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRREDSPAHLERLGNI 194 >gi|22537444|ref|NP_688295.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae 2603V/R] gi|76797962|ref|ZP_00780222.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae 18RS21] gi|77406085|ref|ZP_00783160.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae H36B] gi|313890485|ref|ZP_07824113.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus SPIN 20026] gi|22534321|gb|AAN00168.1|AE014251_12 C-5 cytosine-specific DNA methylase [Streptococcus agalactiae 2603V/R] gi|76586686|gb|EAO63184.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae 18RS21] gi|77175318|gb|EAO78112.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae H36B] gi|313121002|gb|EFR44113.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus SPIN 20026] gi|323127117|gb|ADX24414.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae subsp. equisimilis ATCC 12394] Length = 451 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42 + + DF VPQ RER++II F FP P RLG+I Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRREDSPAHLERLGNI 194 >gi|332673536|gb|AEE70353.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 83] Length = 434 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + A DFGV Q RERLYI+ L+ +++ FP Sbjct: 175 LNAKDFGVAQNRERLYIVGNLSCTIDLDHFP 205 >gi|308235652|ref|ZP_07666389.1| DcmB [Gardnerella vaginalis ATCC 14018] gi|311115197|ref|YP_003986418.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis ATCC 14019] gi|310946691|gb|ADP39395.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis ATCC 14019] Length = 333 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 11/60 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R+R++ I F +++F FP E + K T+ + +W+ Sbjct: 148 VNAKDYGVAQDRKRVFYIGFRKDLNIKFSFPKGST----------EDDEKKLTLKDVIWD 197 >gi|67924690|ref|ZP_00518097.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] gi|67853467|gb|EAM48819.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] Length = 420 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 16/91 (17%), Positives = 32/91 (35%), Gaps = 25/91 (27%) Query: 1 MKACDFGVPQRRERLYIID---------------------FLNPSVEFKFPTPLGIKPR- 38 + + +F VPQ R R+YI+ F ++ P+ + Sbjct: 146 LNSSNFNVPQNRVRIYIVGKKGSQPNLTIKSDKGAIDSHSFKKNIIQGDLFAPINYPTKP 205 Query: 39 --LGDILEEHIDDKSTISNKLWEGHQKRKEN 67 + DIL++ +++K S + R Sbjct: 206 LTVKDILKDIVEEKYFCSQEF-TNLLNRAVR 235 >gi|153940750|ref|YP_001392502.1| hypothetical protein CLI_3290 [Clostridium botulinum F str. Langeland] gi|152936646|gb|ABS42144.1| conserved domain protein [Clostridium botulinum F str. Langeland] Length = 338 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFP 30 + + DFGVPQ RER++II S FP Sbjct: 151 INSRDFGVPQNRERVFIIGHLRERSTRKIFP 181 >gi|309808410|ref|ZP_07702309.1| putative modification methylase HhaI [Lactobacillus iners LactinV 01V1-a] gi|308168238|gb|EFO70357.1| putative modification methylase HhaI [Lactobacillus iners LactinV 01V1-a] Length = 198 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGI 35 + ++G+PQ+RER+Y++ F N F FP P + Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKL 188 >gi|253755079|ref|YP_003028219.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407] gi|251817543|emb|CAZ55290.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407] Length = 451 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42 + + DF VPQ RER++II F FP P RLG+I Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRGENSPAHLERLGNI 194 >gi|254467362|ref|ZP_05080773.1| DNA-cytosine methyltransferase [Rhodobacterales bacterium Y4I] gi|206688270|gb|EDZ48752.1| DNA-cytosine methyltransferase [Rhodobacterales bacterium Y4I] Length = 319 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR 38 + A DFGVPQ R R+ I+ S +F +P PL P Sbjct: 145 LNASDFGVPQLRPRVAIVALRKEFSGQFNWPEPLPHNPP 183 >gi|302387870|ref|YP_003823692.1| DNA-cytosine methyltransferase [Clostridium saccharolyticum WM1] gi|302198498|gb|ADL06069.1| DNA-cytosine methyltransferase [Clostridium saccharolyticum WM1] Length = 569 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDIL 43 + + FGVPQ RER+Y++ F FP + ++ Sbjct: 178 VNSKHFGVPQHRERVYLVGHFGGIRGRKVFPIGGANTAPVKQLI 221 >gi|194337838|ref|YP_002019632.1| DNA-cytosine methyltransferase [Pelodictyon phaeoclathratiforme BU-1] gi|194310315|gb|ACF45015.1| DNA-cytosine methyltransferase [Pelodictyon phaeoclathratiforme BU-1] Length = 409 Score = 49.5 bits (118), Expect = 2e-04, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 28/65 (43%), Gaps = 7/65 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A D+GVPQ RER+ I+ + + P+ + + ++ + WE Sbjct: 170 INAADYGVPQTRERVVIVG-TRADISLPWSFPIETHSEDRLLWDMYVTGEY------WER 222 Query: 61 HQKRK 65 H+ K Sbjct: 223 HKVHK 227 >gi|148252729|ref|YP_001237314.1| putative 5-methylcytosine methyltransferase [Bradyrhizobium sp. BTAi1] gi|146404902|gb|ABQ33408.1| putative 5-methylcytosine methyltransferase [Bradyrhizobium sp. BTAi1] Length = 381 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 17/26 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A DFGVPQ R R++I+ F V+ Sbjct: 179 INARDFGVPQNRRRVFILGFDRRRVD 204 >gi|227874774|ref|ZP_03992927.1| DNA methyltransferase Cfr42I [Mobiluncus mulieris ATCC 35243] gi|227844549|gb|EEJ54705.1| DNA methyltransferase Cfr42I [Mobiluncus mulieris ATCC 35243] Length = 420 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 17/75 (22%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQRR R++++ F + + FP P L E S + W Sbjct: 198 VDAADYGVPQRRHRVFMVGFRSDVDAGWNFPAPTHSASALRAAQE---------SGEYW- 247 Query: 60 GHQKRKENNKIAGKG 74 E ++IA KG Sbjct: 248 ------ERHRIAIKG 256 >gi|305666023|ref|YP_003862310.1| putative DNA modification methylase [Maribacter sp. HTCC2170] gi|88710798|gb|EAR03030.1| putative DNA modification methylase (N.MgoV) [Maribacter sp. HTCC2170] Length = 493 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKS 51 + + D+G+PQ R R+YII F + FK P +L LE+ + Sbjct: 145 INSHDYGLPQNRIRVYIIGFKDKRYLDSFKLPDKPLNGHKLFQHLEDLPKPQF 197 >gi|313683546|ref|YP_004061284.1| DNA-cytosine methyltransferase [Sulfuricurvum kujiense DSM 16994] gi|313156406|gb|ADR35084.1| DNA-cytosine methyltransferase [Sulfuricurvum kujiense DSM 16994] Length = 332 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDIL 43 + A DFGVPQ R R+ ++ F +P P +G+ L Sbjct: 154 INAKDFGVPQLRPRVILVGLRKNIFPYFSWPDSYLEAPTVGEAL 197 >gi|317012300|gb|ADU82908.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori Lithuania75] Length = 348 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F P P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGTLKSFKQKFHSPKPIKTHFSLKDAL 188 >gi|238801891|ref|YP_002925094.1| putative DNA methylase [Streptococcus phage 5093] gi|238558577|gb|ACR45907.1| putative DNA methylase [Streptococcus phage 5093] Length = 319 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 12/19 (63%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + DFGVPQ RERL+II Sbjct: 147 LNSKDFGVPQNRERLFIIG 165 >gi|265751236|ref|ZP_06087299.1| DcmB protein [Bacteroides sp. 3_1_33FAA] gi|270294601|ref|ZP_06200803.1| DNA-cytosine methyltransferase [Bacteroides sp. D20] gi|263238132|gb|EEZ23582.1| DcmB protein [Bacteroides sp. 3_1_33FAA] gi|270276068|gb|EFA21928.1| DNA-cytosine methyltransferase [Bacteroides sp. D20] Length = 466 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG-----IKPRLGDILE 44 + A D+ +PQ R R++++ FL + F FP P G ++ +GDI+E Sbjct: 143 LNAADYYIPQDRYRVFVVGFLKELNCTFNFPKPFGKPYVTLRKAIGDIME 192 >gi|269976808|ref|ZP_06183783.1| DNA methyltransferase Cfr42I [Mobiluncus mulieris 28-1] gi|269935005|gb|EEZ91564.1| DNA methyltransferase Cfr42I [Mobiluncus mulieris 28-1] Length = 404 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLG 40 + A D+GVPQRR R++++ F + + FP P L Sbjct: 182 VDAADYGVPQRRHRVFMVGFRSDVDAGWSFPAPTHSASALR 222 >gi|220903553|ref|YP_002478865.1| DNA-cytosine methyltransferase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] gi|219867852|gb|ACL48187.1| DNA-cytosine methyltransferase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] Length = 308 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGI 35 + A D+GVPQ R+R++I V F +P Sbjct: 142 LNAADYGVPQTRQRVFIAGVRKDLDVIFTYPDATHS 177 >gi|260642764|ref|ZP_05417219.2| modification methylase NgoMIV [Bacteroides finegoldii DSM 17565] gi|260620609|gb|EEX43480.1| modification methylase NgoMIV [Bacteroides finegoldii DSM 17565] Length = 327 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKP 37 + A D+GVPQ R R+ II + F FP + K Sbjct: 144 LNASDYGVPQLRPRVIIIGIRRDLADVFMFPEKIPEKT 181 >gi|296393765|ref|YP_003658649.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985] gi|296180912|gb|ADG97818.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985] Length = 393 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLG 40 + A D+GVPQRR R++I+ F + + FP+P L Sbjct: 181 VDAADYGVPQRRHRVFIVGFRSDVRAGWAFPSPTHSGEALR 221 >gi|167759130|ref|ZP_02431257.1| hypothetical protein CLOSCI_01477 [Clostridium scindens ATCC 35704] gi|167663248|gb|EDS07378.1| hypothetical protein CLOSCI_01477 [Clostridium scindens ATCC 35704] Length = 324 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51 + A +FG+PQ RER++ I LN +F+F + R L + LE+ + D Sbjct: 164 LDAREFGLPQARERVFTISVLNGE-KFEFDDLIRTPMRNLQEFLEDDVPDIY 214 >gi|302873674|ref|YP_003842307.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] gi|307686602|ref|ZP_07629048.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] gi|302576531|gb|ADL50543.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] Length = 448 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDIL 43 + + DFGVPQ RER++II L + P + L I+ Sbjct: 151 LNSKDFGVPQNRERVFIIASLRSRGRREILPIGGENRATLKQII 194 >gi|332162719|ref|YP_004299296.1| Cytosine-specific methyltransferase [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|325666949|gb|ADZ43593.1| Cytosine-specific methyltransferase [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|330859459|emb|CBX69803.1| hypothetical protein YEW_FM23370 [Yersinia enterocolitica W22703] Length = 365 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 9/45 (20%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH 46 + +FGVPQ RER++I+ L+ + FK P DIL ++ Sbjct: 213 NSANFGVPQTRERVFIVGTLHGNPLFKEPV---------DILHKN 248 >gi|206975132|ref|ZP_03236046.1| modification methylase HaeIII [Bacillus cereus H3081.97] gi|206746553|gb|EDZ57946.1| modification methylase HaeIII [Bacillus cereus H3081.97] Length = 352 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + A DFGVPQ R+R II +FP P K + D + + Sbjct: 150 LNAADFGVPQNRKRAVIIG-KRGLAPAEFPKPKNEKNTIWDAISD 193 >gi|221232312|ref|YP_002511465.1| DNA methylase [Streptococcus pneumoniae ATCC 700669] gi|220674773|emb|CAR69346.1| putative DNA methylase [Streptococcus pneumoniae ATCC 700669] Length = 369 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + + +FGVPQ RER++II L K FP Sbjct: 131 LNSKNFGVPQNRERVFIIGHLRGGSGRKVFP 161 >gi|126740127|ref|ZP_01755817.1| DNA modification methylase M.NGOI [Roseobacter sp. SK209-2-6] gi|126718946|gb|EBA15658.1| DNA modification methylase M.NGOI [Roseobacter sp. SK209-2-6] Length = 319 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR 38 + A D+GVPQ R R+ I+ S +F +P PL PR Sbjct: 145 LNASDYGVPQLRPRVAIVALRKEFSGQFNWPEPLPHNPR 183 >gi|326779115|ref|ZP_08238380.1| DNA-cytosine methyltransferase [Streptomyces cf. griseus XylebKG-1] gi|326659448|gb|EGE44294.1| DNA-cytosine methyltransferase [Streptomyces cf. griseus XylebKG-1] Length = 433 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKS 51 ++A DFGVPQ R R ++ ++F +PTP+G + D LE+ ++ + Sbjct: 197 LEASDFGVPQLRPRAVLVAIRADVLGDIKFVWPTPVGGVYSVFDALEKSMEARY 250 >gi|42560766|ref|NP_975217.1| cytosine-specific DNA-methyltransferase Sau96I [Mycoplasma mycoides subsp. mycoides SC str. PG1] gi|42492262|emb|CAE76859.1| Cytosine-specific DNA-methyltransferase Sau96I [Mycoplasma mycoides subsp. mycoides SC str. PG1] gi|301320716|gb|ADK69359.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale] Length = 341 Score = 49.1 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A D+ V Q+RERL +I N ++F+FP K L DIL Sbjct: 155 LNALDYMVAQKRERLIVIGIRNDLTNLIKFEFPKKHQKKLVLKDIL 200 >gi|322411818|gb|EFY02726.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae subsp. dysgalactiae ATCC 27957] Length = 451 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + +F VPQ RER++II F FP Sbjct: 148 LNSKNFQVPQNRERIFIIGHSRRYRPRFLFP 178 >gi|300124212|gb|ADJ68008.1| M.BanII [Aneurinibacillus aneurinilyticus] Length = 385 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 19/26 (73%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + + +GVPQ+RER++ + FLN ++ Sbjct: 149 LNSSHYGVPQKRERVFFVGFLNKVLD 174 >gi|209809294|ref|YP_002264832.1| putative C-5 cytosine-specific DNA methylase [Aliivibrio salmonicida LFI1238] gi|208010856|emb|CAQ81257.1| putative C-5 cytosine-specific DNA methylase [Aliivibrio salmonicida LFI1238] Length = 387 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 23/62 (37%), Gaps = 12/62 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKF-PTPLGIKPRLG---------DILEEHIDD 49 + A DFGVPQ R+R++I F P P G + E + + Sbjct: 160 LNAKDFGVPQNRKRVFIHGVRKDIKSTVSFPPEATHFSPTSGLAPCWKTASTVFEP-VPE 218 Query: 50 KS 51 K Sbjct: 219 KY 220 >gi|322385307|ref|ZP_08058952.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus cristatus ATCC 51100] gi|321270566|gb|EFX53481.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus cristatus ATCC 51100] Length = 480 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + +FGVPQ RER++II FP Sbjct: 176 LNSKNFGVPQNRERVFIIGHSRKRGTRLLFP 206 >gi|238793797|ref|ZP_04637418.1| Cytosine-specific methyltransferase [Yersinia intermedia ATCC 29909] gi|238726861|gb|EEQ18394.1| Cytosine-specific methyltransferase [Yersinia intermedia ATCC 29909] Length = 365 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 9/45 (20%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH 46 + +FGVPQ RER++I+ L+ + FK P DIL ++ Sbjct: 213 NSANFGVPQTRERVFIVGTLHGNPLFKEPV---------DILHKN 248 >gi|169834211|ref|YP_001693507.1| hypothetical protein SPH_0083 [Streptococcus pneumoniae Hungary19A-6] gi|168996713|gb|ACA37325.1| hypothetical protein SPH_0083 [Streptococcus pneumoniae Hungary19A-6] Length = 255 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + DFGVPQ RER++II Sbjct: 147 LNSKDFGVPQNRERVFIIG 165 >gi|15088756|ref|NP_150145.1| putative DNA methylase [Streptococcus phage MM1] gi|15074902|emb|CAC48079.1| putative DNA methylase [Streptococcus phage MM1] gi|73747029|gb|AAZ82425.1| C5 methyltransferase alpha subunit [Streptococcus phage MM1 1998] Length = 385 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + + +FGVPQ RER++II L K FP Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRGGSGRKVFP 177 >gi|212710423|ref|ZP_03318551.1| hypothetical protein PROVALCAL_01485 [Providencia alcalifaciens DSM 30120] gi|212686843|gb|EEB46371.1| hypothetical protein PROVALCAL_01485 [Providencia alcalifaciens DSM 30120] Length = 330 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPR--LGDILEE 45 + A D+GV Q R+R+ + F + ++ + FP P+ R L DI+++ Sbjct: 145 LNAVDYGVAQDRKRVIFVGFRSDLNIPYTFPEPIEKDKRKVLKDIIKD 192 >gi|319745928|gb|EFV98213.1| type II DNA modification methyltransferase [Streptococcus agalactiae ATCC 13813] Length = 454 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30 + + +F VPQ RER++II F FP Sbjct: 151 LNSKNFQVPQNRERIFIIGHSRRYRPRFLFP 181 >gi|296491874|ref|YP_003662339.1| putative DNA (cytosine-5-)-methyltransferase [Xenorhabdus nematophila ATCC 19061] gi|289176759|emb|CBJ92924.1| putative DNA (cytosine-5-)-methyltransferase [Xenorhabdus nematophila ATCC 19061] Length = 575 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 25/102 (24%), Positives = 44/102 (43%), Gaps = 11/102 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP---RLGDILEEHIDDKSTISNKL 57 + +FGV +RR+RL ++ + F+ ++ R+ +ILE D S + Sbjct: 315 LDGNEFGVIERRKRLCVVALSHGIDGFELEKVQPVRTKESRIHEILEPVPLD----SER- 369 Query: 58 WE---GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 W+ ++ +K AGKGF L + T+ Y K Sbjct: 370 WKSFDYLADKELRDKAAGKGFSRQLLTGDDEYCGTIGKDYAK 411 >gi|12229868|sp|Q9RLM4|MTD1_NEIMC RecName: Full=Probable modification methylase NmeDIP; Short=M.NmeDIP; AltName: Full=Cytosine-specific methyltransferase NmeDIP gi|6179652|emb|CAB59897.1| putative m5C methylase [Neisseria meningitidis] Length = 420 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 8/50 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEH 46 + A ++GVPQ RER+ ++ FL+ V+ F + + D LE+ Sbjct: 220 INAIEYGVPQDRERIILVGFLSQHVDALQKFDWDAHI----SFPDALEKD 265 >gi|225075681|ref|ZP_03718880.1| hypothetical protein NEIFLAOT_00697 [Neisseria flavescens NRL30031/H210] gi|224952952|gb|EEG34161.1| hypothetical protein NEIFLAOT_00697 [Neisseria flavescens NRL30031/H210] Length = 389 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 13/78 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP------LGIKPRLGDILEEHIDDKSTIS 54 + A D+GVPQ RER+ I+ L E + + + +GD++++ D+ I+ Sbjct: 239 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDE---IA 295 Query: 55 NKLWEGHQKRKENNKIAG 72 N +W R E + G Sbjct: 296 NHIWS----RAEKSPDQG 309 >gi|331703222|ref|YP_004399909.1| cytosine specific DNA methyltransferase Sau96I [Mycoplasma mycoides subsp. capri LC str. 95010] gi|328801777|emb|CBW53930.1| Cytosine specific DNA methyltransferase Sau96I [Mycoplasma mycoides subsp. capri LC str. 95010] Length = 342 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A D+ V Q+RERL +I N ++F+FP K L DIL Sbjct: 155 LNALDYMVAQKRERLIVIGIRNDLTNLIKFEFPKKHQKKLVLKDIL 200 >gi|313665138|ref|YP_004047009.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma leachii PG50] gi|312949950|gb|ADR24546.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma leachii PG50] Length = 342 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 + A D+ V Q+RERL +I N ++F+FP K L DIL Sbjct: 155 LNALDYMVAQKRERLIVIGIRNDLTNLIKFEFPKKHQKKLVLKDIL 200 >gi|261392162|emb|CAX49670.1| putative modification methylase (cytosine-specific methyltransferase) [Neisseria meningitidis 8013] gi|309378365|emb|CBX23011.1| putative DNA cytosine methyltransferase [Neisseria lactamica Y92-1009] Length = 389 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 13/78 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP------LGIKPRLGDILEEHIDDKSTIS 54 + A D+GVPQ RER+ I+ L E + + + +GD++++ D+ I+ Sbjct: 239 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDE---IA 295 Query: 55 NKLWEGHQKRKENNKIAG 72 N +W R E + G Sbjct: 296 NHIWS----RAEKSPDQG 309 >gi|317506927|ref|ZP_07964699.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC BAA-974] gi|316254855|gb|EFV14153.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC BAA-974] Length = 399 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLG 40 + A D+GVPQRR R++I+ F + + FP P L Sbjct: 181 VDAADYGVPQRRHRVFIVGFRSDVRAGWAFPAPTHSGEALR 221 >gi|158335733|ref|YP_001516905.1| DNA-cytosine methyltransferase [Acaryochloris marina MBIC11017] gi|158305974|gb|ABW27591.1| DNA-cytosine methyltransferase [Acaryochloris marina MBIC11017] Length = 397 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGI 35 + A ++GVPQRRER++I+ ++E+ FP Sbjct: 174 VDAANYGVPQRRERVFIVGIREDLNIEWSFPEESHS 209 >gi|94968156|ref|YP_590204.1| DNA-cytosine methyltransferase [Candidatus Koribacter versatilis Ellin345] gi|94550206|gb|ABF40130.1| DNA-cytosine methyltransferase [Candidatus Koribacter versatilis Ellin345] Length = 359 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 M AC+FGVPQ R R+ + S F +P +GD+L + +S + W+ Sbjct: 184 MNACEFGVPQLRPRVVFVAMRKEYSEHFAWPRATNEPQTVGDVLFD------LMSARGWK 237 Query: 60 GHQKRKEN 67 G + + Sbjct: 238 GVKAWRAK 245 >gi|312874669|ref|ZP_07734692.1| modification methylase HaeIII [Lactobacillus iners LEAF 2053A-b] gi|311089796|gb|EFQ48217.1| modification methylase HaeIII [Lactobacillus iners LEAF 2053A-b] Length = 331 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 18/73 (24%), Positives = 30/73 (41%), Gaps = 11/73 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ R+R++ + F ++ F P KP ++ D + + Sbjct: 142 LNASDYGVPQDRKRVFYVGFRKDLNINFDIP----PKPYDYKLIFR--DAIYDLKDNAIP 195 Query: 60 GHQKRKENNKIAG 72 E NK G Sbjct: 196 AL----EKNKTNG 204 >gi|308182632|ref|YP_003926759.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori PeCan4] gi|308064817|gb|ADO06709.1| type II DNA modification enzyme (methyltransferase) [Helicobacter pylori PeCan4] Length = 351 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ RER+ ++ L +F F P+ L D L Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFHKPIKTHFSLKDAL 188 >gi|325294602|ref|YP_004281116.1| DNA-cytosine methyltransferase [Desulfurobacterium thermolithotrophum DSM 11699] gi|325065050|gb|ADY73057.1| DNA-cytosine methyltransferase [Desulfurobacterium thermolithotrophum DSM 11699] Length = 342 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGD 41 + D+ VPQ R+R++II F + + FP P K L D Sbjct: 143 IDTYDYLVPQNRKRVFIIGFRKDLQISYSFPKPFDRKKTLRD 184 >gi|294673126|ref|YP_003573742.1| C-5 cytosine-specific family DNA methylase [Prevotella ruminicola 23] gi|294473536|gb|ADE82925.1| DNA methylase, C-5 cytosine-specific family [Prevotella ruminicola 23] Length = 342 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH 46 + A ++GVPQ R+R + +F FP + LGD + Sbjct: 155 VNAANYGVPQIRQRFICVGVRKDMPDFIFPEETHSE--LGDETHKK 198 >gi|227431785|ref|ZP_03913812.1| possible DNA (cytosine-5-)-methyltransferase [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] gi|227352468|gb|EEJ42667.1| possible DNA (cytosine-5-)-methyltransferase [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] Length = 448 Score = 48.8 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + DFGVPQ RER+YII L E + FP Sbjct: 150 NSKDFGVPQNRERVYIIGHLRGDSEREVFP 179 >gi|331090242|ref|ZP_08339130.1| hypothetical protein HMPREF1025_02713 [Lachnospiraceae bacterium 3_1_46FAA] gi|330402188|gb|EGG81760.1| hypothetical protein HMPREF1025_02713 [Lachnospiraceae bacterium 3_1_46FAA] Length = 464 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + DFGVPQ RER++II Sbjct: 151 LNSKDFGVPQNRERVFIIA 169 >gi|254805366|ref|YP_003083587.1| putative type II DNA modification methylase [Neisseria meningitidis alpha14] gi|254668908|emb|CBA07091.1| putative type II DNA modification methylase [Neisseria meningitidis alpha14] gi|308389730|gb|ADO32050.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha710] Length = 389 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 13/78 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP------LGIKPRLGDILEEHIDDKSTIS 54 + A D+GVPQ RER+ I+ L E + + + +GD++++ D+ I+ Sbjct: 239 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDE---IA 295 Query: 55 NKLWEGHQKRKENNKIAG 72 N +W R E + G Sbjct: 296 NHIWS----RAEKSPDQG 309 >gi|254456253|ref|ZP_05069682.1| Cytosine-specific methyltransferase HphIA [Candidatus Pelagibacter sp. HTCC7211] gi|207083255|gb|EDZ60681.1| Cytosine-specific methyltransferase HphIA [Candidatus Pelagibacter sp. HTCC7211] Length = 342 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32 + + D+GVPQ R R++I+ + +F+FP P Sbjct: 144 LNSADYGVPQIRHRVFIVGIKKELNKKFEFPKP 176 >gi|121635255|ref|YP_975500.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis FAM18] gi|313668027|ref|YP_004048311.1| C-5 cytosine-specific DNA methylase [Neisseria lactamica ST-640] gi|120866961|emb|CAM10721.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis FAM18] gi|313005489|emb|CBN86924.1| C-5 cytosine-specific DNA methylase [Neisseria lactamica 020-06] Length = 383 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 13/78 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP------LGIKPRLGDILEEHIDDKSTIS 54 + A D+GVPQ RER+ I+ L E + + + +GD++++ D+ I+ Sbjct: 233 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDE---IA 289 Query: 55 NKLWEGHQKRKENNKIAG 72 N +W R E + G Sbjct: 290 NHIWS----RAEKSPDQG 303 >gi|312863775|ref|ZP_07724013.1| DNA (cytosine-5-)-methyltransferase [Streptococcus vestibularis F0396] gi|311101311|gb|EFQ59516.1| DNA (cytosine-5-)-methyltransferase [Streptococcus vestibularis F0396] Length = 454 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL 43 + + DF VPQ RER++II F FP P + L Sbjct: 151 LNSKDFQVPQNRERVFIIGHSRRYRPRFLFPIRGENSPVNLERL 194 >gi|121634523|ref|YP_974768.1| putative modification methylase NmeDI [Neisseria meningitidis FAM18] gi|120866229|emb|CAM09969.1| putative modification methylase NmeDI [Neisseria meningitidis FAM18] Length = 383 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 8/50 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEH 46 + A ++GVPQ RER+ ++ FL+ V+ F + + D LE+ Sbjct: 183 INAIEYGVPQDRERIILVGFLSQHVDALQKFDWDAHI----SFPDALEKD 228 >gi|319939117|ref|ZP_08013481.1| modification methylase BsuRI [Streptococcus anginosus 1_2_62CV] gi|319812167|gb|EFW08433.1| modification methylase BsuRI [Streptococcus anginosus 1_2_62CV] Length = 434 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 11/29 (37%), Positives = 19/29 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF 29 + A D+GVPQ RER++++ +E K+ Sbjct: 231 VNARDYGVPQSRERVFLVGVHKEKIEKKY 259 >gi|300791025|ref|YP_003771316.1| DNA (cytosine-5-)-methyltransferase [Amycolatopsis mediterranei U32] gi|299800539|gb|ADJ50914.1| DNA (cytosine-5-)-methyltransferase [Amycolatopsis mediterranei U32] Length = 435 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEE 45 + ACDFGVPQ R R ++ + FK+P P+ + + + + Sbjct: 163 LNACDFGVPQLRPRFVLVAMQEDDAKYFKWPEPVAKQLTVSAAIHD 208 >gi|315506801|ref|YP_004085688.1| DNA-cytosine methyltransferase [Micromonospora sp. L5] gi|315413420|gb|ADU11537.1| DNA-cytosine methyltransferase [Micromonospora sp. L5] Length = 412 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 ++A D+GVPQ R R ++ F +P P G P +GD L E ++ + W Sbjct: 148 LQASDYGVPQLRPRFILVALKTEDAPYFHWPEPQGAPPTVGDTLVE------LMAERGWR 201 Query: 60 GHQKRKEN 67 G Q E Sbjct: 202 GAQAWAER 209 >gi|307153788|ref|YP_003889172.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822] gi|306984016|gb|ADN15897.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822] Length = 424 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 9/63 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +GVPQ RERL+++ V ++P P+ ++ K + +WE Sbjct: 160 LNAAHYGVPQNRERLFLLGSQKGLVLPQYPEPITAPNPFQNL------SK---TPTVWEA 210 Query: 61 HQK 63 Q Sbjct: 211 LQD 213 >gi|325141979|gb|EGC64416.1| cytosine-specific methyltransferase MthTI [Neisseria meningitidis 961-5945] Length = 364 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 8/50 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEH 46 + A ++GVPQ RER+ ++ FL+ V+ F + + D LE+ Sbjct: 164 INAIEYGVPQDRERIILVGFLSQHVDALQKFDWDAHI----SFPDALEKD 209 >gi|319746106|gb|EFV98380.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus agalactiae ATCC 13813] Length = 458 Score = 48.8 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFP 30 + + DF VPQ RER++II F FP Sbjct: 151 LNSKDFQVPQNRERIFIIGHSRRYCSRFLFP 181 >gi|331086924|ref|ZP_08336001.1| hypothetical protein HMPREF0987_02304 [Lachnospiraceae bacterium 9_1_43BFAA] gi|330410090|gb|EGG89525.1| hypothetical protein HMPREF0987_02304 [Lachnospiraceae bacterium 9_1_43BFAA] Length = 438 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 21/45 (46%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + A D+GVPQRR R+ I + ++P P +L+ Sbjct: 181 LNAADYGVPQRRNRIIFIGYRRGLTPPQYPEPTVKPNEQLSLLDA 225 >gi|260866454|ref|YP_003232856.1| putative DNA modification methylase [Escherichia coli O111:H- str. 11128] gi|257762810|dbj|BAI34305.1| predicted DNA modification methylase [Escherichia coli O111:H- str. 11128] Length = 356 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45 A D+GVPQ R R+ ++ S F++P+ I P +GD L + Sbjct: 154 NASDYGVPQLRPRVLLVALRGKYSAHFRWPSETLIPPTVGDALFD 198 >gi|241758593|ref|ZP_04756708.1| site-specific DNA-methyltransferase [Neisseria flavescens SK114] gi|241321245|gb|EER57417.1| site-specific DNA-methyltransferase [Neisseria flavescens SK114] Length = 364 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLG 40 + A ++GVPQ RER+ ++ FLN V+ F + + LG Sbjct: 164 INAIEYGVPQDRERIILVGFLNQHVDTLQKFDWDAHILFPDALG 207 >gi|325131820|gb|EGC54520.1| DNA-cytosine methyltransferase [Neisseria meningitidis M6190] gi|325137870|gb|EGC60445.1| cytosine-specific methyltransferase MthTI [Neisseria meningitidis ES14902] gi|325197946|gb|ADY93402.1| cytosine-specific methyltransferase MthTI [Neisseria meningitidis G2136] Length = 376 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 8/50 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEH 46 + A ++GVPQ RER+ ++ FL+ V+ F + + D LE+ Sbjct: 176 INAIEYGVPQDRERIILVGFLSQHVDALQKFDWDAHI----SFPDALEKD 221 >gi|254475144|ref|ZP_05088530.1| DNA-cytosine methyltransferase [Ruegeria sp. R11] gi|214029387|gb|EEB70222.1| DNA-cytosine methyltransferase [Ruegeria sp. R11] Length = 324 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-LGIKPRLGDIL 43 + A D+GVPQ R R+ I+ S +F +P P P +G+ L Sbjct: 145 LNASDYGVPQLRPRVAIVALRKEFSGQFAWPDPLPHNPPTVGETL 189 >gi|110643908|ref|YP_671638.1| putative type II 5-cytosoine methyltransferase [Escherichia coli 536] gi|110345500|gb|ABG71737.1| putative type II 5-cytosoine methyltransferase [Escherichia coli 536] Length = 315 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 27/106 (25%), Positives = 40/106 (37%), Gaps = 32/106 (30%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR----------------LGDILE 44 D+GVPQ R R+ I+ + VE+ +P P P+ L DI E Sbjct: 144 NVADYGVPQMRYRVIIVGVRDDIKVEYIYPQPTHSSPKKSDKTGLAPWISIGDALHDIPE 203 Query: 45 E--------HIDDKSTISNKLWEGHQKRKENNK------IAGKGFG 76 H+ I+N+ + GH + + NK G G G Sbjct: 204 PDSENDLLNHVYSTYKITNRNFTGH-RETDPNKPSPTILARGNGKG 248 >gi|121582558|ref|YP_974087.1| DNA-cytosine methyltransferase [Acidovorax sp. JS42] gi|120608614|gb|ABM44352.1| DNA-cytosine methyltransferase [Acidovorax sp. JS42] Length = 318 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDILEE 45 A D+GV Q R R+ + F +P P P +G++L + Sbjct: 146 NASDYGVSQLRPRVVFVGIRKDLASGFSWPEPLPNNPPTVGELLHD 191 >gi|317182001|dbj|BAJ59785.1| cytosine specific DNA methyltransferase (BSP6IM) [Helicobacter pylori F57] Length = 434 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + A DFGV Q RERLYI+ L+ ++ FP Sbjct: 175 LNAKDFGVAQNRERLYIVGNLSCPIDLDHFP 205 >gi|209527672|ref|ZP_03276170.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] gi|209491900|gb|EDZ92257.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] Length = 429 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 19/70 (27%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-----------------IKP--RLGD 41 + + ++GVPQ R R Y++ LN + F + LG KP ++ D Sbjct: 148 LNSSNYGVPQNRVRAYMMGVLNQTPHFNLVSDLGAKDSHSYESGQLSLFSAPKPSCKVRD 207 Query: 42 ILEEHIDDKS 51 ILE++ Sbjct: 208 ILEDNPPHHY 217 >gi|260913722|ref|ZP_05920198.1| modification methylase NgoPII [Pasteurella dagmatis ATCC 43325] gi|260632261|gb|EEX50436.1| modification methylase NgoPII [Pasteurella dagmatis ATCC 43325] Length = 329 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 11/60 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R+R++ I F S+ F+FP I + D +DK T+ + +W+ Sbjct: 144 VNAKDYGVAQERKRVFYIGFRKDLSISFQFP----IGSTVND------EDKITLKDIIWD 193 >gi|291569071|dbj|BAI91343.1| cytosine-specific methyltransferase [Arthrospira platensis NIES-39] Length = 429 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 19/70 (27%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP-------------------RLGD 41 + + ++GVPQ R R Y++ LN + F + LG K ++ D Sbjct: 148 LNSSNYGVPQNRVRAYMMGVLNQTPHFNLLSDLGAKDSHSYQSGQLSLFSAYQTPCKVRD 207 Query: 42 ILEEHIDDKS 51 ILE++ Sbjct: 208 ILEDNPPQHY 217 >gi|284050345|ref|ZP_06380555.1| DNA (cytosine-5-)-methyltransferase [Arthrospira platensis str. Paraca] Length = 429 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 19/70 (27%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP-------------------RLGD 41 + + ++GVPQ R R Y++ LN + F + LG K ++ D Sbjct: 148 LNSSNYGVPQNRVRAYMMGVLNQTPHFNLLSDLGAKDSHSYQSGQLSLFSAYQTPCKVRD 207 Query: 42 ILEEHIDDKS 51 ILE++ Sbjct: 208 ILEDNPPQHY 217 >gi|163738696|ref|ZP_02146110.1| DNA-cytosine methyltransferase [Phaeobacter gallaeciensis BS107] gi|163741592|ref|ZP_02148983.1| DNA modification methylase M.NGOI [Phaeobacter gallaeciensis 2.10] gi|161385326|gb|EDQ09704.1| DNA modification methylase M.NGOI [Phaeobacter gallaeciensis 2.10] gi|161388024|gb|EDQ12379.1| DNA-cytosine methyltransferase [Phaeobacter gallaeciensis BS107] Length = 324 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR 38 + A D+GVPQ R R+ I+ S +F +P PL PR Sbjct: 145 LNASDYGVPQLRPRVAIVALRKEFSGQFNWPDPLPHNPR 183 >gi|24527985|emb|CAD33712.1| putative DNA methylase [Escherichia coli] Length = 314 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 27/106 (25%), Positives = 40/106 (37%), Gaps = 32/106 (30%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR----------------LGDILE 44 D+GVPQ R R+ I+ + VE+ +P P P+ L DI E Sbjct: 143 NVADYGVPQMRYRVIIVGVRDDIKVEYIYPQPTHSSPKKSDKTGLAPWISIGDALHDIPE 202 Query: 45 E--------HIDDKSTISNKLWEGHQKRKENNK------IAGKGFG 76 H+ I+N+ + GH + + NK G G G Sbjct: 203 PDSENDLLNHVYSTYKITNRNFTGH-RETDPNKPSPTILARGNGKG 247 >gi|323178455|gb|EFZ64033.1| modification methylase NgoMIV [Escherichia coli 1180] Length = 377 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45 A D+GVPQ R R+ ++ S F++P+ I P +GD L + Sbjct: 154 NASDYGVPQLRPRVLLVALRGKYSAHFRWPSETLIPPTVGDALFD 198 >gi|325132717|gb|EGC55400.1| DNA-cytosine methyltransferase [Neisseria meningitidis M6190] gi|325136737|gb|EGC59337.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579] gi|325138603|gb|EGC61162.1| DNA-cytosine methyltransferase [Neisseria meningitidis ES14902] gi|325142796|gb|EGC65168.1| DNA-cytosine methyltransferase [Neisseria meningitidis 961-5945] gi|325198710|gb|ADY94166.1| DNA-cytosine methyltransferase [Neisseria meningitidis G2136] gi|325201728|gb|ADY97182.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149] gi|325204572|gb|ADZ00026.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240355] gi|325208528|gb|ADZ03980.1| DNA-cytosine methyltransferase [Neisseria meningitidis NZ-05/33] Length = 316 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 13/78 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP------LGIKPRLGDILEEHIDDKSTIS 54 + A D+GVPQ RER+ I+ L E + + + +GD++++ D+ I+ Sbjct: 166 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDE---IA 222 Query: 55 NKLWEGHQKRKENNKIAG 72 N +W R E + G Sbjct: 223 NHIWS----RAEKSPDQG 236 >gi|25011412|ref|NP_735807.1| hypothetical protein gbs1370 [Streptococcus agalactiae NEM316] gi|24412950|emb|CAD47029.1| unknown [Streptococcus agalactiae NEM316] Length = 450 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL 43 + + DF VPQ RER+++I F FP P + L Sbjct: 148 LNSKDFQVPQNRERVFLIGHSRRYRPRFLFPLRREGSPTDIERL 191 >gi|294155584|ref|YP_003559968.1| CpG cytosine-specific DNA modification methyltransferase [Mycoplasma crocodyli MP145] gi|291600126|gb|ADE19622.1| CpG cytosine-specific DNA modification methyltransferase [Mycoplasma crocodyli MP145] Length = 176 Score = 48.4 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49 M + D+ Q RER++ + FL + F+FP + +++++ I+D Sbjct: 1 MNSKDYNSAQNRERVFAVSFLGEN-NFEFPKINSKPKTIKEVIKQSIND 48 >gi|326574028|gb|EGE23977.1| DcmB [Moraxella catarrhalis CO72] Length = 337 Score = 48.4 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 11/60 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A ++GV Q R+R++ I F ++ F FP +G E+ D+K T+ + +W+ Sbjct: 144 VNAKNYGVAQERKRVFYIGFRKDLAINFNFP--------IGSTAED--DNKITLKDVIWD 193 >gi|325130663|gb|EGC53404.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304] gi|325134723|gb|EGC57362.1| DNA-cytosine methyltransferase [Neisseria meningitidis M13399] gi|325144843|gb|EGC67131.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240013] gi|325205668|gb|ADZ01121.1| DNA-cytosine methyltransferase [Neisseria meningitidis M04-240196] Length = 316 Score = 48.4 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 13/78 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP------LGIKPRLGDILEEHIDDKSTIS 54 + A D+GVPQ RER+ I+ L E + + + +GD++++ D+ I+ Sbjct: 166 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDE---IA 222 Query: 55 NKLWEGHQKRKENNKIAG 72 N +W R E + G Sbjct: 223 NHIWS----RAEKSPDQG 236 >gi|303236368|ref|ZP_07322958.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN] gi|302483426|gb|EFL46431.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN] Length = 357 Score = 48.4 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 13/60 (21%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-------------PRLGDILEEHIDD 49 A D+GVPQ R+RL + N +F+FP PL + P L D L + Sbjct: 157 AADYGVPQIRKRLVFVGLKNNKEKFEFPEPLLKEEAYITCKQAISDLPPLVDELGSEVST 216 >gi|118601986|ref|YP_908686.1| cytosine-specific DNA methylase [Photobacterium damselae subsp. piscicida] gi|118614724|ref|YP_908507.1| cytosine-specific DNA methylase [Photobacterium damselae subsp. piscicida] gi|134044487|ref|YP_001101821.1| C-5 cytosine-specific DNA methylase [Yersinia ruckeri] gi|134044859|ref|YP_001102203.1| C-5 cytosine-specific DNA methylase [Yersinia pestis biovar Orientalis str. IP275] gi|134047248|ref|YP_001101999.1| C-5 cytosine-specific DNA methylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|165937989|ref|ZP_02226549.1| cytosine-specific DNA methylase [Yersinia pestis biovar Orientalis str. IP275] gi|229516190|ref|ZP_04405639.1| site-specific DNA methylase [Vibrio cholerae RC9] gi|237640283|ref|YP_002891138.1| Dcm [Escherichia coli] gi|237810027|ref|YP_002894466.1| Dcm [Escherichia coli] gi|237810223|ref|YP_002894662.1| Dcm [Salmonella enterica] gi|118596815|dbj|BAF38119.1| cytosine-specific DNA methylase [Photobacterium damselae subsp. piscicida] gi|118596995|dbj|BAF38298.1| cytosine-specific DNA methylase [Photobacterium damselae subsp. piscicida] gi|133904850|gb|ABO40867.1| C-5 cytosine-specific DNA methylase [Yersinia ruckeri] gi|133905167|gb|ABO41182.1| C-5 cytosine-specific DNA methylase [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|133905393|gb|ABO42155.1| C-5 cytosine-specific DNA methylase [Yersinia pestis biovar Orientalis str. IP275] gi|165914012|gb|EDR32629.1| cytosine-specific DNA methylase [Yersinia pestis biovar Orientalis str. IP275] gi|229346840|gb|EEO11809.1| site-specific DNA methylase [Vibrio cholerae RC9] gi|229561502|gb|ACQ77705.1| Dcm [Escherichia coli] gi|229561707|gb|ACQ77909.1| Dcm [Salmonella enterica] gi|229561882|gb|ACQ78083.1| Dcm [Escherichia coli] gi|324008172|gb|EGB77391.1| C-5 cytosine-specific DNA methylase [Escherichia coli MS 57-2] gi|327536569|gb|AEA95402.1| C-5 cytosine-specific DNA methylase [Salmonella enterica subsp. enterica serovar Dublin] gi|332144438|dbj|BAK19658.1| C-5 cytosine-specific DNA methylase [Salmonella enterica subsp. enterica serovar Typhimurium] Length = 541 Score = 48.4 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 26/102 (25%), Positives = 45/102 (44%), Gaps = 11/102 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP---RLGDILEEHIDDKSTISNKL 57 + +FGV +RR+RL ++ + F+ ++ R+ DILE D S + Sbjct: 281 LDGNEFGVIERRKRLCVVALSHGIDGFELEKVQPVRTKESRIQDILEPVPLD----SER- 335 Query: 58 WE---GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 W+ +++ +K AGKGF L + T+ Y K Sbjct: 336 WKSFDYLAEKELRDKAAGKGFSRQLLTGDDEFCGTIGKDYAK 377 >gi|290891561|ref|ZP_06554618.1| hypothetical protein AWRIB429_2008 [Oenococcus oeni AWRIB429] gi|290478814|gb|EFD87481.1| hypothetical protein AWRIB429_2008 [Oenococcus oeni AWRIB429] Length = 382 Score = 48.4 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + +FGVPQ RER++II Sbjct: 149 LNSKNFGVPQNRERVFIIG 167 >gi|262200549|ref|YP_003271757.1| DNA-cytosine methyltransferase [Gordonia bronchialis DSM 43247] gi|262083896|gb|ACY19864.1| DNA-cytosine methyltransferase [Gordonia bronchialis DSM 43247] Length = 399 Score = 48.4 bits (115), Expect = 4e-04, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLG 40 + A D+GVPQ+R R++ + F + E+ FP+P L Sbjct: 178 VNAADYGVPQQRWRVFFVGFRSDVDAEWSFPSPTHSAAALR 218 >gi|315029938|gb|EFT41870.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX4000] Length = 317 Score = 48.0 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 26/94 (27%), Positives = 41/94 (43%), Gaps = 6/94 (6%) Query: 1 MKACDFGVPQRRERLY-IIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A DFG+PQ+R+R++ I F +KP LG+ LE D K ++ Sbjct: 149 LNAMDFGIPQKRKRVFAISKLDGEPFNFDLLKHRPLKP-LGNFLEVTTDQKYLVTQP--S 205 Query: 60 GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93 K + + +A GF L N T++ R Sbjct: 206 MLSKIRSKSSLA-NGFSGRLEVVNDFVY-TITTR 237 >gi|281181375|dbj|BAI57705.1| cytosine specific DNA methyltransferase [Escherichia coli SE15] gi|315288374|gb|EFU47772.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 110-3] Length = 398 Score = 48.0 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A D+GVPQ R+R++I N Sbjct: 159 LNARDYGVPQNRKRVFIAGVRND 181 >gi|152994008|ref|YP_001359729.1| cytosine-specific methyltransferase [Sulfurovum sp. NBC37-1] gi|151425869|dbj|BAF73372.1| cytosine-specific methyltransferase [Sulfurovum sp. NBC37-1] Length = 362 Score = 48.0 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPT-PLGIKPRLGDILEEHIDDK 50 + A DFGVPQ R R +II ++F F + K +G+ L++ K Sbjct: 150 LNAADFGVPQYRNRFFIIGHRKEKGGIKFDFDSLEKKPKVTVGEALKDLPSLK 202 >gi|15894780|ref|NP_348129.1| DNA-methyltransferase (cytosine-specific), ortholog of BSP6I Bsubtilis [Clostridium acetobutylicum ATCC 824] gi|15024448|gb|AAK79469.1|AE007660_12 DNA-methyltransferase (cytosine-specific), ortholog of BSP6I Bsubtilis [Clostridium acetobutylicum ATCC 824] gi|325508918|gb|ADZ20554.1| DNA-methyltransferase (cytosine-specific) [Clostridium acetobutylicum EA 2018] Length = 415 Score = 48.0 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSVEFKF 29 + DF +PQ RER+YI+ FLN KF Sbjct: 204 LNTMDFSHLPQNRERIYIVGFLNKKDAEKF 233 >gi|317480905|ref|ZP_07939986.1| C-5 cytosine-specific DNA methylase [Bacteroides sp. 4_1_36] gi|316902990|gb|EFV24863.1| C-5 cytosine-specific DNA methylase [Bacteroides sp. 4_1_36] Length = 441 Score = 48.0 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Query: 5 DFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPR-LGDILEEHIDDKSTISN 55 FG+PQ R R+YI+ L +F+FP + + DIL D ++ Sbjct: 149 YFGIPQHRTRIYIVGRLKSKGGLKDFRFPEHIERPECNINDILVPDDTDYMSLRP 203 >gi|462647|sp|P34905|MTB1_BREBE RecName: Full=Modification methylase BbvI; Short=M.BbvI; AltName: Full=Cytosine-specific methyltransferase BbvI Length = 374 Score = 48.0 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 17/70 (24%) Query: 5 DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP------RLGDILEEHIDDKSTISNKL 57 ++GVPQRR R+ I+ V F+ P P + L DI E+ ++ + T Sbjct: 170 EYGVPQRRHRIIIVGIRKDQDVAFRVPEPTHKEKYRTASEALADIPEDALNHEFT----- 224 Query: 58 WEGHQKRKEN 67 + K+ Sbjct: 225 -----RHKKK 229 >gi|228969065|ref|ZP_04129983.1| Cytosine-specific methyltransferase [Bacillus thuringiensis serovar sotto str. T04001] gi|228790631|gb|EEM38314.1| Cytosine-specific methyltransferase [Bacillus thuringiensis serovar sotto str. T04001] Length = 326 Score = 48.0 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + +FGVPQ RER++II Sbjct: 150 LNSKNFGVPQNRERVFIIG 168 >gi|288904476|ref|YP_003429697.1| DNA methylase [Streptococcus gallolyticus UCN34] gi|288731201|emb|CBI12749.1| Putative DNA methylase [Streptococcus gallolyticus UCN34] Length = 366 Score = 48.0 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + DFGVPQ RER+++I Sbjct: 147 LNSKDFGVPQNRERVFLIG 165 >gi|237703954|ref|ZP_04534435.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA] gi|226901866|gb|EEH88125.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA] Length = 367 Score = 48.0 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A D+GVPQ R+R++I N Sbjct: 128 LNARDYGVPQNRKRVFIAGVRND 150 >gi|330723584|gb|AEC45954.1| Cytosine-specific methyltransferase [Mycoplasma hyorhinis MCLD] Length = 397 Score = 48.0 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49 + + DFG Q RER++++ LN FK+P + L ILE + Sbjct: 217 LNSTDFGSSQNRERVFMVSKLNNKP-FKWPLKIKHNNDLSRILESNFQP 264 >gi|1709158|sp|P50192|MTHA_HAEPH RecName: Full=Modification methylase HphIA; Short=M.HphIA; AltName: Full=Cytosine-specific methyltransferase HphIA; AltName: Full=M.Hphi(C) gi|732729|emb|CAA59690.1| site-specific DNA-methyltransferase (cytosine-specific) [Haemophilus parahaemolyticus] Length = 372 Score = 48.0 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP-RLGD 41 + A DFGVPQ R R+ I E FP P + +GD Sbjct: 195 LNAADFGVPQLRSRIVFIG-RKDGGEITFPEPSHTEYNTVGD 235 >gi|169823586|ref|YP_001691089.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328] gi|167832206|dbj|BAG09121.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328] Length = 330 Score = 48.0 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 16/76 (21%), Positives = 28/76 (36%), Gaps = 15/76 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + A D+GV Q R+R++ + F ++ F P KP L D + + + Sbjct: 142 LNASDYGVAQDRKRIFYVGFRKDLNICFDNPPKKFNYKPTLKDAI-------YDLKDTAI 194 Query: 59 EGHQKRKENNKIAGKG 74 N+ G Sbjct: 195 PSL------NRNKTNG 204 >gi|328947038|ref|YP_004364375.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] gi|328447362|gb|AEB13078.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] Length = 466 Score = 48.0 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Query: 5 DFGVPQRRERLYIIDFLNPSV---EFKFPTPLGI-KPRLGDILEEHIDD 49 +FG+PQ R+R+YI+ L +FKFP + + +++E DD Sbjct: 173 NFGIPQHRKRIYIVGRLKSKGGLKDFKFPPHEEKVECNIKSVIDESDDD 221 >gi|67925212|ref|ZP_00518579.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] gi|67852948|gb|EAM48340.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] Length = 417 Score = 48.0 bits (114), Expect = 5e-04, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF--PTPLG 34 + A FGVPQ+R+R++I+ V +F P P Sbjct: 225 LSAASFGVPQKRDRIFIVGLKKDQVSKQFIIPKPTH 260 >gi|210617281|ref|ZP_03291507.1| hypothetical protein CLONEX_03729 [Clostridium nexile DSM 1787] gi|210149385|gb|EEA80394.1| hypothetical protein CLONEX_03729 [Clostridium nexile DSM 1787] Length = 455 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDI 42 + + DFGVPQ R+R+YI+ +L+ P P L I Sbjct: 176 LNSKDFGVPQARKRVYIVGYLDFRCAGKILPEPETNGAALVQI 218 >gi|304372838|ref|YP_003856047.1| Cytosine-specific methyltransferase [Mycoplasma hyorhinis HUB-1] gi|304309029|gb|ADM21509.1| Cytosine-specific methyltransferase [Mycoplasma hyorhinis HUB-1] Length = 397 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49 + + DFG Q RER++++ LN FK+P + L ILE + Sbjct: 217 LNSTDFGSSQNRERVFMVSKLNNKP-FKWPLKIKHNNDLSRILESNFQP 264 >gi|291539766|emb|CBL12877.1| DNA-methyltransferase (dcm) [Roseburia intestinalis XB6B4] Length = 366 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 22/33 (66%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 + A D+G+PQ R+R++ + + +F+FP P+ Sbjct: 155 LYAPDYGIPQMRKRVFFVGLRDGKTKFEFPEPV 187 >gi|311977248|gb|ADQ20503.1| M.BbvI [Brevibacillus brevis] Length = 367 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 17/70 (24%) Query: 5 DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP------RLGDILEEHIDDKSTISNKL 57 ++GVPQRR R+ I+ V F+ P P + L DI E+ ++ + T Sbjct: 170 EYGVPQRRHRIIIVGIRKDQDVAFRVPEPTHKEKYRTASEALADIPEDALNHEFT----- 224 Query: 58 WEGHQKRKEN 67 + K+ Sbjct: 225 -----RHKKK 229 >gi|153852755|ref|ZP_01994192.1| hypothetical protein DORLON_00174 [Dorea longicatena DSM 13814] gi|149754397|gb|EDM64328.1| hypothetical protein DORLON_00174 [Dorea longicatena DSM 13814] Length = 367 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRL 39 + + DFGVPQ R+R+YI+ +L+ P P L Sbjct: 84 LNSKDFGVPQSRKRVYIVGYLDGRCAGKILPFPKANGTAL 123 >gi|317054725|ref|YP_004103193.1| cytosine specific DNA methyltransferase [Paracoccus aminophilus] gi|294869157|gb|ADF47149.1| cytosine specific DNA methyltransferase [Paracoccus aminophilus] Length = 363 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 + A D+GVPQ R R ++I + ++ FP P + D+ Sbjct: 149 LNAADYGVPQARPRFFLIGTRDGE-KYNFPDPSHAPTSVNDLF 190 >gi|213024445|ref|ZP_03338892.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] Length = 137 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 19/43 (44%), Gaps = 7/43 (16%) Query: 8 VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDIL 43 +PQ RER+ ++ F N +F +P L ++L Sbjct: 94 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELL 136 >gi|293363234|ref|ZP_06610118.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma alligatoris A21JP2] gi|292553093|gb|EFF41842.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma alligatoris A21JP2] Length = 428 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 6/68 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD-KSTISNKLWE 59 + + DFG+ Q R+R+YII + +V + + + DI E++++ KS S +L Sbjct: 160 LNSADFGLAQNRKRVYIIGTKDKTVHLN--NFVKKQSNVKDIQEDNLETIKSIFSKQL-- 215 Query: 60 GHQKRKEN 67 +K K Sbjct: 216 -LKKYKTK 222 >gi|242348041|ref|YP_002995602.1| C-5 cytosine-specific DNA methylase [Aeromonas hydrophila] gi|224831860|gb|ACN66991.1| C-5 cytosine-specific DNA methylase [Aeromonas hydrophila] Length = 541 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 26/102 (25%), Positives = 45/102 (44%), Gaps = 11/102 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP---RLGDILEEHIDDKSTISNKL 57 + +FGV +RR+RL ++ + F+ ++ R+ DILE D S + Sbjct: 281 LDGNEFGVIERRKRLCVVALSHGIDGFELEKVQPVRTKESRIQDILESVPLD----SER- 335 Query: 58 WE---GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 W+ +++ +K AGKGF L + T+ Y K Sbjct: 336 WKSFDYLAEKELRDKAAGKGFSRQLLTGDDEFCGTIGKDYAK 377 >gi|224436796|ref|ZP_03657794.1| modification methylase HaeIII [Helicobacter cinaedi CCUG 18818] gi|313143285|ref|ZP_07805478.1| cytosine specific DNA methyltransferase [Helicobacter cinaedi CCUG 18818] gi|313128316|gb|EFR45933.1| cytosine specific DNA methyltransferase [Helicobacter cinaedi CCUG 18818] Length = 305 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPR 38 + A D+GV Q R+R+ II + E FP PL KP+ Sbjct: 148 LNASDYGVAQNRKRVIIIGRRVDIKQEIDFPKPLHKKPK 186 >gi|20530828|gb|AAM27270.1|AF507962_1 methyl transferase [Lactococcus lactis] Length = 185 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + +FGVPQ RER++II Sbjct: 149 LNSKNFGVPQNRERVFIIG 167 >gi|30089875|ref|NP_839905.1| putative methylase [Lactococcus phage P335 sensu lato] gi|21954664|gb|AAM83053.1|AF489521_14 putative methylase [Lactococcus phage 4268] Length = 185 Score = 47.6 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + +FGVPQ RER++II Sbjct: 149 LNSKNFGVPQNRERVFIIG 167 >gi|163755904|ref|ZP_02163021.1| modification methylase (Eco47II, Sau96I) [Kordia algicida OT-1] gi|161324075|gb|EDP95407.1| modification methylase (Eco47II, Sau96I) [Kordia algicida OT-1] Length = 413 Score = 47.6 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45 +KA ++ VPQ+RERL ++ +++ +P P L D L++ Sbjct: 219 LKAINYKVPQKRERLILVGIRKDIDIKYDYPKPHNKIYNLSDALKK 264 >gi|153815491|ref|ZP_01968159.1| hypothetical protein RUMTOR_01726 [Ruminococcus torques ATCC 27756] gi|145847133|gb|EDK24051.1| hypothetical protein RUMTOR_01726 [Ruminococcus torques ATCC 27756] Length = 439 Score = 47.6 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDI 42 + + DFGVPQ R+R+Y++ +L+ P P L I Sbjct: 160 LNSKDFGVPQSRKRVYLVGYLDRRCAGKILPFPAANGTSLIQI 202 >gi|323955563|gb|EGB51327.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H263] Length = 126 Score = 47.6 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A D+GVPQ R+R++I N Sbjct: 81 LNARDYGVPQNRKRVFIAGVRND 103 >gi|262402827|ref|ZP_06079388.1| type II restriction-modification system methylation subunit [Vibrio sp. RC586] gi|262351609|gb|EEZ00742.1| type II restriction-modification system methylation subunit [Vibrio sp. RC586] Length = 341 Score = 47.6 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-LGIKPRLGDILEEHIDD 49 +KA DF VPQ R R+ I+ + + + FP P + + ++E I D Sbjct: 155 LKASDFEVPQNRHRVIIVGVRHDVNNNYTFPEPIISSDLTVKSVIENSILD 205 >gi|145218883|ref|YP_001129592.1| DNA-cytosine methyltransferase [Prosthecochloris vibrioformis DSM 265] gi|145205047|gb|ABP36090.1| DNA-cytosine methyltransferase [Chlorobium phaeovibrioides DSM 265] Length = 377 Score = 47.6 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 ++A D+G+PQRR+R I+ + P+P Sbjct: 152 LEASDYGLPQRRQRTIIVGWKKHLPAVSLPSPTH 185 >gi|331085742|ref|ZP_08334825.1| hypothetical protein HMPREF0987_01128 [Lachnospiraceae bacterium 9_1_43BFAA] gi|330406665|gb|EGG86170.1| hypothetical protein HMPREF0987_01128 [Lachnospiraceae bacterium 9_1_43BFAA] Length = 425 Score = 47.6 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + D+GVPQ RER++II Sbjct: 151 LNSKDYGVPQNRERVFIIA 169 >gi|160894995|ref|ZP_02075769.1| hypothetical protein CLOL250_02545 [Clostridium sp. L2-50] gi|156863426|gb|EDO56857.1| hypothetical protein CLOL250_02545 [Clostridium sp. L2-50] Length = 447 Score = 47.6 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRL 39 + + DFGVPQ R+R+YI+ +L+ P P L Sbjct: 164 LNSKDFGVPQSRKRVYIVGYLDGRCAGKILPFPKANGTAL 203 >gi|254412384|ref|ZP_05026158.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196180694|gb|EDX75684.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 221 Score = 47.6 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + + D+GV Q RER++I+ F+FP P K Sbjct: 161 LNSADYGVAQLRERVFIVA-TRIKPSFRFPLPTHSK 195 >gi|153872654|ref|ZP_02001483.1| DNA methylase [Beggiatoa sp. PS] gi|152070879|gb|EDN68516.1| DNA methylase [Beggiatoa sp. PS] Length = 259 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FG+PQ RER+ II Sbjct: 26 LNAKHFGLPQNRERIIIIG 44 >gi|328948822|ref|YP_004366159.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] gi|328449146|gb|AEB14862.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] Length = 437 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 22/83 (26%), Positives = 32/83 (38%), Gaps = 14/83 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP---RLGDILEEHID---DKS--- 51 + A +FGVPQ R+R+YI FP + L DILE+ + K Sbjct: 161 LNAKNFGVPQDRKRIYITG-----TYTDFPNLENFETNNANLSDILEKGLPVSNSKFVNL 215 Query: 52 TISNKLWEGHQKRKENNKIAGKG 74 +SN + +K G Sbjct: 216 VLSNYSVKQLYGMSIKDKRGGNN 238 >gi|71274663|ref|ZP_00650951.1| C-5 cytosine-specific DNA methylase [Xylella fastidiosa Dixon] gi|71899625|ref|ZP_00681779.1| C-5 cytosine-specific DNA methylase [Xylella fastidiosa Ann-1] gi|71164395|gb|EAO14109.1| C-5 cytosine-specific DNA methylase [Xylella fastidiosa Dixon] gi|71730577|gb|EAO32654.1| C-5 cytosine-specific DNA methylase [Xylella fastidiosa Ann-1] Length = 329 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVE-FKFPTPL-GIKPRLGDILEE 45 A D+GV Q R R+ + F +P PL P +G++L + Sbjct: 157 NASDYGVSQLRPRVVFVGIRKDLASGFAWPEPLQNAPPTVGELLHD 202 >gi|154502686|ref|ZP_02039746.1| hypothetical protein RUMGNA_00499 [Ruminococcus gnavus ATCC 29149] gi|153796569|gb|EDN78989.1| hypothetical protein RUMGNA_00499 [Ruminococcus gnavus ATCC 29149] Length = 458 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRL 39 + + DFGVPQ R+R+Y++ +L+ P P L Sbjct: 179 LNSKDFGVPQSRKRVYLVGYLDRRCAGKILPFPTANGTPL 218 >gi|265751237|ref|ZP_06087300.1| DNA-cytosine methyltransferase [Bacteroides sp. 3_1_33FAA] gi|270294602|ref|ZP_06200804.1| DNA-cytosine methyltransferase [Bacteroides sp. D20] gi|263238133|gb|EEZ23583.1| DNA-cytosine methyltransferase [Bacteroides sp. 3_1_33FAA] gi|270276069|gb|EFA21929.1| DNA-cytosine methyltransferase [Bacteroides sp. D20] Length = 335 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 21/79 (26%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + A D+ VP+ R+R++ I F +F++PTPL KP T+ +W Sbjct: 144 LNANDYDVPEDRDRVFYIGFRKDLDIHDFEYPTPLKHKP--------------TLRESIW 189 Query: 59 EGHQKRK----ENNKIAGK 73 + Q E NK G Sbjct: 190 D-LQDSAIPALEKNKTNGN 207 >gi|255073161|ref|XP_002500255.1| DNA methyltransferase [Micromonas sp. RCC299] gi|226515517|gb|ACO61513.1| DNA methyltransferase [Micromonas sp. RCC299] Length = 599 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 23/103 (22%), Positives = 38/103 (36%), Gaps = 16/103 (15%) Query: 8 VPQRRERLYIIDFL------NPSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 VPQ R+R++ + F F +P P + D+LE+ + T ++ E Sbjct: 424 VPQSRKRVFFVGFRSDLRAAREDGVFTWPEEPRDCGGTVKDVLEDE--HRETARCEVSEY 481 Query: 61 HQKRKE----NNKIAGKGFG---YGLFFENSATTNTLSARYYK 96 +R + G+ G G + TL A Y K Sbjct: 482 QMERAAAFFRRTQSRGENEGSEHAGYLYPVDGVARTLCASYRK 524 >gi|332970700|gb|EGK09681.1| modification methylase DdeIM [Kingella kingae ATCC 23330] Length = 193 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 6/52 (11%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFP-----TPLGIKPRLGDILEEHIDD 49 A DFGVPQ R R + + F N + F+FP + + + D+ + + D Sbjct: 2 ASDFGVPQNRRRAFFVGFKNGT-RFEFPQATVKQHITAEQAISDLPDYSVAD 52 >gi|227486883|ref|ZP_03917199.1| DNA restriction-modification system, DNA methylase [Corynebacterium glucuronolyticum ATCC 51867] gi|227541955|ref|ZP_03972004.1| DNA restriction-modification system DNA methylase [Corynebacterium glucuronolyticum ATCC 51866] gi|227092957|gb|EEI28269.1| DNA restriction-modification system, DNA methylase [Corynebacterium glucuronolyticum ATCC 51867] gi|227182398|gb|EEI63370.1| DNA restriction-modification system DNA methylase [Corynebacterium glucuronolyticum ATCC 51866] Length = 332 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 3 ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + D+GVPQ R R ++ S F+FP P+ + +G+ L +++K LW Sbjct: 152 SADYGVPQLRPRFILVALRKEYSPYFEFPEPMPHRITVGEALHGLMEEKGWPGADLWA 209 >gi|313675860|ref|YP_004053856.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] gi|312942558|gb|ADR21748.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] Length = 412 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45 +KA + VPQ+RERL ++ +EF +P P L D L++ Sbjct: 218 LKAIQYRVPQKRERLILVGIRKDIDIEFLYPKPHKKIYNLKDALKK 263 >gi|154504826|ref|ZP_02041564.1| hypothetical protein RUMGNA_02336 [Ruminococcus gnavus ATCC 29149] gi|153794709|gb|EDN77129.1| hypothetical protein RUMGNA_02336 [Ruminococcus gnavus ATCC 29149] Length = 422 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + +FGVPQ RER++II Sbjct: 151 LNSKNFGVPQNRERVFIIA 169 >gi|153814253|ref|ZP_01966921.1| hypothetical protein RUMTOR_00462 [Ruminococcus torques ATCC 27756] gi|145848649|gb|EDK25567.1| hypothetical protein RUMTOR_00462 [Ruminococcus torques ATCC 27756] Length = 422 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + +FGVPQ RER++II Sbjct: 151 LNSKNFGVPQNRERVFIIA 169 >gi|79835466|gb|ABB52093.1| Mod [Arthrospira platensis] gi|291569838|dbj|BAI92110.1| cytosine-specific methyltransferase [Arthrospira platensis NIES-39] Length = 345 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 21/104 (20%), Positives = 40/104 (38%), Gaps = 24/104 (23%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEH-----IDDKSTI 53 + A ++GVPQ+RERL+++ + + +P L I GD + + I K + Sbjct: 162 INAVNYGVPQKRERLFVVAY---QTAWNWPEAETLAIPYTAGDAIYDTASTIPIGAKF-L 217 Query: 54 SNKLWEGHQKRKENNKIAGKGFGYGLFFENSAT----TNTLSAR 93 + + E + + +K TL+ R Sbjct: 218 TPSMLEYIGRYEAKSKC---------VKPRDIYLDIPCRTLTCR 252 >gi|167746072|ref|ZP_02418199.1| hypothetical protein ANACAC_00767 [Anaerostipes caccae DSM 14662] gi|167654587|gb|EDR98716.1| hypothetical protein ANACAC_00767 [Anaerostipes caccae DSM 14662] Length = 476 Score = 47.2 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 29/71 (40%), Gaps = 12/71 (16%) Query: 1 MKACDFGVPQRRER-LYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL-- 57 + A DFGVPQ RER ++I + L E F + + D +++ L Sbjct: 251 LNAKDFGVPQNRERLIFIGNKLGIDNEVLFDEIESLSKTIPD---------YNLADALYG 301 Query: 58 WEGHQKRKENN 68 + ++ N Sbjct: 302 LRSLRASRKRN 312 >gi|325270791|ref|ZP_08137382.1| modification methylase Eco47II [Prevotella multiformis DSM 16608] gi|324986907|gb|EGC18899.1| modification methylase Eco47II [Prevotella multiformis DSM 16608] Length = 437 Score = 47.2 bits (112), Expect = 8e-04, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEE 45 +KA + VPQ+RERL+++ N V F++P+P L D + Sbjct: 217 LKAVMYKVPQKRERLFLVALRNDLSGHVTFRWPSPYHRIMTLRDAFFK 264 >gi|213863400|ref|ZP_03386655.1| C-5 cytosine-specific DNA methylase [Salmonella enterica subsp. enterica serovar Typhi str. M223] Length = 60 Score = 47.2 bits (112), Expect = 8e-04, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP 37 + + DF VPQ RER++II F FP P Sbjct: 16 LNSKDFQVPQNRERVFIIGHSRRYRPRFLFPLRRENSP 53 >gi|78778033|ref|YP_394348.1| DNA (cytosine-5-)-methyltransferase., Type II site-specific deoxyribonuclease [Sulfurimonas denitrificans DSM 1251] gi|78498573|gb|ABB45113.1| DNA (cytosine-5-)-methyltransferase., Type II site-specific deoxyribonuclease [Sulfurimonas denitrificans DSM 1251] Length = 657 Score = 47.2 bits (112), Expect = 8e-04, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDI 42 +KA D+G+PQ R R ++I F + + F FP + +K + D+ Sbjct: 160 IKASDYGLPQLRPRTFMIGFRDEDILKGFNFPPKIPLKFNMSDV 203 >gi|225017397|ref|ZP_03706589.1| hypothetical protein CLOSTMETH_01323 [Clostridium methylpentosum DSM 5476] gi|224949807|gb|EEG31016.1| hypothetical protein CLOSTMETH_01323 [Clostridium methylpentosum DSM 5476] Length = 485 Score = 47.2 bits (112), Expect = 8e-04, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDIL 43 + FG PQ RER++I+ +P FP P G L ++ Sbjct: 152 LNTKYFGPPQNRERVFIVACRHPGAGRGPKIFPVPAGSGKALIQLI 197 >gi|257464589|ref|ZP_05628960.1| putative 5-methylcytosine methyltransferase [Actinobacillus minor 202] gi|257450249|gb|EEV24292.1| putative 5-methylcytosine methyltransferase [Actinobacillus minor 202] Length = 331 Score = 47.2 bits (112), Expect = 8e-04, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 + A DFGVPQ R R+ I + FP P + + Sbjct: 153 LNAADFGVPQLRSRIVFIG-RKDKGKILFPEPSHREYK 189 >gi|253569226|ref|ZP_04846636.1| cytosine-specific DNA methylase [Bacteroides sp. 1_1_6] gi|251841245|gb|EES69326.1| cytosine-specific DNA methylase [Bacteroides sp. 1_1_6] Length = 448 Score = 47.2 bits (112), Expect = 8e-04, Method: Composition-based stats. Identities = 17/74 (22%), Positives = 29/74 (39%), Gaps = 10/74 (13%) Query: 5 DFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPR-LGDILEEHIDDKSTISN----- 55 FGVPQ R R+YI+ L+ F+FP + I+ D ++ Sbjct: 150 YFGVPQHRNRIYIVGRLHSKGGLKGFEFPDYTQRPECHISSIIHPEDTDYMSLRPITRKH 209 Query: 56 -KLWEGHQKRKENN 68 + WE + + + Sbjct: 210 LEAWEHFLQLLDKH 223 >gi|325285907|ref|YP_004261697.1| DNA-cytosine methyltransferase [Cellulophaga lytica DSM 7489] gi|324321361|gb|ADY28826.1| DNA-cytosine methyltransferase [Cellulophaga lytica DSM 7489] Length = 414 Score = 47.2 bits (112), Expect = 8e-04, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45 +KA ++ VPQ+RER+ ++ +++++P P L D L++ Sbjct: 219 LKAINYKVPQKRERVILVGVRKDIDIKYEYPKPHNKIYNLIDALKK 264 >gi|218133430|ref|ZP_03462234.1| hypothetical protein BACPEC_01295 [Bacteroides pectinophilus ATCC 43243] gi|217990805|gb|EEC56811.1| hypothetical protein BACPEC_01295 [Bacteroides pectinophilus ATCC 43243] Length = 320 Score = 46.8 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + + +FGVPQ RER++II Sbjct: 151 LNSKNFGVPQNRERVFIIA 169 >gi|291543286|emb|CBL16395.1| DNA-methyltransferase (dcm) [Ruminococcus sp. 18P13] Length = 369 Score = 46.8 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + + FGVPQ+R RLYI+ +L+P FP G L ++ + ++ Sbjct: 147 LNSKYFGVPQQRRRLYIVGYLDPRCAGKVFPLSGGNAKNLKQLIPGPQGQRVYETD 202 >gi|188533112|ref|YP_001906909.1| C-5 cytosine-specific DNA methylase family protein [Erwinia tasmaniensis Et1/99] gi|188028154|emb|CAO96012.1| C-5 cytosine-specific DNA methylase family protein [Erwinia tasmaniensis Et1/99] Length = 395 Score = 46.8 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A D+GVPQ R R++I+ + Sbjct: 167 LNAKDYGVPQNRNRVFILGLRDD 189 >gi|300727022|ref|ZP_07060441.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Prevotella bryantii B14] gi|299775566|gb|EFI72157.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Prevotella bryantii B14] Length = 446 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 8/70 (11%) Query: 1 MKACDFGVPQRRERLYIID----FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56 + A DFG+PQ+R+R+YI+ F ++EF P ++ + L +D+K T K Sbjct: 159 LDASDFGIPQKRKRVYIVGCKKRFGEINLEFNNPKIKTVEGCIEHGL-PVLDNKFT---K 214 Query: 57 LWEGHQKRKE 66 L + K+ Sbjct: 215 LLLSYYSPKK 224 >gi|187778292|ref|ZP_02994765.1| hypothetical protein CLOSPO_01884 [Clostridium sporogenes ATCC 15579] gi|187771917|gb|EDU35719.1| hypothetical protein CLOSPO_01884 [Clostridium sporogenes ATCC 15579] Length = 355 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + + DFGVPQ RER++ I L K FP Sbjct: 146 LNSKDFGVPQNRERVFTIGHLRRYGRRKIFP 176 >gi|91206207|ref|YP_538562.1| site-specific DNA methylase [Rickettsia bellii RML369-C] gi|91069751|gb|ABE05473.1| Site-specific DNA methylase [Rickettsia bellii RML369-C] Length = 308 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-----SVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53 + A FGVPQ RER+Y + ++++ P L DILE+ ID I Sbjct: 142 LNASLFGVPQARERVYFVCLRKDFSSEYNLKYIKPKESYENVFLNDILEKDIDKNLYI 199 >gi|320333452|ref|YP_004170163.1| DNA-cytosine methyltransferase [Deinococcus maricopensis DSM 21211] gi|319754741|gb|ADV66498.1| DNA-cytosine methyltransferase [Deinococcus maricopensis DSM 21211] Length = 326 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-LGIKPRLGDIL 43 + A D+GVPQ R R+ ++ ++ +P P P +G+ L Sbjct: 149 LNARDYGVPQLRPRVILVALRPDVMAQYSWPEPHPEAAPTVGEAL 193 >gi|160933407|ref|ZP_02080795.1| hypothetical protein CLOLEP_02253 [Clostridium leptum DSM 753] gi|156867284|gb|EDO60656.1| hypothetical protein CLOLEP_02253 [Clostridium leptum DSM 753] Length = 382 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 18/23 (78%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + + DFGVPQ R+R+Y++ +L+ Sbjct: 149 LNSKDFGVPQSRKRVYLVGYLDE 171 >gi|317056067|ref|YP_004104534.1| DNA-cytosine methyltransferase [Ruminococcus albus 7] gi|315448336|gb|ADU21900.1| DNA-cytosine methyltransferase [Ruminococcus albus 7] Length = 425 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 12/24 (50%), Positives = 17/24 (70%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS 24 + + DFGVPQ R+R++II FL Sbjct: 146 LNSADFGVPQARKRVFIIGFLRGE 169 >gi|269122950|ref|YP_003305527.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM 12112] gi|268314276|gb|ACZ00650.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM 12112] Length = 328 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 13/74 (17%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL-GIKPRLGDILEEHIDDKSTISNKLW 58 + A D+GVPQ R+R++ I F +++F P G K D + + + Sbjct: 142 LNASDYGVPQDRKRVFYIGFRKDLNIKFDKPPKQYGYKVTFKDAI-------YDLKDTAI 194 Query: 59 EGHQKRKENNKIAG 72 E NK G Sbjct: 195 PAL----EKNKTNG 204 >gi|160873497|ref|YP_001552813.1| DNA-cytosine methyltransferase [Shewanella baltica OS195] gi|160859019|gb|ABX47553.1| DNA-cytosine methyltransferase [Shewanella baltica OS195] gi|315265725|gb|ADT92578.1| DNA-cytosine methyltransferase [Shewanella baltica OS678] Length = 385 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A D+GVPQ R+R++I N Sbjct: 158 LNAKDYGVPQNRKRVFIFGTRND 180 >gi|53804329|ref|YP_114062.1| C-5 cytosine-specific DNA methylase family protein [Methylococcus capsulatus str. Bath] gi|53758090|gb|AAU92381.1| C-5 cytosine-specific DNA methylase family protein [Methylococcus capsulatus str. Bath] Length = 345 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 20/37 (54%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL 39 A D+GVPQ RER+ I+ L F+ P P+ R Sbjct: 196 AADYGVPQTRERVLIVGTLPGVKPFEPPKPIISPSRY 232 >gi|254413051|ref|ZP_05026823.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196180215|gb|EDX75207.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 353 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 7/74 (9%) Query: 1 MKACDFGVPQRRERLYII----DFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + A D+GVPQRRERL+ + + +P P +G LG++ + ++ Sbjct: 162 LNAADYGVPQRRERLFCVAHRGGWKWHPKTHHNLPYTVGE--ALGELALIVPLNAKFLTP 219 Query: 56 KLWEGHQKRKENNK 69 + E +K ++ +K Sbjct: 220 SMDEYIKKYEKASK 233 >gi|315636653|ref|ZP_07891886.1| modification methylase Eco47II [Arcobacter butzleri JV22] gi|315479079|gb|EFU69779.1| modification methylase Eco47II [Arcobacter butzleri JV22] Length = 411 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 4/70 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56 +KA + VPQ+RERL I+ V + +P P L D L++ + DK + Sbjct: 217 LKAIYYKVPQKRERLIIVGIKKEFMEKVTYSYPEPNEKIYTLKDALKKGELFDKDVPKSS 276 Query: 57 LWEGHQKRKE 66 + +++KE Sbjct: 277 GQKYPKRKKE 286 >gi|283834911|ref|ZP_06354652.1| C-5 cytosine-specific DNA methylase family protein [Citrobacter youngae ATCC 29220] gi|291069174|gb|EFE07283.1| C-5 cytosine-specific DNA methylase family protein [Citrobacter youngae ATCC 29220] Length = 400 Score = 46.8 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPT 31 + A D+GVPQ R R++I+ + E +P Sbjct: 171 LNAKDYGVPQNRNRVFILGLRSDVNIGEVTWPP 203 >gi|298373723|ref|ZP_06983712.1| modification methylase EcoRII [Bacteroidetes oral taxon 274 str. F0058] gi|298274775|gb|EFI16327.1| modification methylase EcoRII [Bacteroidetes oral taxon 274 str. F0058] Length = 457 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Query: 6 FGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILEEH 46 F +PQ R R+YI+ F FPTP K + I++E+ Sbjct: 161 FSIPQHRRRIYIVCVDKNKRSLEGFSFPTPTKNKCEISKIIDEN 204 >gi|119513472|ref|ZP_01632497.1| cytosine-specific DNA methyltransferase [Nodularia spumigena CCY9414] gi|119461873|gb|EAW42885.1| cytosine-specific DNA methyltransferase [Nodularia spumigena CCY9414] Length = 400 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A ++GVPQ RER+ ++ F N + Sbjct: 172 INAIEYGVPQDRERIILVGFRNNLIN 197 >gi|119493084|ref|ZP_01624009.1| C-5 cytosine-specific DNA methylase [Lyngbya sp. PCC 8106] gi|119452829|gb|EAW34004.1| C-5 cytosine-specific DNA methylase [Lyngbya sp. PCC 8106] Length = 441 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 26/66 (39%), Gaps = 9/66 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST---ISNKL 57 + A +GVPQ+RERL+++ +P P P + + + + + Sbjct: 165 LNAAYYGVPQKRERLFLLGCREDLALPNYPEPTFQPPY------SQVAKRYSHLPPTPTV 218 Query: 58 WEGHQK 63 E Q Sbjct: 219 REALQD 224 >gi|127429|sp|P06530|MTBR_BACSU RecName: Full=Modification methylase BsuRI; Short=M.BsuRI; AltName: Full=Cytosine-specific methyltransferase BsuRI gi|40247|emb|CAA26731.1| unnamed protein product [Bacillus subtilis] Length = 436 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 + A D+GVPQ RER+ I S +K+P+P + Sbjct: 227 LNARDYGVPQLRERVIIEGVRKDISFNYKYPSPTHGE 263 >gi|125974232|ref|YP_001038142.1| DNA-cytosine methyltransferase [Clostridium thermocellum ATCC 27405] gi|125714457|gb|ABN52949.1| DNA-cytosine methyltransferase [Clostridium thermocellum ATCC 27405] Length = 483 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/17 (58%), Positives = 14/17 (82%) Query: 1 MKACDFGVPQRRERLYI 17 + + DFGVPQ RER++I Sbjct: 148 LNSKDFGVPQNRERVFI 164 >gi|317506898|ref|ZP_07964670.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC BAA-974] gi|316254826|gb|EFV14124.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC BAA-974] Length = 331 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEE 45 + A +FGVPQ R R ++ +F++P + P +G L Sbjct: 148 LNASEFGVPQLRPRFILVAMKRRDFRKFEWPRAISAPPTVGSALRP 193 >gi|281416239|ref|YP_003347588.1| DNA cytosine methyltransferase [Enterococcus phage phiFL3A] gi|270209504|gb|ACZ64045.1| DNA cytosine methyltransferase [Enterococcus phage phiFL3A] gi|270209572|gb|ACZ64112.1| DNA cytosine methyltransferase [Enterococcus phage phiFL3B] Length = 317 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 1 MKACDFGVPQRRERLY-IIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + A DFG+PQ+R+R++ I F +KP L + LE D K ++ Sbjct: 149 LNAMDFGIPQKRKRVFAISKLDGEPFNFDLLKHRPLKP-LRNFLEVTTDQKYLVT 202 >gi|210621902|ref|ZP_03292899.1| hypothetical protein CLOHIR_00844 [Clostridium hiranonis DSM 13275] gi|210154533|gb|EEA85539.1| hypothetical protein CLOHIR_00844 [Clostridium hiranonis DSM 13275] Length = 438 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 + A D+GVPQRR R+ I + + ++P P Sbjct: 181 LNAADYGVPQRRNRIIFIGYKKGLKQPQYPEPT 213 >gi|325298663|ref|YP_004258580.1| DNA-cytosine methyltransferase [Bacteroides salanitronis DSM 18170] gi|324318216|gb|ADY36107.1| DNA-cytosine methyltransferase [Bacteroides salanitronis DSM 18170] Length = 463 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG-----IKPRLGDILE 44 + A DF +PQ R R++++ FL + F FP PL ++ +GDI E Sbjct: 143 LNAADFRIPQDRYRVFVVGFLKDLNCNFHFPHPLQNAHITLQKAIGDINE 192 >gi|328471744|gb|EGF42621.1| putative C-5 cytosine-specific DNA methylase [Vibrio parahaemolyticus 10329] Length = 392 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 19/92 (20%), Positives = 31/92 (33%), Gaps = 28/92 (30%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-----------SVEFKF-------------PTPLGIK 36 + A D+GVPQ R+R +I+ + F P + Sbjct: 160 LNAKDYGVPQNRKRAFILGIRDDVKIDKLVFPPKKTHFSPSSQEVAGGASSWTPASSVFE 219 Query: 37 PRLGDILEEHIDDK---ST-ISNKLWEGHQKR 64 P DI+E + D T +S+ + R Sbjct: 220 PITSDIIERFVTDHFRPYTKLSDDDARYYLNR 251 >gi|228982443|ref|ZP_04142702.1| Cytosine-specific methyltransferase [Bacillus thuringiensis Bt407] gi|228776626|gb|EEM24934.1| Cytosine-specific methyltransferase [Bacillus thuringiensis Bt407] Length = 418 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/84 (17%), Positives = 37/84 (44%), Gaps = 5/84 (5%) Query: 5 DFGVPQRRERLYIIDFL-NPSVEFKFPTPLGI--KPRLGDILEEHIDDKSTISNKLWEGH 61 ++G+PQ R+R++++ N F+FP + I + + D + + + +++ + Sbjct: 162 EYGIPQHRKRVFMVGIRSNLGKTFEFPEIVSISERKTIRDAIGDLPNPDKVMNS--LKDI 219 Query: 62 QKRKENNKIAGKGFGYGLFFENSA 85 Q + GYG+ + Sbjct: 220 QYEAQEQSSVHNHVGYGIRSDEKE 243 >gi|309789600|ref|ZP_07684181.1| BsaWI methylase [Oscillochloris trichoides DG6] gi|308228336|gb|EFO81983.1| BsaWI methylase [Oscillochloris trichoides DG6] Length = 436 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 14/77 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL----------GDI--LEEHID 48 + A ++GVPQ RERL+II + S+ FPTP +L GD+ L+ + Sbjct: 173 LNAANYGVPQFRERLFIIATSDSSLPIIFPTPTHGYTKLLPWNTVEDAIGDLPPLDNGEE 232 Query: 49 DKSTISNKL--WEGHQK 63 +S + ++ + Sbjct: 233 KNFYLSPPMKPYQYLMR 249 >gi|251811836|ref|ZP_04826309.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis BCM-HMP0060] gi|282875124|ref|ZP_06283997.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis SK135] gi|251804633|gb|EES57290.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis BCM-HMP0060] gi|281295889|gb|EFA88410.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis SK135] Length = 329 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK 50 ++ D+ +PQ+R+R++I+ + N +EF +P L K + + + + K Sbjct: 153 LQTSDYNIPQKRQRVFIVGYKN--IEFNYPEKLKRKVTIKEAISDLPPLK 200 >gi|27733906|ref|NP_775697.1| putative C5-methyltransferase [Leuconostoc citreum] gi|27552370|emb|CAD38156.1| putative C5-methyltransferase [Leuconostoc citreum] Length = 403 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query: 1 MKACDFGVPQRRERLYIID--FLNPSVEF----KFPTPLGIKPRLG 40 + A D+GVPQ RER++++ +F KFP P + L Sbjct: 217 VNARDYGVPQSRERVFLVGTNIKKVKQKFDWKYKFPNPTHGEKLLP 262 >gi|284054848|ref|ZP_06385058.1| DNA-cytosine methyltransferase [Arthrospira platensis str. Paraca] Length = 220 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 21/104 (20%), Positives = 40/104 (38%), Gaps = 24/104 (23%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEH-----IDDKSTI 53 + A ++GVPQ+RERL+++ + + +P L I GD + + I K + Sbjct: 77 INAVNYGVPQKRERLFVVAY---QTAWNWPEAETLAIPYTAGDAIYDTASTIPIGAKF-L 132 Query: 54 SNKLWEGHQKRKENNKIAGKGFGYGLFFENSAT----TNTLSAR 93 + + E + + +K TL+ R Sbjct: 133 TPSMLEYIGRYEAKSKC---------VKPRDIYLDIPCRTLTCR 167 >gi|227485932|ref|ZP_03916248.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus lactolyticus ATCC 51172] gi|227235977|gb|EEI85992.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus lactolyticus ATCC 51172] Length = 358 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 19/93 (20%), Positives = 30/93 (32%), Gaps = 29/93 (31%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR---------------------- 38 + + + GVPQ RER YI N + P K Sbjct: 148 INSVESGVPQNRERTYICGIYNFENDKYLPDSRNFKVNKLKEKLNKSNFNGFNFFNSLIF 207 Query: 39 ------LGDILEEHIDDKSTI-SNKLWEGHQKR 64 + DI+++ +D K + + KL E Sbjct: 208 DSKQIYIEDIIDKSVDTKYYLDNPKLNEYINNY 240 >gi|225375779|ref|ZP_03753000.1| hypothetical protein ROSEINA2194_01411 [Roseburia inulinivorans DSM 16841] gi|225212376|gb|EEG94730.1| hypothetical protein ROSEINA2194_01411 [Roseburia inulinivorans DSM 16841] Length = 431 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTP 32 + + DFGVPQ R+R+YI+ F P P Sbjct: 150 LNSKDFGVPQARKRVYIVGYFDFRCAGKVLPEP 182 >gi|46019864|emb|CAE52388.1| putative cytosine-specific methyltransferase [Streptococcus thermophilus] gi|312279225|gb|ADQ63882.1| Cytosine-specific methyltransferase [Streptococcus thermophilus ND03] Length = 515 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-LGIKPRLGDIL 43 + + +FGVPQ+R R+ + + N ++P P + + + D L Sbjct: 182 LNSANFGVPQQRNRVVFLAYRNDVNPLEYPEPNVLPEVTVRDAL 225 >gi|313677760|ref|YP_004055756.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] gi|312944458|gb|ADR23648.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] Length = 346 Score = 46.4 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 9/64 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI------KPRLGDILEEHIDD--KST 52 + A DF VPQ R R + + L S+EF+FP P+ + + D+ ++ ++D + T Sbjct: 152 LLASDFAVPQNRRRAFFVG-LKNSLEFEFPKPITTDNKITSEEAISDLPKDSLEDGCQYT 210 Query: 53 ISNK 56 I+ K Sbjct: 211 INPK 214 >gi|295395397|ref|ZP_06805596.1| modification methylase NaeI [Brevibacterium mcbrellneri ATCC 49030] gi|294971719|gb|EFG47595.1| modification methylase NaeI [Brevibacterium mcbrellneri ATCC 49030] Length = 355 Score = 46.1 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTP-LGIKPRLGDILEEH 46 + DFGVPQ R R ++ + +F+FP+ ++ +G IL++ Sbjct: 147 SADFGVPQLRPRAVLVALKDGEADFEFPSGDTSLRVPVGPILKDE 191 >gi|262283394|ref|ZP_06061160.1| cytosine-specific methyltransferase NlaX [Streptococcus sp. 2_1_36FAA] gi|262260885|gb|EEY79585.1| cytosine-specific methyltransferase NlaX [Streptococcus sp. 2_1_36FAA] Length = 460 Score = 46.1 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + + FGVPQ R+R++++ Sbjct: 147 LNSSHFGVPQNRQRIFLVG 165 >gi|237737311|ref|ZP_04567792.1| DNA-cytosine methyltransferase [Fusobacterium mortiferum ATCC 9817] gi|229421173|gb|EEO36220.1| DNA-cytosine methyltransferase [Fusobacterium mortiferum ATCC 9817] Length = 407 Score = 46.1 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A DFGVPQ R+R+ II + N + FK+P IK Sbjct: 194 LDAKDFGVPQSRKRVIIIGWKNE-LNFKYPNFETIK 228 >gi|22538008|ref|NP_688859.1| prophage LambdaSa2, type II DNA modification methyltransferase [Streptococcus agalactiae 2603V/R] gi|22534910|gb|AAN00732.1|AE014276_13 prophage LambdaSa2, type II DNA modification methyltransferase, putative [Streptococcus agalactiae 2603V/R] Length = 437 Score = 46.1 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 10/18 (55%), Positives = 14/18 (77%) Query: 2 KACDFGVPQRRERLYIID 19 + +FGVPQ RER++II Sbjct: 148 NSKNFGVPQNRERVFIIG 165 >gi|295104578|emb|CBL02122.1| DNA-methyltransferase (dcm) [Faecalibacterium prausnitzii SL3/3] Length = 293 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 24/53 (45%), Gaps = 6/53 (11%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP-----RLGDILEEHIDDK 50 A D+GVPQ RER+ + EF P P P L D LE H DK Sbjct: 143 AEDYGVPQTRERVIFVGTRKTLPEFVPPKPSVFAPITAYEALHD-LENHPQDK 194 >gi|50949214|emb|CAF31654.1| putative C5-methyltransferase [Cloning vector pGID052] Length = 307 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query: 1 MKACDFGVPQRRERLYIID--FLNPSVEF----KFPTPLGIKPRLG 40 + A D+GVPQ RER++++ +F KFP P + L Sbjct: 217 VNARDYGVPQSRERVFLVGTNIKKVKQKFDWKYKFPNPTHGEKLLP 262 >gi|255520393|ref|ZP_05387630.1| C-5 cytosine-specific DNA methylase [Listeria monocytogenes FSL J1-175] Length = 451 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDK 50 + ++GVPQ RER++II L + + FP + + ++ D K Sbjct: 149 NSKNYGVPQNRERVFIIGHLRGAGGREIFPLGGENRTFNKNDIKAINDSK 198 >gi|1171048|sp|P25263|MTC1_HERAU RecName: Full=Modification methylase HgiCI; Short=M.HgiCI; AltName: Full=Cytosine-specific methyltransferase HgiCI gi|515372|emb|CAA38933.1| methyltransferase [Herpetosiphon aurantiacus] Length = 420 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 20/94 (21%), Positives = 30/94 (31%), Gaps = 21/94 (22%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK--------------------PRLG 40 + + +F VPQ R R+YI+ E + +G + Sbjct: 145 LNSSNFQVPQNRLRVYIVGLDQSQPELTITSHIGATDSHKFKQLSNQASLFDTNKIMLVR 204 Query: 41 DILEEHIDDKSTISNKLWEGHQKRKENNKIAGKG 74 DILE+H DK S + I G Sbjct: 205 DILEDHPLDKYNCSTDFVNKLLA-FIGHPIKLNG 237 >gi|296329951|ref|ZP_06872435.1| DNA (cytosine-5-)-methyltransferase [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305676676|ref|YP_003868348.1| DNA (cytosine-5-)-methyltransferase [Bacillus subtilis subsp. spizizenii str. W23] gi|296152990|gb|EFG93855.1| DNA (cytosine-5-)-methyltransferase [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305414920|gb|ADM40039.1| DNA (cytosine-5-)-methyltransferase [Bacillus subtilis subsp. spizizenii str. W23] Length = 488 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A DFGVPQ R R++II Sbjct: 183 LNAADFGVPQHRRRIFIIA 201 >gi|262171500|ref|ZP_06039178.1| modification methylase PspPI (Cytosine-specific methyltransferase PspPI) (M.PspPI) [Vibrio mimicus MB-451] gi|261892576|gb|EEY38562.1| modification methylase PspPI (Cytosine-specific methyltransferase PspPI) (M.PspPI) [Vibrio mimicus MB-451] Length = 416 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGD 41 +KA F VPQ+RERL ++ SVEF +P+P L D Sbjct: 222 LKAIFFKVPQKRERLILVGIRKDLANSVEFHWPSPYKKIMTLRD 265 >gi|284052085|ref|ZP_06382295.1| DNA-cytosine methyltransferase [Arthrospira platensis str. Paraca] Length = 382 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 9/62 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A ++G+PQRRER++I+ E+ FP LE + + S W Sbjct: 174 LDAENYGIPQRRERVFIVGVREDWQREWSFPQESHS-------LESLLWSQYV-SFDYWN 225 Query: 60 GH 61 H Sbjct: 226 NH 227 >gi|261415336|ref|YP_003249019.1| DNA-cytosine methyltransferase [Fibrobacter succinogenes subsp. succinogenes S85] gi|261371792|gb|ACX74537.1| DNA-cytosine methyltransferase [Fibrobacter succinogenes subsp. succinogenes S85] gi|302326638|gb|ADL25839.1| cytosine specific DNA methyltransferase [Fibrobacter succinogenes subsp. succinogenes S85] Length = 418 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 19/77 (24%), Positives = 32/77 (41%), Gaps = 13/77 (16%) Query: 2 KACDFGVPQRRERLYIIDFLN------------PSVEFKFPTPLGIKPRLGDILEEHIDD 49 A ++G PQ+RER+ II + + F P + L D L+E++ + Sbjct: 191 NAANYGAPQKRERIVIICSRDGSKAPYLTPTHSETGLFNLPKWRTVSEVLND-LDENVQE 249 Query: 50 KSTISNKLWEGHQKRKE 66 S S K + + K Sbjct: 250 YSKFSEKRLKFFRMLKA 266 >gi|153854028|ref|ZP_01995361.1| hypothetical protein DORLON_01352 [Dorea longicatena DSM 13814] gi|149753410|gb|EDM63341.1| hypothetical protein DORLON_01352 [Dorea longicatena DSM 13814] Length = 468 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTP 32 + + DFGVPQ R+R+YI+ F P P Sbjct: 187 LNSKDFGVPQARKRVYIVGYFDFRCAGKVLPEP 219 >gi|291566149|dbj|BAI88421.1| type II DNA modification methyltransferase [Arthrospira platensis NIES-39] Length = 379 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 9/62 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A ++G+PQRRER++I+ E+ FP LE + + S W Sbjct: 171 LDAENYGIPQRRERVFIVGVREDWQREWSFPQESHS-------LESLLWSQYV-SFDYWN 222 Query: 60 GH 61 H Sbjct: 223 NH 224 >gi|326559503|gb|EGE09926.1| DNA-cytosine methyltransferase [Moraxella catarrhalis 7169] Length = 354 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 22/82 (26%), Positives = 33/82 (40%), Gaps = 9/82 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A +GV Q R R+ I+ + K+P PL + L D + I K I + LWE Sbjct: 179 LNASHYGVAQNRVRVIIVGIRKDIDKKMKYPKPLFGE--LSDSQKPVITSKQAI-DDLWE 235 Query: 60 GHQK----RKENNKIAGKGFGY 77 +N+ K F Sbjct: 236 LLDDNINSHSKNHYSKAK-FYP 256 >gi|326567273|gb|EGE17393.1| DNA-cytosine methyltransferase [Moraxella catarrhalis 12P80B1] gi|326568220|gb|EGE18302.1| DNA-cytosine methyltransferase [Moraxella catarrhalis BC8] Length = 354 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 22/82 (26%), Positives = 33/82 (40%), Gaps = 9/82 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A +GV Q R R+ I+ + K+P PL + L D + I K I + LWE Sbjct: 179 LNASHYGVAQNRVRVIIVGIRKDIDKKMKYPKPLFGE--LSDSQKPVITSKQAI-DDLWE 235 Query: 60 GHQK----RKENNKIAGKGFGY 77 +N+ K F Sbjct: 236 LLDDNINSHSKNHYSKAK-FYP 256 >gi|288799842|ref|ZP_06405301.1| modification methylase BepI (Cytosine-specific methyltransferase BepI) [Prevotella sp. oral taxon 299 str. F0039] gi|288333090|gb|EFC71569.1| modification methylase BepI (Cytosine-specific methyltransferase BepI) [Prevotella sp. oral taxon 299 str. F0039] Length = 406 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 15/68 (22%), Positives = 27/68 (39%), Gaps = 9/68 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI---------LEEHIDDKS 51 + A +GVPQ RER+ I F ++ + L ++ +E I D Sbjct: 195 LHAGRYGVPQNRERIIFIGFRKDALTEEALEMLKESVPFDEVSPYPAPTHYIESDIVDLY 254 Query: 52 TISNKLWE 59 ++ L + Sbjct: 255 YETSSLLK 262 >gi|33322745|gb|AAQ07107.1|AF496419_1 cytosine-specific DNA methyltransferase [Lactobacillus delbrueckii subsp. lactis] Length = 138 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 14/26 (53%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A +FGVPQ RERL I + Sbjct: 106 LNARNFGVPQNRERLIYIGIRKDIAD 131 >gi|7243959|gb|AAB21481.2| cytosine DNA methyltransferase homolog [Neisseria gonorrhoeae] Length = 347 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37 +FGVPQ RER+ I+ + +F+ P P + Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 196 >gi|18700048|gb|AAL03949.1| DNA methyltransferase Bse634IM [Geobacillus stearothermophilus] Length = 387 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 9/44 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---------FKFPTPLGI 35 + A +FG+PQ R R++II F N +E F++PTP+ Sbjct: 172 LNALEFGIPQDRARVFIIGFKNSIIETLQENYMDAFQWPTPIYP 215 >gi|330882498|gb|EGH16647.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea str. race 4] Length = 335 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDILEE 45 + A D+GV Q R R+ + + F +P P L P +G +L + Sbjct: 162 LNASDYGVSQLRPRVVFVGIQKKYADKFHWPEPGLVQPPTVGQLLHD 208 >gi|116627564|ref|YP_820183.1| site-specific DNA methylase [Streptococcus thermophilus LMD-9] gi|116100841|gb|ABJ65987.1| Site-specific DNA methylase [Streptococcus thermophilus LMD-9] Length = 406 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI-LEEHIDD 49 + A ++GVPQ RER+ II ++ FP P P ++ L + D Sbjct: 147 LNAAEYGVPQARERVIIIG-NRIGIDNPFPKPTHKIPDENELDLFPELPD 195 >gi|91215328|ref|ZP_01252299.1| modification methylase (Eco47II, Sau96I) [Psychroflexus torquis ATCC 700755] gi|91186280|gb|EAS72652.1| modification methylase (Eco47II, Sau96I) [Psychroflexus torquis ATCC 700755] Length = 412 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45 +KA ++ VPQ+RERL ++ +E+ +P+P L D L++ Sbjct: 221 LKAINYNVPQKRERLILVGVRKDIDLEYVYPSPYEKVYNLSDALKK 266 >gi|302876802|ref|YP_003845435.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] gi|307687485|ref|ZP_07629931.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] gi|302579659|gb|ADL53671.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] Length = 363 Score = 46.1 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 20/31 (64%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31 + A D+G+PQ R+R++ + N EF+FP Sbjct: 155 LYAPDYGIPQIRKRVFFVGLRNSDTEFEFPE 185 >gi|170680813|ref|YP_001746263.1| DNA-cytosine methyltransferase family protein [Escherichia coli SMS-3-5] gi|307315390|ref|ZP_07594959.1| DNA-cytosine methyltransferase [Escherichia coli W] gi|33413740|gb|AAN28260.1| Mth [Enterobacteria phage WPhi] gi|170518531|gb|ACB16709.1| DNA-cytosine methyltransferase family protein [Escherichia coli SMS-3-5] gi|306905264|gb|EFN35809.1| DNA-cytosine methyltransferase [Escherichia coli W] gi|315063217|gb|ADT77544.1| DNA cytosine methylase [Escherichia coli W] gi|323380718|gb|ADX52986.1| DNA-cytosine methyltransferase [Escherichia coli KO11] Length = 312 Score = 45.7 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34 + A +GV Q R+R++I+ + +KFP P Sbjct: 141 LNASHYGVSQDRKRIFIVGIRKDYGITYKFPKPTH 175 >gi|261364680|ref|ZP_05977563.1| modification methylase Eco47II [Neisseria mucosa ATCC 25996] gi|288566964|gb|EFC88524.1| modification methylase Eco47II [Neisseria mucosa ATCC 25996] Length = 419 Score = 45.7 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDIL 43 +KA + VPQ+RERL++I VEF +P+P L D L Sbjct: 220 LKAVFYKVPQKRERLFLIGIRKDLADKVEFHWPSPYHRILTLQDAL 265 >gi|325965496|ref|YP_004243400.1| DNA-methyltransferase Dcm [Arthrobacter phenanthrenivorans Sphe3] gi|323471583|gb|ADX75266.1| DNA-methyltransferase Dcm [Arthrobacter phenanthrenivorans Sphe3] Length = 389 Score = 45.7 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 8/51 (15%) Query: 5 DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 ++GVPQRR+R+ I+ +F+ P+P DI + KS ++ Sbjct: 183 EYGVPQRRQRIVIVGIREDLQTDFRVPSPE----IYNDI---DVSAKSALT 226 >gi|315169253|gb|EFU13270.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX1341] Length = 521 Score = 45.7 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 20/41 (48%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + A FGVPQ+R R+ + + N V +P + + D Sbjct: 182 LNAAHFGVPQQRNRVVFLAYRNDVVPVTYPVINNDRTTVYD 222 >gi|309389435|gb|ADO77315.1| DNA-cytosine methyltransferase [Halanaerobium praevalens DSM 2228] Length = 328 Score = 45.7 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 ++ D+G+PQRR+R+ I+ F+FP + D +++ Sbjct: 152 LQTSDYGIPQRRKRIIIVG--TKDYTFEFPKKNNSVITVKDAIDD 194 >gi|332359910|gb|EGJ37724.1| C-5 cytosine-specific DNA methylase superfamily protein [Streptococcus sanguinis SK1056] Length = 516 Score = 45.7 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 8/65 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP------RLGDIL--EEHIDDKST 52 + A +FGVPQ+R R+ + + N ++P P LGD+ E + + Sbjct: 182 LNAANFGVPQQRNRVVFLAYRNDVAPLQYPESDNDIPNATVYDALGDLYGGEFSYETDYS 241 Query: 53 ISNKL 57 + ++L Sbjct: 242 LQSRL 246 >gi|326789360|ref|YP_004307181.1| DNA-cytosine methyltransferase [Clostridium lentocellum DSM 5427] gi|326540124|gb|ADZ81983.1| DNA-cytosine methyltransferase [Clostridium lentocellum DSM 5427] Length = 446 Score = 45.7 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHID 48 + A D+GVPQ RER+++I N +V ++ P IL + + Sbjct: 165 LNAADYGVPQIRERVFVIAIKKNENVRYELPKA-----TYASILSDRVS 208 >gi|15901190|ref|NP_345794.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus pneumoniae TIGR4] gi|14972819|gb|AAK75434.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus pneumoniae TIGR4] Length = 407 Score = 45.7 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 19/85 (22%), Positives = 29/85 (34%), Gaps = 16/85 (18%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50 + + DFGVP+ RER++II FP + + L + K Sbjct: 149 LNSKDFGVPKNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKALGNLNPSRSGMSGK 208 Query: 51 STISNKLWEGHQKRKENNKIAGKGF 75 S L + G+GF Sbjct: 209 VYYSEGLAPTLVR------GKGEGF 227 >gi|111656823|ref|ZP_01407675.1| hypothetical protein SpneT_02001911 [Streptococcus pneumoniae TIGR4] gi|148994722|ref|ZP_01823806.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus pneumoniae SP9-BS68] gi|148999034|ref|ZP_01826467.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus pneumoniae SP11-BS70] gi|307067986|ref|YP_003876952.1| site-specific DNA methylase [Streptococcus pneumoniae AP200] gi|147755157|gb|EDK62211.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus pneumoniae SP11-BS70] gi|147927053|gb|EDK78094.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus pneumoniae SP9-BS68] gi|306409523|gb|ADM84950.1| Site-specific DNA methylase [Streptococcus pneumoniae AP200] gi|332074668|gb|EGI85142.1| modification methylase HpaII [Streptococcus pneumoniae GA17545] gi|332200781|gb|EGJ14853.1| modification methylase HpaII [Streptococcus pneumoniae GA41317] gi|332201799|gb|EGJ15869.1| modification methylase HpaII [Streptococcus pneumoniae GA47368] Length = 392 Score = 45.7 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 19/85 (22%), Positives = 29/85 (34%), Gaps = 16/85 (18%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50 + + DFGVP+ RER++II FP + + L + K Sbjct: 134 LNSKDFGVPKNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKALGNLNPSRSGMSGK 193 Query: 51 STISNKLWEGHQKRKENNKIAGKGF 75 S L + G+GF Sbjct: 194 VYYSEGLAPTLVR------GKGEGF 212 >gi|307354298|ref|YP_003895349.1| DNA-cytosine methyltransferase [Methanoplanus petrolearius DSM 11571] gi|307157531|gb|ADN36911.1| DNA-cytosine methyltransferase [Methanoplanus petrolearius DSM 11571] Length = 421 Score = 45.7 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP 30 + A DFGV Q R+R+ I + +F++P Sbjct: 202 LNARDFGVLQNRKRIIFIGWKKEH-DFEYP 230 >gi|268686152|ref|ZP_06153014.1| modification methylase NgoFVII [Neisseria gonorrhoeae SK-93-1035] gi|268626436|gb|EEZ58836.1| modification methylase NgoFVII [Neisseria gonorrhoeae SK-93-1035] Length = 374 Score = 45.3 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37 +FGVPQ RER+ I+ + +F+ P P + Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 196 >gi|11386930|sp|Q59606|MTF7_NEIGO RecName: Full=Modification methylase NgoFVII; Short=M.NgoFVII; AltName: Full=Cytosine-specific methyltransferase NgoFVII; Short=M.NgoVII gi|1165245|gb|AAA86270.1| M.NgoVII [Neisseria gonorrhoeae] Length = 374 Score = 45.3 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37 +FGVPQ RER+ I+ + +F+ P P + Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 196 >gi|238923038|ref|YP_002936551.1| DcmB [Eubacterium rectale ATCC 33656] gi|238874710|gb|ACR74417.1| DcmB [Eubacterium rectale ATCC 33656] Length = 672 Score = 45.3 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 11/60 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV + R+R++ I F +++F FP G E+ D K T+ + +W+ Sbjct: 148 VNAKDYGVAEERKRVFYIGFRKDLNIDFGFPK--------GSTKED--DKKITLRDIIWD 197 >gi|254416815|ref|ZP_05030564.1| DNA-cytosine methyltransferase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196176361|gb|EDX71376.1| DNA-cytosine methyltransferase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 391 Score = 45.3 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 14/74 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEF----------KFPTPLGIKPRLGDILEEHIDD 49 ++A D+GVPQ RER+ I + SV F P ++ L +++E++ + Sbjct: 187 LQAADYGVPQNRERVVFIGSRDSESVTFPLATHCQSGRDLPKWRTLRDALTNLVEQNPE- 245 Query: 50 KST-ISNKLWEGHQ 62 T S K + + Sbjct: 246 -FTPYSEKRLKYLR 258 >gi|319787787|ref|YP_004147262.1| DNA-cytosine methyltransferase [Pseudoxanthomonas suwonensis 11-1] gi|317466299|gb|ADV28031.1| DNA-cytosine methyltransferase [Pseudoxanthomonas suwonensis 11-1] Length = 425 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 24/65 (36%), Gaps = 15/65 (23%) Query: 3 ACDFGVPQRRERLYIIDFLNP--------------SVEFKFPTP-LGIKPRLGDILEEHI 47 A D+GVPQ R R+ ++ N P P G P L D+L + I Sbjct: 186 AKDYGVPQNRPRVLLVGVRNDVGSGLKREGKDEDAIARGYLPAPAPGSAPDLVDLLGDLI 245 Query: 48 DDKST 52 D Sbjct: 246 DPDYV 250 >gi|294635767|ref|ZP_06714227.1| C-5 cytosine-specific DNA methylase family protein [Edwardsiella tarda ATCC 23685] gi|291090867|gb|EFE23428.1| C-5 cytosine-specific DNA methylase family protein [Edwardsiella tarda ATCC 23685] Length = 403 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGD 41 + A D+GVPQ R+R +I+ + F++P P + G Sbjct: 160 LNARDYGVPQSRKRAFILAVRKDICTDGFEWP-PKATHTKSGS 201 >gi|59800809|ref|YP_207521.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae FA 1090] gi|254493277|ref|ZP_05106448.1| modification methylase NgoFVII [Neisseria gonorrhoeae 1291] gi|260440968|ref|ZP_05794784.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae DGI2] gi|268594414|ref|ZP_06128581.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae 35/02] gi|268596411|ref|ZP_06130578.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae FA19] gi|268598542|ref|ZP_06132709.1| modification methylase NgoFVII [Neisseria gonorrhoeae MS11] gi|268600894|ref|ZP_06135061.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID18] gi|268681681|ref|ZP_06148543.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID332] gi|268683908|ref|ZP_06150770.1| modification methylase NgoFVII [Neisseria gonorrhoeae SK-92-679] gi|291044296|ref|ZP_06570005.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae DGI2] gi|293399487|ref|ZP_06643640.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|59717704|gb|AAW89109.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae FA 1090] gi|226512317|gb|EEH61662.1| modification methylase NgoFVII [Neisseria gonorrhoeae 1291] gi|268547803|gb|EEZ43221.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae 35/02] gi|268550199|gb|EEZ45218.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae FA19] gi|268582673|gb|EEZ47349.1| modification methylase NgoFVII [Neisseria gonorrhoeae MS11] gi|268585025|gb|EEZ49701.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID18] gi|268621965|gb|EEZ54365.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID332] gi|268624192|gb|EEZ56592.1| modification methylase NgoFVII [Neisseria gonorrhoeae SK-92-679] gi|291011190|gb|EFE03186.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae DGI2] gi|291610056|gb|EFF39178.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] Length = 374 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37 +FGVPQ RER+ I+ + +F+ P P + Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 196 >gi|170754579|ref|YP_001781640.1| DNA-cytosine methyltransferase [Clostridium botulinum B1 str. Okra] gi|169119791|gb|ACA43627.1| DNA-cytosine methyltransferase [Clostridium botulinum B1 str. Okra] Length = 444 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIK 36 A D+GVPQ RER++++ + F +P + Sbjct: 187 ASDYGVPQNRERVFLVAINEKYGDNKFIYPEKTHGE 222 >gi|237753192|ref|ZP_04583672.1| cytosine specific DNA methyltransferase [Helicobacter winghamensis ATCC BAA-430] gi|229375459|gb|EEO25550.1| cytosine specific DNA methyltransferase [Helicobacter winghamensis ATCC BAA-430] Length = 354 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + A DF VPQ RER + I + FP P ++ + D + + Sbjct: 156 LNAKDFCVPQNRERAFFIA--HKKEYLGFPAPSEMQVCVKDAISD 198 >gi|113474395|ref|YP_720456.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101] gi|110165443|gb|ABG49983.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101] Length = 421 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A ++GVPQ RERL+I+ Sbjct: 155 LNAANYGVPQHRERLFILG 173 >gi|116620819|ref|YP_822975.1| DNA-cytosine methyltransferase [Candidatus Solibacter usitatus Ellin6076] gi|116223981|gb|ABJ82690.1| DNA-cytosine methyltransferase [Candidatus Solibacter usitatus Ellin6076] Length = 419 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A D GVPQ RER++I+ ++ Sbjct: 195 LNALDLGVPQDRERVFIVGVHRRMIK 220 >gi|319776343|ref|YP_004138831.1| Modification methylase HaeIII [Haemophilus influenzae F3047] gi|127460|sp|P20589|MTH3_HAEAE RecName: Full=Modification methylase HaeIII; Short=M.HaeIII; AltName: Full=Cytosine-specific methyltransferase HaeIII gi|148915|gb|AAA24970.1| methyltransferase [Haemophilus aegyptius] gi|2961233|gb|AAC05696.1| HaeIII DNA modification methyltransferase [Haemophilus influenzae biotype aegyptius] gi|317450934|emb|CBY87160.1| Modification methylase HaeIII [Haemophilus influenzae F3047] Length = 330 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 12/74 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R+R++ I F ++ + P P IKP D++ + + + Sbjct: 142 LNANDYGVAQDRKRVFYIGFRKELNINYLPPIPHLIKPTFKDVIWD-------LKDNPIP 194 Query: 60 GHQKRKENNKIAGK 73 + NK G Sbjct: 195 AL----DKNKTNGN 204 >gi|319897026|ref|YP_004135221.1| modification methylase haeiii [Haemophilus influenzae F3031] gi|317432530|emb|CBY80890.1| Modification methylase HaeIII [Haemophilus influenzae F3031] Length = 330 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 12/74 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R+R++ I F ++ + P P IKP D++ + + + Sbjct: 142 LNANDYGVAQDRKRVFYIGFRKELNINYLPPIPHLIKPTFKDVIWD-------LKDNPIP 194 Query: 60 GHQKRKENNKIAGK 73 + NK G Sbjct: 195 AL----DKNKTNGN 204 >gi|147668731|ref|YP_001213549.1| DNA-cytosine methyltransferase [Dehalococcoides sp. BAV1] gi|146269679|gb|ABQ16671.1| DNA-cytosine methyltransferase [Dehalococcoides sp. BAV1] Length = 335 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGD 41 + A D+ VPQ R+R+ I+ + + F P P+ KP L D Sbjct: 143 LNAHDYSVPQDRKRVIIVGYHVKTELYFTPPKPIAHKPLLRD 184 >gi|255279956|ref|ZP_05344511.1| modification methylase AgeI [Bryantella formatexigens DSM 14469] gi|255269729|gb|EET62934.1| modification methylase AgeI [Bryantella formatexigens DSM 14469] Length = 475 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 12/18 (66%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Query: 1 MKACDFGVPQRRER-LYI 17 + A DFGVPQ RER +YI Sbjct: 247 LNAKDFGVPQNRERLIYI 264 >gi|240127759|ref|ZP_04740420.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae SK-93-1035] Length = 347 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37 +FGVPQ RER+ I+ + +F+ P P + Sbjct: 133 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 169 >gi|329123495|ref|ZP_08252059.1| modification methylase HaeIII [Haemophilus aegyptius ATCC 11116] gi|327471077|gb|EGF16532.1| modification methylase HaeIII [Haemophilus aegyptius ATCC 11116] Length = 217 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 12/74 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R+R++ I F ++ + P P IKP D++ + + + Sbjct: 29 LNANDYGVAQDRKRVFYIGFRKELNINYLPPIPHLIKPTFKDVIWD-------LKDNPIP 81 Query: 60 GHQKRKENNKIAGK 73 + NK G Sbjct: 82 AL----DKNKTNGN 91 >gi|303237411|ref|ZP_07323977.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN] gi|302482361|gb|EFL45390.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN] Length = 383 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGD 41 ++A + VPQ+RER+ ++ N P V F +P P L D Sbjct: 188 LEAIRYQVPQKRERIVLVAIRNDIAPKVTFHWPAPYYRLMTLND 231 >gi|194098099|ref|YP_002001147.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae NCCP11945] gi|239998556|ref|ZP_04718480.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae 35/02] gi|240013681|ref|ZP_04720594.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae DGI18] gi|240016120|ref|ZP_04722660.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae FA6140] gi|240080261|ref|ZP_04724804.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae FA19] gi|240112474|ref|ZP_04726964.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae MS11] gi|240115214|ref|ZP_04729276.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae PID18] gi|240120750|ref|ZP_04733712.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae PID24-1] gi|240123054|ref|ZP_04736010.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae PID332] gi|240125307|ref|ZP_04738193.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae SK-92-679] gi|193933389|gb|ACF29213.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae NCCP11945] gi|317163831|gb|ADV07372.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae TCDC-NG08107] Length = 347 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37 +FGVPQ RER+ I+ + +F+ P P + Sbjct: 133 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 169 >gi|332665024|ref|YP_004447812.1| DNA-cytosine methyltransferase [Haliscomenobacter hydrossis DSM 1100] gi|332333838|gb|AEE50939.1| DNA-cytosine methyltransferase [Haliscomenobacter hydrossis DSM 1100] Length = 366 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 9/46 (19%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH 46 + A DF VPQ RER++ I F N S I P L +LE + Sbjct: 144 LNATDFDVPQARERVFFIGFKNNS---------QIIPDLTKMLEPY 180 >gi|269978372|gb|ACZ55920.1| putative type I restriction-modification system specificity subunit S [Helicobacter pylori] Length = 263 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 12/19 (63%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 +KA D+GVPQ RER+ II Sbjct: 152 LKASDYGVPQHRERVIIIG 170 >gi|1127162|pdb|1DCT|A Chain A, Dna (Cytosine-5) Methylase From Haeiii Covalently Bound To Dna gi|1127163|pdb|1DCT|B Chain B, Dna (Cytosine-5) Methylase From Haeiii Covalently Bound To Dna Length = 324 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 12/74 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R+R++ I F ++ + P P IKP D++ + + + Sbjct: 142 LNANDYGVAQDRKRVFYIGFRKELNINYLPPIPHLIKPTFKDVIWD-------LKDNPIP 194 Query: 60 GHQKRKENNKIAGK 73 + NK G Sbjct: 195 AL----DKNKTNGN 204 >gi|270293678|ref|ZP_06199880.1| cytosine-specific methyltransferase [Bacteroides sp. D20] gi|270275145|gb|EFA21005.1| cytosine-specific methyltransferase [Bacteroides sp. D20] Length = 361 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + A ++GVPQRR R++++ N ++F+FP P K + + Sbjct: 152 LWADEYGVPQRRMRMFMVG-NNQGIDFEFPKPFDYKVSVEE 191 >gi|229490017|ref|ZP_04383870.1| modification methylase DdeI [Rhodococcus erythropolis SK121] gi|229323118|gb|EEN88886.1| modification methylase DdeI [Rhodococcus erythropolis SK121] Length = 431 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLG 34 + A D+GVPQ RER++I+ S +FP Sbjct: 241 VNAQDYGVPQFRERVFIVATRRDSGIGPLRFPPKTH 276 >gi|226307434|ref|YP_002767394.1| modification methylase [Rhodococcus erythropolis PR4] gi|226186551|dbj|BAH34655.1| putative modification methylase [Rhodococcus erythropolis PR4] Length = 444 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLG 34 + A D+GVPQ RER++I+ S +FP Sbjct: 254 VNAQDYGVPQFRERVFIVATRRDSSIGPLRFPPKTH 289 >gi|58580230|ref|YP_199246.1| modification methylase XorII [Xanthomonas oryzae pv. oryzae KACC10331] gi|58424824|gb|AAW73861.1| Modification methylase XorII [Xanthomonas oryzae pv. oryzae KACC10331] Length = 442 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ R RL ++ +P P G + +GD + + D +S +LWE Sbjct: 173 LNAADYGVPQDRRRLILMGARKGLPLPAYPEPTG-RTTVGDAIGDIPDAESF--PELWE 228 >gi|458402|gb|AAA50432.1| M-XorII [Xanthomonas oryzae] Length = 424 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ R RL ++ +P P G + +GD + + D +S +LWE Sbjct: 155 LNAADYGVPQDRRRLILMGARKGLPLPAYPEPTG-RTTVGDAIGDIPDAESF--PELWE 210 >gi|62297515|sp|P52311|MTX2_XANOR RecName: Full=Modification methylase XorII; Short=M.XorII; AltName: Full=Cytosine-specific methyltransferase XorII Length = 424 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ R RL ++ +P P G + +GD + + D +S +LWE Sbjct: 155 LNAADYGVPQDRRRLILMGARKGLPLPAYPEPTG-RTTVGDAIGDIPDAESF--PELWE 210 >gi|60202518|gb|AAX14650.1| BbvCI methyltransferase 1 [Brevibacillus brevis] Length = 429 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGI--KPRLGDILEEHIDDKSTISNKL 57 + A +FGVPQ RERL I + F +P P + + EE + + ++ L Sbjct: 170 LNAANFGVPQFRERLIIAAVCKSEANNFFWPEPTHELGNSNITSLFEELMPTQPPLT--L 227 Query: 58 WE 59 WE Sbjct: 228 WE 229 >gi|291530602|emb|CBK96187.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3] Length = 369 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + + FGVPQ+R RLYI+ +L+P FP L ++ + ++ Sbjct: 147 LNSKYFGVPQQRRRLYIVGYLDPRCAGKVFPLSGCNAKNLKQLIPGPQGQRVYETD 202 >gi|124262880|ref|YP_001023350.1| C-5 cytosine-specific DNA methylase [Methylibium petroleiphilum PM1] gi|124262126|gb|ABM97115.1| C-5 cytosine-specific DNA methylase [Methylibium petroleiphilum PM1] Length = 473 Score = 45.3 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 19/88 (21%), Positives = 38/88 (43%), Gaps = 6/88 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP---RLGDILEEHIDDKSTISNKL 57 + + ++ V + RERL ++ +EF F +P RLG+I++E D S Sbjct: 288 VNSAEWNVLEHRERLCVVAVTKG-IEFSFDGLERPEPVSRRLGEIMDEVPVDAPCWSEM- 345 Query: 58 WEGHQKRKENNKIAGKGFGYGLFFENSA 85 + ++ ++ G F + +S Sbjct: 346 -AYLKDKRARDEAKGNNFKMTVLTPDSE 372 >gi|332710686|ref|ZP_08430629.1| DNA-methyltransferase [Lyngbya majuscula 3L] gi|332350562|gb|EGJ30159.1| DNA-methyltransferase [Lyngbya majuscula 3L] Length = 450 Score = 44.9 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/76 (22%), Positives = 28/76 (36%), Gaps = 13/76 (17%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP-------------TPLGIKPRLGDILEEHI 47 + A DFGVPQ+R RL+++ +P + P L D E Sbjct: 179 LNAADFGVPQKRRRLFLLGSRLGEAPVAYPSSELSSHQWVTVKDAIADLPNLDDFPELQK 238 Query: 48 DDKSTISNKLWEGHQK 63 D ++ + + Q Sbjct: 239 SDCVELTPEQLDLLQA 254 >gi|330936955|gb|EGH41063.1| HsdRM [Pseudomonas syringae pv. pisi str. 1704B] Length = 313 Score = 44.9 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/74 (20%), Positives = 29/74 (39%), Gaps = 12/74 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG----------IKPRLGDILEEHIDD 49 + A +FGV Q R+R++I+ +++ FP I +GD+ E + Sbjct: 141 LNAAEFGVAQERKRIFIVGIRKDFGIKYVFPEATHGDEKAHAGVTIHDAIGDMPEWPAGE 200 Query: 50 KSTISNKLWEGHQK 63 + W + Sbjct: 201 FYDL-PFHWYYLSR 213 >gi|293371778|ref|ZP_06618188.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f] gi|292633230|gb|EFF51801.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f] Length = 337 Score = 44.9 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGD 41 + A D+ VP+ R+R++ I F F++PTP KP L + Sbjct: 144 LNANDYDVPEDRDRVFYIGFRKDLNIHNFEYPTPQKHKPTLRE 186 >gi|322514130|ref|ZP_08067198.1| modification methylase NgoPII [Actinobacillus ureae ATCC 25976] gi|322120016|gb|EFX92002.1| modification methylase NgoPII [Actinobacillus ureae ATCC 25976] Length = 356 Score = 44.9 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 11/60 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R+R++ I + ++F+FP +G +++ D K ++ + +W+ Sbjct: 144 VNAKDYGVAQERKRVFYIGYRKDLGIDFEFP--------VGSTIDD--DKKISLKDIIWD 193 >gi|228469860|ref|ZP_04054799.1| modification methylase HaeIII [Porphyromonas uenonis 60-3] gi|228308495|gb|EEK17283.1| modification methylase HaeIII [Porphyromonas uenonis 60-3] Length = 359 Score = 44.9 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGD 41 + A D+ VP+ R+R++ I F EF+FP P+ + L D Sbjct: 146 LNAYDYEVPEDRKRVFYIGFRKDLDIKEFEFPVPIPKRLTLRD 188 >gi|224418258|ref|ZP_03656264.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter canadensis MIT 98-5491] gi|253827583|ref|ZP_04870468.1| putative methylase [Helicobacter canadensis MIT 98-5491] gi|313141791|ref|ZP_07803984.1| cytosine-specific DNA methyltransferase [Helicobacter canadensis MIT 98-5491] gi|253510989|gb|EES89648.1| putative methylase [Helicobacter canadensis MIT 98-5491] gi|313130822|gb|EFR48439.1| cytosine-specific DNA methyltransferase [Helicobacter canadensis MIT 98-5491] Length = 589 Score = 44.9 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + A +GVPQ RER++ I + FP + D + + Sbjct: 152 LNAKHYGVPQNRERVFFIA--HKERLLSFPKESNCLVSVKDAISD 194 >gi|262192113|ref|ZP_06050275.1| DNA-cytosine methyltransferase [Vibrio cholerae CT 5369-93] gi|262032024|gb|EEY50600.1| DNA-cytosine methyltransferase [Vibrio cholerae CT 5369-93] Length = 393 Score = 44.9 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 18/80 (22%), Positives = 30/80 (37%), Gaps = 16/80 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLN----PSVEFKFPTPL------GIKP---RLGDILEEHI 47 + A D+GVPQ R+R++I S P P G P + E+ Sbjct: 164 VNAKDYGVPQNRKRVFIYGLRQDLDTDSNHVFPPEPTHFSATSGKHPHWVTASSVFEKIP 223 Query: 48 DDKSTISNKLWEGHQKRKEN 67 + ++ W+ + K K Sbjct: 224 KELY---DQYWDKYFKIKTK 240 >gi|326566077|gb|EGE16234.1| DNA-cytosine methyltransferase [Moraxella catarrhalis BC1] Length = 354 Score = 44.9 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 4/59 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF-KFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 + A +GV Q R R+ I+ + K+P PL + L D + I K I + LW Sbjct: 179 LNASHYGVAQNRVRVIIVGIRKDIDKKMKYPKPLFGE--LSDSKKPVITSKQAI-DDLW 234 >gi|209525887|ref|ZP_03274422.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] gi|209493696|gb|EDZ94016.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] Length = 406 Score = 44.9 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG-DILEEHIDDKSTISNK 56 D+GVPQ RER+ I+ F F + P G D L ++ K + + Sbjct: 160 NFADYGVPQYRERVLIVGVR-MDTGFNF---IHPSPEYGSDRLYPYLTAKQALKDV 211 >gi|186684463|ref|YP_001867659.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102] gi|14594706|gb|AAK68641.1| cytosine-specific DNA methyltransferase [Nostoc punctiforme PCC 73102] gi|186466915|gb|ACC82716.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102] Length = 413 Score = 44.9 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 18/26 (69%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A ++GVPQ RER+ +I F N ++ Sbjct: 172 INAIEYGVPQDRERIILIGFRNNFIK 197 >gi|308184574|ref|YP_003928707.1| site-specific DNA methylase [Helicobacter pylori SJM180] gi|308060494|gb|ADO02390.1| site-specific DNA methylase [Helicobacter pylori SJM180] Length = 405 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 12/19 (63%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 +KA D+GVPQ RER+ II Sbjct: 148 LKASDYGVPQHRERVIIIG 166 >gi|163761361|ref|ZP_02168435.1| C-5 cytosine-specific DNA methylase family protein [Hoeflea phototrophica DFL-43] gi|162281356|gb|EDQ31653.1| C-5 cytosine-specific DNA methylase family protein [Hoeflea phototrophica DFL-43] Length = 376 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPT 31 + A D+G PQRR+R++I+ + F++P Sbjct: 160 LDARDYGTPQRRQRVFILGIRRDVSTDGFEWPP 192 >gi|288801979|ref|ZP_06407420.1| modification methylase HaeIII (Cytosine-specific methyltransferase HaeIII) [Prevotella melaninogenica D18] gi|288335414|gb|EFC73848.1| modification methylase HaeIII (Cytosine-specific methyltransferase HaeIII) [Prevotella melaninogenica D18] Length = 336 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGD 41 + A DF VP+ R R++ I F ++++P P KP L + Sbjct: 144 LNANDFDVPEDRNRVFYIGFRKDLHINDYEYPLPQKHKPTLRE 186 >gi|239982029|ref|ZP_04704553.1| DNA modification methylase [Streptomyces albus J1074] gi|291453880|ref|ZP_06593270.1| C-5 cytosine-specific DNA methylase [Streptomyces albus J1074] gi|291356829|gb|EFE83731.1| C-5 cytosine-specific DNA methylase [Streptomyces albus J1074] Length = 409 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEE 45 + A D+GVPQ R R ++ F +P P + + LEE Sbjct: 183 LHAQDYGVPQLRPRAILVAIRKDQYRGFDWPAPRKKLRTVAEALEE 228 >gi|46580156|ref|YP_010964.1| C-5 cytosine-specific DNA methylase family protein [Desulfovibrio vulgaris str. Hildenborough] gi|46449573|gb|AAS96223.1| C-5 cytosine-specific DNA methylase family protein [Desulfovibrio vulgaris str. Hildenborough] gi|311233853|gb|ADP86707.1| DNA-cytosine methyltransferase [Desulfovibrio vulgaris RCH1] Length = 369 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A D+GVPQ R+R++I+ Sbjct: 168 LNARDYGVPQNRKRVFILG 186 >gi|283956744|ref|ZP_06374220.1| hypothetical protein C1336_000290019 [Campylobacter jejuni subsp. jejuni 1336] gi|283791719|gb|EFC30512.1| hypothetical protein C1336_000290019 [Campylobacter jejuni subsp. jejuni 1336] Length = 330 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 8/45 (17%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + D+ + Q R R++I+ + + F FP + + ++++ Sbjct: 155 LNTKDYSIAQNRSRIFIVGTIKKN-SFIFPKKENSQISIKKVIDD 198 >gi|227503804|ref|ZP_03933853.1| DNA restriction-modification system, DNA methylase [Corynebacterium striatum ATCC 6940] gi|227199628|gb|EEI79676.1| DNA restriction-modification system, DNA methylase [Corynebacterium striatum ATCC 6940] Length = 455 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDIL 43 ++A D+GVPQ R R ++ N F +P + +G L Sbjct: 264 LQAADYGVPQLRPRFILVALKNEFANYFAWPKVVKSHTPVGTAL 307 >gi|212694208|ref|ZP_03302336.1| hypothetical protein BACDOR_03734 [Bacteroides dorei DSM 17855] gi|212663274|gb|EEB23848.1| hypothetical protein BACDOR_03734 [Bacteroides dorei DSM 17855] Length = 370 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS 24 + A D+ VPQ RER++++ Sbjct: 155 LNATDYNVPQARERIFVVGIRGDE 178 >gi|320009547|gb|ADW04397.1| DNA-cytosine methyltransferase [Streptomyces flavogriseus ATCC 33331] Length = 431 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVE-FKFPTPL-GIKPRLGDIL 43 A DFGVPQ R R ++ F +P PL G +P++G+ L Sbjct: 154 AADFGVPQLRPRFVLVALQREYAPYFSWPKPLEGERPKVGETL 196 >gi|200388503|ref|ZP_03215115.1| modification methylase HaeIII [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|199605601|gb|EDZ04146.1| modification methylase HaeIII [Salmonella enterica subsp. enterica serovar Virchow str. SL491] Length = 361 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIK 36 + A +GVPQ R+RL+II N + F+FP K Sbjct: 152 VNARAYGVPQSRKRLFIIGVRNDLGQCFEFPAETHGK 188 >gi|240117500|ref|ZP_04731562.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae PID1] gi|268603200|ref|ZP_06137367.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID1] gi|268587331|gb|EEZ52007.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID1] Length = 374 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37 +FGVPQ RER+ I+ + +F+ P P + Sbjct: 160 NFTEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 196 >gi|187923153|ref|YP_001894795.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN] gi|187714347|gb|ACD15571.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN] Length = 317 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDI 42 M A DFGV Q R+R+ I+ VE+ FP + D+ Sbjct: 144 MNAQDFGVAQERKRIIIVGIRKDLGVEYAFPYATHGEHGEKDL 186 >gi|289167785|ref|YP_003446054.1| site-specific DNA methylase [Streptococcus mitis B6] gi|288907352|emb|CBJ22189.1| site-specific DNA methylase [Streptococcus mitis B6] Length = 351 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ R+R+ + N EF++P LG Sbjct: 152 LLASDYGVPQNRKRVIFVGTRND--EFEYPEALGT 184 >gi|312873586|ref|ZP_07733633.1| modification methylase BanI [Lactobacillus iners LEAF 2052A-d] gi|311090839|gb|EFQ49236.1| modification methylase BanI [Lactobacillus iners LEAF 2052A-d] Length = 487 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 18/78 (23%), Positives = 31/78 (39%), Gaps = 7/78 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST-ISNKLWE 59 + + DF + Q R R+YII + V+ K L DI++ ++ T + KL Sbjct: 216 LNSKDFNLAQSRNRIYIIGLRSGKVK-KLEGFEKKTSVLKDIIDSRVEAHKTDFTKKLLS 274 Query: 60 G-----HQKRKENNKIAG 72 + +K G Sbjct: 275 HYSVDELYGKAIKDKRGG 292 >gi|168821212|ref|ZP_02833212.1| modification methylase HaeIII [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|205342142|gb|EDZ28906.1| modification methylase HaeIII [Salmonella enterica subsp. enterica serovar Weltevreden str. HI_N05-537] gi|320088731|emb|CBY98489.1| C-5 cytosine-specific DNA methylase family protein [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] Length = 361 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 + A +GVPQ R+RL+II N F+FP K Sbjct: 152 VNARAYGVPQSRKRLFIIGVRNDLGQSFEFPAETHGK 188 >gi|269129048|ref|YP_003302418.1| DNA-cytosine methyltransferase [Thermomonospora curvata DSM 43183] gi|268314006|gb|ACZ00381.1| DNA-cytosine methyltransferase [Thermomonospora curvata DSM 43183] Length = 418 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPR-LGDILEEHIDDK 50 ++A D+GV Q R R ++ F +P P +P+ +GD+L + + + Sbjct: 148 LQASDYGVSQLRPRFVLVAMRPEDFSYFHWPEPGKKQPKTVGDLLHDQMASR 199 >gi|120537007|ref|YP_957065.1| C-5 cytosine-specific DNA methylase [Marinobacter aquaeolei VT8] gi|120326841|gb|ABM21150.1| C-5 cytosine-specific DNA methylase [Marinobacter aquaeolei VT8] Length = 467 Score = 44.9 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 23/102 (22%), Positives = 41/102 (40%), Gaps = 12/102 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPR---LGDILEE--HIDDKST 52 + CDFG + R+R +I + F ++ + L D+LE DD+ T Sbjct: 276 LNGCDFGALENRDRAVVIAMSRDLAKAGMFNLADIKPLRVKEEKLADVLEPISEDDDRWT 335 Query: 53 ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARY 94 I +++ + G GF L+ + NT++ Y Sbjct: 336 IH----TYLEEKALRDAKKGSGFQRQLYTGEESYINTVTRGY 373 >gi|126659133|ref|ZP_01730272.1| site-specific DNA-methyltransferase M.NgoVII [Cyanothece sp. CCY0110] gi|126619540|gb|EAZ90270.1| site-specific DNA-methyltransferase M.NgoVII [Cyanothece sp. CCY0110] Length = 346 Score = 44.5 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 27/70 (38%), Gaps = 13/70 (18%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61 D+GVPQ RER+ II + FK+ P D+ S + +G Sbjct: 134 NFADYGVPQLRERVLIIGIRKD-INFKYRKPFPTHK----------PDEYVTSEEALQGV 182 Query: 62 QK--RKENNK 69 +K ++ Sbjct: 183 KKIPYNNEHQ 192 >gi|240047747|ref|YP_002961135.1| Cytosine-specific methyltransferase [Mycoplasma conjunctivae HRC/581] gi|239985319|emb|CAT05332.1| Cytosine-specific methyltransferase [Mycoplasma conjunctivae] Length = 211 Score = 44.5 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKLWE 59 + + DFG Q R+R++++ +L +F++P + L IL+ H+ ++ +++K+++ Sbjct: 35 LNSADFGSSQNRQRVFMVSWLTNK-KFEWPATIKHNNNLKKILDLTHLPNEENLASKIFK 93 Query: 60 G 60 Sbjct: 94 Y 94 >gi|209525305|ref|ZP_03273847.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] gi|209494320|gb|EDZ94633.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] Length = 342 Score = 44.5 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 20/104 (19%), Positives = 40/104 (38%), Gaps = 24/104 (23%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEH-----IDDKSTI 53 + A ++GVPQ+RERL+++ + + +P L + GD + + I K + Sbjct: 162 INAVNYGVPQKRERLFVVAY---QTAWHWPEAETLAMPYTAGDAIYDTASTIPIGAKF-L 217 Query: 54 SNKLWEGHQKRKENNKIAGKGFGYGLFFENSAT----TNTLSAR 93 + + E + + +K TL+ R Sbjct: 218 TPSMLEYIGRYEAKSKC---------VKPREIYLDIPCRTLTCR 252 >gi|218441171|ref|YP_002379500.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424] gi|218173899|gb|ACK72632.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424] Length = 415 Score = 44.5 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 20/38 (52%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 + A ++GVPQ R+RL+++ K+P + K Sbjct: 161 LNAANYGVPQNRKRLFLLGGKKNLPPLKYPEAISDKKT 198 >gi|269986305|gb|EEZ92611.1| DNA-cytosine methyltransferase [Candidatus Parvarchaeum acidiphilum ARMAN-4] Length = 349 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 A ++GVPQ R+R+ I+ + + F F P Sbjct: 145 DARNYGVPQERKRVIIVGYRKD-IGFSFLPPEPTH 178 >gi|254225219|ref|ZP_04918832.1| C-5 cytosine-specific DNA methylase superfamily [Vibrio cholerae V51] gi|125622318|gb|EAZ50639.1| C-5 cytosine-specific DNA methylase superfamily [Vibrio cholerae V51] Length = 303 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 18/80 (22%), Positives = 30/80 (37%), Gaps = 16/80 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLN----PSVEFKFPTPL------GIKP---RLGDILEEHI 47 + A D+GVPQ R+R++I S P P G P + E+ Sbjct: 74 VNAKDYGVPQNRKRVFIYGLRQDLDTDSNHVFPPEPTHFSATSGKHPHWVTASSVFEKIP 133 Query: 48 DDKSTISNKLWEGHQKRKEN 67 + ++ W+ + K K Sbjct: 134 KELY---DQYWDKYFKIKTK 150 >gi|188581100|ref|YP_001924545.1| DNA-cytosine methyltransferase [Methylobacterium populi BJ001] gi|179344598|gb|ACB80010.1| DNA-cytosine methyltransferase [Methylobacterium populi BJ001] Length = 446 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 5/38 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 + A DFGVPQ RERL ++ P P+ P Sbjct: 156 LDAADFGVPQHRERLILLGARRG-----LPLPVYPLPT 188 >gi|75906326|ref|YP_320622.1| C-5 cytosine-specific DNA methylase [Anabaena variabilis ATCC 29413] gi|75700051|gb|ABA19727.1| C-5 cytosine-specific DNA methylase [Anabaena variabilis ATCC 29413] Length = 431 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 19/36 (52%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A +GVPQ RERL++I K+P P+ Sbjct: 168 LNAAHYGVPQARERLFLIGAREDVKLPKYPKPITKP 203 >gi|149373126|ref|ZP_01892014.1| DcmB [unidentified eubacterium SCB49] gi|149354274|gb|EDM42843.1| DcmB [unidentified eubacterium SCB49] Length = 349 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49 + A D+ VPQ R+R++ I + FK+ P P++ LE+ I D Sbjct: 145 LNASDYNVPQDRKRVFFIGIRKD-LNFKYQFPTETFPKIP--LEDVISD 190 >gi|298504551|gb|ADI83274.1| DNA cytosine methyltransferase [Geobacter sulfurreducens KN400] Length = 428 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 4/66 (6%) Query: 1 MKACDFGVPQRRERLYIID--FLNPSVEFKFPTPLGIKPRLGDI-LEEHIDDKSTISNKL 57 + A D+GVPQ R R +II F NP+ F P KP G D T + + Sbjct: 178 LCAADYGVPQIRWRAFIIGCSFTNPAAVFP-PKKTNFKPNNGYRKAFSEEFDSYTENPHI 236 Query: 58 WEGHQK 63 W+ + Sbjct: 237 WKTVRD 242 >gi|17229768|ref|NP_486316.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120] gi|17131367|dbj|BAB73975.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120] Length = 431 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 19/36 (52%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A +GVPQ RERL++I K+P P+ Sbjct: 168 LNAAHYGVPQARERLFLIGAREDVKLPKYPKPITKP 203 >gi|78776322|ref|YP_392637.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM 1251] gi|78496862|gb|ABB43402.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM 1251] Length = 395 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A D+GVPQ RER++ I + Sbjct: 197 LNAADYGVPQSRERVFFIGIRRDLIN 222 >gi|210614083|ref|ZP_03290039.1| hypothetical protein CLONEX_02252 [Clostridium nexile DSM 1787] gi|210150861|gb|EEA81869.1| hypothetical protein CLONEX_02252 [Clostridium nexile DSM 1787] Length = 244 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 11/23 (47%), Positives = 18/23 (78%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + + DFGVPQ R+R+Y+I +L+ Sbjct: 140 LNSKDFGVPQSRKRVYLIGYLDE 162 >gi|302551692|ref|ZP_07304034.1| modification methylase NaeI [Streptomyces viridochromogenes DSM 40736] gi|302469310|gb|EFL32403.1| modification methylase NaeI [Streptomyces viridochromogenes DSM 40736] Length = 415 Score = 44.5 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A ++GVPQ R R ++ + + F +P +G L++ + K + + W Sbjct: 144 LHANNYGVPQLRPRFVLVAMRHEDAQWFNWPEEKPTTQTVGTALQDMMAAKGWLGAEAWA 203 >gi|315639354|ref|ZP_07894516.1| DNA (cytosine-5-)-methyltransferase [Campylobacter upsaliensis JV21] gi|315480680|gb|EFU71322.1| DNA (cytosine-5-)-methyltransferase [Campylobacter upsaliensis JV21] Length = 320 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR 38 + A + VPQ R+R+ II E +FP PL I+P+ Sbjct: 147 LNANAYAVPQNRKRVIIIGRRKDIKREVEFPKPLNIEPK 185 >gi|325270471|ref|ZP_08137073.1| modification methylase DdeI [Prevotella multiformis DSM 16608] gi|324987194|gb|EGC19175.1| modification methylase DdeI [Prevotella multiformis DSM 16608] Length = 398 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP-----RLGDILEEHIDD 49 + A D+GVPQ R R + L+ + EF FP+P P + D+ E+ + + Sbjct: 202 LLASDYGVPQNRRRAIFVGMLDGT-EFVFPSPTLETPVTCKEAISDLPEDSLPE 254 >gi|298492225|ref|YP_003722402.1| DNA-cytosine methyltransferase ['Nostoc azollae' 0708] gi|298234143|gb|ADI65279.1| DNA-cytosine methyltransferase ['Nostoc azollae' 0708] Length = 434 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A ++GVPQ RERL+++ + K P Sbjct: 157 LNAANYGVPQNRERLFLLGCRQ---DLKLPNHPDK 188 >gi|77465763|ref|YP_355266.1| cytosine-specific DNA methylase [Rhodobacter sphaeroides 2.4.1] gi|77390181|gb|ABA81365.1| Cytosine-specific DNA methylase [Rhodobacter sphaeroides 2.4.1] Length = 443 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + A D+G PQ R+RL++I P + D Sbjct: 154 LDAADYGTPQHRQRLFLIGAKRGE---TLPEIPPPQTNAAD 191 >gi|310830454|ref|YP_003965555.1| Cytosine-specific methyltransferase [Paenibacillus polymyxa SC2] gi|309249921|gb|ADO59487.1| Cytosine-specific methyltransferase [Paenibacillus polymyxa SC2] Length = 267 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR 38 + D+GVPQ R+R+ ++ F+FP P+ ++ R Sbjct: 23 LNCWDYGVPQLRKRVIVVGIRKDLDKHFEFPPPVPLEER 61 >gi|195873685|ref|ZP_02698511.2| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|195632788|gb|EDX51242.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica serovar Newport str. SL317] Length = 382 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31 + + D+G+PQ RERL+++ F F F Sbjct: 163 LNSLDYGIPQDRERLFVVGFKK---SFIFDK 190 >gi|144900416|emb|CAM77280.1| modification methylase MthTI [Magnetospirillum gryphiswaldense MSR-1] Length = 356 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 11/23 (47%), Positives = 15/23 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + AC +GVPQ RER +II + Sbjct: 161 LNACHYGVPQSRERAFIIGYRRD 183 >gi|40850587|gb|AAR96017.1| M2.BsaI [Geobacillus stearothermophilus] Length = 381 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---GIKPRLGDILEEHIDDKSTISN 55 + + D+GVPQRR R+ II + + P P+ + L D L I K +S+ Sbjct: 278 LNSVDYGVPQRRNRVVIIGDSTGTKNSEPPIPITSLKGEKTLFDALSSAISVKEALSD 335 >gi|238751088|ref|ZP_04612584.1| Modification methylase FnuDI [Yersinia rohdei ATCC 43380] gi|238710778|gb|EEQ03000.1| Modification methylase FnuDI [Yersinia rohdei ATCC 43380] Length = 362 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFP 30 + A ++GVPQ R+RL+II + F+FP Sbjct: 152 VNAKEYGVPQSRKRLFIIGVRKDLDQYFEFP 182 >gi|218441855|ref|YP_002380184.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424] gi|218174583|gb|ACK73316.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424] Length = 342 Score = 44.1 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 17/75 (22%), Positives = 30/75 (40%), Gaps = 7/75 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNK 56 + A + PQ RER++II +F FP L LGD+ ++ Sbjct: 167 LNASWYETPQNRERVFIIG---HRGKFTFPCRLSNSITAGEALGDLAISIPPGAKFLTES 223 Query: 57 LWEGHQKRKENNKIA 71 + + K ++ +K Sbjct: 224 MNQYVAKYEKASKCK 238 >gi|311977245|gb|ADQ20501.1| M2.BfuAI [Lysinibacillus fusiformis] Length = 342 Score = 44.1 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + D+GVPQ RER++II E FP P + Sbjct: 156 LNMADYGVPQLRERVFIIG-NRLGHEVNFPLPTHSE 190 >gi|226349837|ref|YP_002776950.1| modification methylase [Rhodococcus opacus B4] gi|226245752|dbj|BAH47019.1| modification methylase [Rhodococcus opacus B4] Length = 428 Score = 44.1 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 12/46 (26%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEE 45 ++A D+GVPQ R R ++ F +P + +G L++ Sbjct: 158 LQASDYGVPQLRPRFVLVALRQEDAAYFHWPEKTPTQDTVGSALKD 203 >gi|167009507|ref|ZP_02274438.1| modification methylase HaeIII [Francisella tularensis subsp. holarctica FSC200] Length = 111 Score = 44.1 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGD 41 + + DF VPQ R+R++ + F F T K L D Sbjct: 29 LNSSDFKVPQDRQRVFFVGIRKDLGFNFNFSTNTYPKITLKD 70 >gi|75906954|ref|YP_321250.1| C-5 cytosine-specific DNA methylase [Anabaena variabilis ATCC 29413] gi|75700679|gb|ABA20355.1| C-5 cytosine-specific DNA methylase [Anabaena variabilis ATCC 29413] Length = 385 Score = 44.1 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A ++GVPQ RER+ ++ F + F +L + L +K++ Sbjct: 172 INAIEYGVPQNRERIILLGFSKKFFQ-DFWGINSHNQKLLEFLFPWESKVLYPKDKVFAY 230 >gi|148988375|ref|ZP_01819822.1| cytosine specific DNA methyltransferase [Streptococcus pneumoniae SP6-BS73] gi|147926056|gb|EDK77130.1| cytosine specific DNA methyltransferase [Streptococcus pneumoniae SP6-BS73] Length = 351 Score = 44.1 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A D+GVPQ R+R+ + N F++P LG Sbjct: 152 LLASDYGVPQNRKRVIFVGTRND--GFEYPEALGT 184 >gi|308229532|gb|ADO24181.1| M.ApaI [Acetobacter pasteurianus subsp. pasteurianus] Length = 349 Score = 44.1 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPL-GIKPRLGDILEEHIDDK 50 A D+GVPQ+R RL I+ + F FP P G + + + DK Sbjct: 145 AADYGVPQKRRRLIIVGMKKGT--FWFPKPTHGPDTNIPHVASGRVIDK 191 >gi|255280633|ref|ZP_05345188.1| modification methylase DdeI [Bryantella formatexigens DSM 14469] gi|255269098|gb|EET62303.1| modification methylase DdeI [Bryantella formatexigens DSM 14469] Length = 378 Score = 44.1 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 17/36 (47%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A D+GVPQ R R +I + FP P K Sbjct: 151 VNAADYGVPQARPRFVLIGIRGFDKKITFPQPTHGK 186 >gi|119511510|ref|ZP_01630619.1| type II DNA modification enzyme (methyltransferase) [Nodularia spumigena CCY9414] gi|119463821|gb|EAW44749.1| type II DNA modification enzyme (methyltransferase) [Nodularia spumigena CCY9414] Length = 371 Score = 44.1 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 30/71 (42%), Gaps = 11/71 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG--IKPRLGDILEEH-----IDDKSTI 53 + A +GVPQ+RERL+ + +++P G+ L + + K + Sbjct: 162 LNAAHYGVPQKRERLFCVA---HKGSWQWPEKTHFYSPYTAGEALGKSAYLAPPNSK-IL 217 Query: 54 SNKLWEGHQKR 64 + + E +K Sbjct: 218 TPSMDEYIKKY 228 >gi|262283530|ref|ZP_06061296.1| cytosine-specific methyltransferase NlaX [Streptococcus sp. 2_1_36FAA] gi|262261021|gb|EEY79721.1| cytosine-specific methyltransferase NlaX [Streptococcus sp. 2_1_36FAA] Length = 411 Score = 44.1 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + + FGVPQ R+R++++ Sbjct: 147 LNSSHFGVPQNRQRVFLVG 165 >gi|256397638|ref|YP_003119202.1| DNA-cytosine methyltransferase [Catenulispora acidiphila DSM 44928] gi|256363864|gb|ACU77361.1| DNA-cytosine methyltransferase [Catenulispora acidiphila DSM 44928] Length = 389 Score = 44.1 bits (104), Expect = 0.007, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 + A FGVPQ+RERL ++ V+ ++P P Sbjct: 157 LNAAHFGVPQKRERLILLG-AQQGVKLRWPRPTH 189 >gi|17232307|ref|NP_488855.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120] gi|17133952|dbj|BAB76514.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120] Length = 414 Score = 43.7 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A ++G+PQ RER++I+ Sbjct: 159 LNAAEYGIPQIRERIFIVG 177 >gi|332366902|gb|EGJ44643.1| modification methylase BepI [Streptococcus sanguinis SK1059] Length = 197 Score = 43.7 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK---FPTP--LGIKPRLGDILEE 45 + A D+GVPQ R R+ I+ N + + +P P +G D LE+ Sbjct: 16 LDAADYGVPQSRRRVIIVGIRNDIGDNEKIYYPEPTHVGNPRTAFDALED 65 >gi|283783021|ref|YP_003373775.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis 409-05] gi|283441534|gb|ADB14000.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis 409-05] Length = 357 Score = 43.7 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + A DFGVPQ R+R II +N P+ L K + D + + Sbjct: 150 LNAADFGVPQNRKRAVIIGKMNGVAP-SLPSSLNEKVTIWDAISD 193 >gi|160931938|ref|ZP_02079330.1| hypothetical protein CLOLEP_00771 [Clostridium leptum DSM 753] gi|156868980|gb|EDO62352.1| hypothetical protein CLOLEP_00771 [Clostridium leptum DSM 753] Length = 379 Score = 43.7 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 11/23 (47%), Positives = 18/23 (78%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + + DFGVPQ R+R+Y+I +L+ Sbjct: 150 LNSKDFGVPQSRKRVYLIGYLDK 172 >gi|325678040|ref|ZP_08157677.1| putative modification methylase BspRI [Ruminococcus albus 8] gi|324110257|gb|EGC04436.1| putative modification methylase BspRI [Ruminococcus albus 8] Length = 358 Score = 43.7 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLG 34 + ACD+GVPQ R+R++ + + +F FPTP Sbjct: 150 LTACDYGVPQARKRVFFVGVNKSKIKHTEKFVFPTPTH 187 >gi|154497795|ref|ZP_02036173.1| hypothetical protein BACCAP_01773 [Bacteroides capillosus ATCC 29799] gi|150273293|gb|EDN00438.1| hypothetical protein BACCAP_01773 [Bacteroides capillosus ATCC 29799] Length = 222 Score = 43.7 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDIL 43 + + FGVPQ R+R+++I +L+P P P G L +L Sbjct: 141 LNSKHFGVPQSRKRVFLICYLDPRCAGKILPVPGGHGKALVQLL 184 >gi|57506146|ref|ZP_00372067.1| cytosine specific DNA methyltransferase (DDEM) [Campylobacter upsaliensis RM3195] gi|57015541|gb|EAL52334.1| cytosine specific DNA methyltransferase (DDEM) [Campylobacter upsaliensis RM3195] Length = 316 Score = 43.7 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRL 39 + A + VPQ R+R+ II E FP PL I+P++ Sbjct: 143 LNANAYAVPQNRKRVIIIGRRKDIKREIDFPKPLNIEPKI 182 >gi|254285523|ref|ZP_04960487.1| modification methylase Eco47II [Vibrio cholerae AM-19226] gi|150424385|gb|EDN16322.1| modification methylase Eco47II [Vibrio cholerae AM-19226] Length = 417 Score = 43.7 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGD 41 +KA + VPQ+RERL ++ V+F +P+P L D Sbjct: 222 LKAIFYKVPQKRERLILVGIRKDLAQKVKFHWPSPYKRVMTLRD 265 >gi|168207074|ref|ZP_02633079.1| Dcm [Clostridium perfringens E str. JGS1987] gi|170661488|gb|EDT14171.1| Dcm [Clostridium perfringens E str. JGS1987] Length = 339 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 RER++I+ + F+F L I E +D+K + + Sbjct: 159 RERVFIVSIRKDIDNGSFEFKEGNDNIVTLESITESFVDEKYYCKDN--SYLKN 210 >gi|294788934|ref|ZP_06754174.1| modification methylase HphIA [Simonsiella muelleri ATCC 29453] gi|294483036|gb|EFG30723.1| modification methylase HphIA [Simonsiella muelleri ATCC 29453] Length = 328 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31 + A DFGVPQ+R R+ I + + FP Sbjct: 153 LNAVDFGVPQQRSRIVFIG-RRDNGKILFPK 182 >gi|158320926|ref|YP_001513433.1| DNA-cytosine methyltransferase [Alkaliphilus oremlandii OhILAs] gi|158141125|gb|ABW19437.1| DNA-cytosine methyltransferase [Alkaliphilus oremlandii OhILAs] Length = 423 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 10/72 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEE-------HIDDKS 51 M A DFGV Q R+R+ II + +EF +P + + ++LE+ I DK Sbjct: 205 MDAKDFGVLQSRKRVIIIGWRKD-LEFDYPIFESDDKEFTVNNLLEDLPKINSGEIYDKF 263 Query: 52 TISNKLWEGHQK 63 K+ + Q Sbjct: 264 RYRKKINKYLQN 275 >gi|319638577|ref|ZP_07993339.1| modification methylase NgoFVII [Neisseria mucosa C102] gi|317400326|gb|EFV80985.1| modification methylase NgoFVII [Neisseria mucosa C102] Length = 374 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37 +FGVPQ RER+ I+ + +F P P + Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFHHPEPTHNET 196 >gi|291299135|ref|YP_003510413.1| DNA-cytosine methyltransferase [Stackebrandtia nassauensis DSM 44728] gi|290568355|gb|ADD41320.1| DNA-cytosine methyltransferase [Stackebrandtia nassauensis DSM 44728] Length = 437 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 11/23 (47%), Positives = 16/23 (69%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A DFGVPQ R+R+ I+ F + Sbjct: 199 VNAADFGVPQIRQRVIIVAFRSD 221 >gi|298253558|ref|ZP_06977348.1| site-specific DNA methylase [Gardnerella vaginalis 5-1] gi|297532325|gb|EFH71213.1| site-specific DNA methylase [Gardnerella vaginalis 5-1] Length = 317 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + A DFGVPQ R+R II +N P+ L K + D + + Sbjct: 110 LNAADFGVPQNRKRAVIIGKMNGVAP-SLPSSLNEKVTIWDAISD 153 >gi|294787738|ref|ZP_06752982.1| modification methylase NgoPII [Simonsiella muelleri ATCC 29453] gi|294484031|gb|EFG31714.1| modification methylase NgoPII [Simonsiella muelleri ATCC 29453] Length = 331 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPT 31 + A ++GV Q R+R++ I F +++F+FP Sbjct: 144 VNAKNYGVAQERKRVFYIGFRKDLNIKFQFPQ 175 >gi|160939240|ref|ZP_02086591.1| hypothetical protein CLOBOL_04134 [Clostridium bolteae ATCC BAA-613] gi|158438203|gb|EDP15963.1| hypothetical protein CLOBOL_04134 [Clostridium bolteae ATCC BAA-613] Length = 366 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDIL 43 + + D+GVPQ RER+YII S FP K I+ Sbjct: 148 VNSKDYGVPQSRERVYIIGDLTGRSTGKIFPLRSPGKTAPAQII 191 >gi|225076231|ref|ZP_03719430.1| hypothetical protein NEIFLAOT_01268 [Neisseria flavescens NRL30031/H210] gi|224952355|gb|EEG33564.1| hypothetical protein NEIFLAOT_01268 [Neisseria flavescens NRL30031/H210] Length = 374 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37 +FGVPQ RER+ I+ + +F P P + Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFHHPEPTHNET 196 >gi|77412067|ref|ZP_00788393.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae CJB111] gi|77161872|gb|EAO72857.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae CJB111] Length = 394 Score = 43.7 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 2 KACDFGVPQRRERLYIID 19 + D+GVPQ RER+Y + Sbjct: 128 NSKDYGVPQNRERIYTLG 145 >gi|229126345|ref|ZP_04255362.1| Cytosine-specific methyltransferase [Bacillus cereus BDRD-Cer4] gi|228657116|gb|EEL12937.1| Cytosine-specific methyltransferase [Bacillus cereus BDRD-Cer4] Length = 363 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL 33 +KA D+GVPQ+R R+ + F V +KFP P Sbjct: 153 LKASDYGVPQQRYRVIFVAFRKDLDVNYKFPLPT 186 >gi|168210881|ref|ZP_02636506.1| Dcm [Clostridium perfringens B str. ATCC 3626] gi|209947599|ref|YP_002291106.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens] gi|170711042|gb|EDT23224.1| Dcm [Clostridium perfringens B str. ATCC 3626] gi|209910390|dbj|BAG75479.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens] Length = 339 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKR--KE 66 RER++I+ + F+F L I E +D+K + + + K Sbjct: 159 RERVFIVSIRKDIDNGSFEFKEGNDNLVTLESITESFVDEKYYCKDNSYLKSFLNKVNKR 218 Query: 67 NNKIA 71 K Sbjct: 219 ICKDK 223 >gi|167046802|ref|YP_001661472.1| DNA methyltransferase [Acinetobacter venetianus] gi|83833711|gb|ABC47668.1| DNA methyltransferase [Acinetobacter venetianus] Length = 737 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 18/27 (66%) Query: 6 FGVPQRRERLYIIDFLNPSVEFKFPTP 32 +GVPQ+RER++++ +F FP P Sbjct: 160 YGVPQKRERVFLMGTRLQHKKFNFPKP 186 Score = 33.7 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 21/63 (33%), Gaps = 18/63 (28%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A D+GVPQ R+R +I + P P K + W+ Sbjct: 528 INAADYGVPQLRKRFLLIG---TKTDLVIPFPK---------------PKYFSTPDSWQL 569 Query: 61 HQK 63 + Sbjct: 570 PYR 572 >gi|76788592|ref|YP_329366.1| prophage LambdaSa04, methyltransferase C-5 [Streptococcus agalactiae A909] gi|76563649|gb|ABA46233.1| prophage LambdaSa04, methyltransferase, C-5 cytosine-specific family [Streptococcus agalactiae A909] Length = 417 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 2 KACDFGVPQRRERLYIID 19 + D+GVPQ RER+Y + Sbjct: 151 NSKDYGVPQNRERIYTLG 168 >gi|30019096|ref|NP_830727.1| Type II restriction-modification system methylation subunit [Bacillus cereus ATCC 14579] gi|29894639|gb|AAP07928.1| Type II restriction-modification system methylation subunit [Bacillus cereus ATCC 14579] Length = 373 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL 33 +KA D+GVPQ+R R+ + F V +KFP P Sbjct: 163 LKASDYGVPQQRYRVIFVAFRKDLDVNYKFPLPT 196 >gi|229060735|ref|ZP_04198090.1| Modification methylase Eco47II [Bacillus cereus AH603] gi|228718382|gb|EEL70014.1| Modification methylase Eco47II [Bacillus cereus AH603] Length = 198 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG--IKPR--LGDILEEH 46 + A F V Q R+R++I+ N +V F FPT + + PR +GD+ Sbjct: 35 LDAVMFEVAQHRKRVFIVGVRNDMNVSFNFPTGISAVVTPRDAIGDLPSPD 85 >gi|313575370|emb|CBR26899.1| hypothetical protein [Streptococcus phage phi-SsUD.1] Length = 419 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 2 KACDFGVPQRRERLYIID 19 + D+GVPQ RER+Y + Sbjct: 151 NSKDYGVPQNRERIYTLG 168 >gi|227112465|ref|ZP_03826121.1| putative C-5 cytosine-specific DNA methylase [Pectobacterium carotovorum subsp. brasiliensis PBR1692] Length = 390 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIK 36 + A D+GVPQ R+R++I + KFP Sbjct: 164 INAVDYGVPQNRKRVFIFGIHEDLNNSTIKFPPKPTHH 201 >gi|323703857|ref|ZP_08115492.1| DNA-cytosine methyltransferase [Desulfotomaculum nigrificans DSM 574] gi|323531175|gb|EGB21079.1| DNA-cytosine methyltransferase [Desulfotomaculum nigrificans DSM 574] Length = 409 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIK 36 + A D+GVPQ+R R++II + F FPT Sbjct: 186 LCAADYGVPQKRYRIFIIGRRDGKLPGFPFPTHANNP 222 >gi|260221505|emb|CBA30136.1| hypothetical protein Csp_C22040 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 191 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 23/52 (44%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 M A +FG PQ R RL++I L P P + DIL+ K T Sbjct: 1 MNAAEFGAPQSRVRLFLIGGLGLPPPEIRPEPSVKRMTARDILDPDDRWKFT 52 >gi|238917713|ref|YP_002931230.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC 27750] gi|238873073|gb|ACR72783.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC 27750] Length = 477 Score = 43.7 bits (103), Expect = 0.009, Method: Composition-based stats. Identities = 11/18 (61%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Query: 1 MKACDFGVPQRRER-LYI 17 + A +FGVPQ RER +YI Sbjct: 247 LNAKNFGVPQNRERLIYI 264 >gi|262113733|emb|CAR95400.1| hypothetical protein [Streptococcus phage phi-m46.1] Length = 417 Score = 43.4 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 2 KACDFGVPQRRERLYIID 19 + D+GVPQ RER+Y + Sbjct: 151 NSKDYGVPQNRERIYTLG 168 >gi|168206039|ref|ZP_02632044.1| Dcm [Clostridium perfringens E str. JGS1987] gi|170662518|gb|EDT15201.1| Dcm [Clostridium perfringens E str. JGS1987] Length = 339 Score = 43.4 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKR 64 RER++I+ + F+F L I E +D+K + + + Sbjct: 159 RERVFIVSIRKDIDNGSFEFKEGNNNLVTLESITESFVDEKYYCKDNSYLKSFLNK 214 >gi|319757808|gb|ADV69750.1| hypothetical protein SSUJS14_0659 [Streptococcus suis JS14] Length = 424 Score = 43.4 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 2 KACDFGVPQRRERLYIID 19 + D+GVPQ RER+Y + Sbjct: 151 NSKDYGVPQNRERIYTLG 168 >gi|89513784|gb|ABD74727.1| site-specific DNA-methyltransferase [Ensifer adhaerens] Length = 137 Score = 43.4 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF-KFPTPLG 34 + A FGVPQ RERL+I+ + + +FP P Sbjct: 71 LNAAYFGVPQVRERLFIVALADALDQVPEFPDPTH 105 >gi|254368946|ref|ZP_04984959.1| modification methylase FnuDI [Francisella tularensis subsp. holarctica FSC022] gi|157121867|gb|EDO66037.1| modification methylase FnuDI [Francisella tularensis subsp. holarctica FSC022] Length = 220 Score = 43.4 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGD 41 + + DF VPQ R+R++ + F F T K L D Sbjct: 29 LNSSDFKVPQDRQRVFFVGIRKDLGFNFNFSTNTYPKITLKD 70 >gi|417325|sp|P15840|MTSI_SPISQ RecName: Full=CPG DNA methylase; AltName: Full=Cytosine-specific methyltransferase SssI; Short=M.SssI gi|66468|pir||CTYMCS site-specific DNA-methyltransferase (cytosine-specific) (EC 2.1.1.73) SssI - Spiroplasma sp. (strain MQ1) gi|47553|emb|CAA35058.1| unnamed protein product [Spiroplasma sp.] Length = 386 Score = 43.4 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 31/116 (26%), Positives = 46/116 (39%), Gaps = 18/116 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG Q R R+++I LN VE P + +L + + +K + N L + Sbjct: 219 LNAADFGSSQARRRVFMISTLNEFVE--LPKGDKKPKSIKKVLNKIVSEKDIL-NNLLKY 275 Query: 61 HQKRKENNKIAGKG---FGYGLFF--------ENSATTNTLS---ARYY-KDGSEI 101 + + K GY F E + T T S +R KDGS I Sbjct: 276 NLTEFKKTKSNINKASLIGYSKFNSEGYVYDPEFTGPTLTASGANSRIKIKDGSNI 331 >gi|300866085|ref|ZP_07110814.1| site-specific DNA-methyltransferase [Oscillatoria sp. PCC 6506] gi|300335911|emb|CBN55972.1| site-specific DNA-methyltransferase [Oscillatoria sp. PCC 6506] Length = 436 Score = 43.4 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 25/63 (39%), Gaps = 5/63 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +GVPQ+RERL+++ +P P + D S +W+ Sbjct: 161 LNAAQYGVPQKRERLFLLGCRQDLTLPTYPQAF-THPASRKTSHSELPD----SPNVWDA 215 Query: 61 HQK 63 + Sbjct: 216 LRD 218 >gi|161869727|ref|YP_001598894.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria meningitidis 053442] gi|161595280|gb|ABX72940.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria meningitidis 053442] Length = 374 Score = 43.4 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 +FGVPQ RER+ I+ + +F P P + +L ++ IS+ Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFHHPEPTHGENTDYGLL-PYVTAGQAISD 213 >gi|168206682|ref|ZP_02632687.1| Dcm [Clostridium perfringens E str. JGS1987] gi|190015777|ref|YP_001967782.1| probable site-specific DNA-methyltransferase [Clostridium perfringens] gi|86450199|gb|ABC96308.1| probable site-specific DNA-methyltransferase [Clostridium perfringens] gi|170661882|gb|EDT14565.1| Dcm [Clostridium perfringens E str. JGS1987] Length = 339 Score = 43.4 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKR 64 RER++I+ + F+F L I E +D+K + + + Sbjct: 159 RERVFIVSIRKDIDNGSFEFKEGNNNLVTLESITESFVDEKYYCKDNSYLKSFLNK 214 >gi|1808696|gb|AAC00045.1| putative type II 5-cytosoine methyltransferase [Corynebacterium glutamicum] Length = 363 Score = 43.4 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG 34 ++GVPQ RER+ I+ + +FK P P Sbjct: 152 NFAEYGVPQFRERVLIVGIRRDTGFDFKHPAPTH 185 >gi|218245850|ref|YP_002371221.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] gi|257058898|ref|YP_003136786.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] gi|218166328|gb|ACK65065.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] gi|256589064|gb|ACU99950.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] Length = 418 Score = 43.4 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A ++GVPQ RERL+++ Sbjct: 157 LNAANYGVPQNRERLFLLG 175 >gi|319645695|ref|ZP_07999926.1| DNA-cytosine methyltransferase [Bacillus sp. BT1B_CT2] gi|317392242|gb|EFV73038.1| DNA-cytosine methyltransferase [Bacillus sp. BT1B_CT2] Length = 327 Score = 43.4 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR--LGDILEEHIDD 49 + A DFGVPQRRER++ I L F F + L K + + LE ++ Sbjct: 147 LNAMDFGVPQRRERVFTISILGNKA-FNF-SKLNRKTAQHIKEFLEGNVTA 195 >gi|254883949|ref|ZP_05256659.1| site-specific DNA methylase [Bacteroides sp. 4_3_47FAA] gi|254836742|gb|EET17051.1| site-specific DNA methylase [Bacteroides sp. 4_3_47FAA] Length = 420 Score = 43.4 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 20/76 (26%), Positives = 27/76 (35%), Gaps = 14/76 (18%) Query: 6 FGV--------PQRRERLYIIDFLNPSVEF------KFPTPLGIKPRLGDILEEHIDDKS 51 FGV Q R R+Y + V P P K L I+EE D K Sbjct: 157 FGVHINSALVSAQNRARIYWTNIRTKKVGLFGELHADIPQPQDRKIFLRHIVEEEADKKY 216 Query: 52 TISNKLWEGHQKRKEN 67 +S K+ ++ E Sbjct: 217 YLSEKMMGWLKRHGEK 232 >gi|192292294|ref|YP_001992899.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris TIE-1] gi|192286043|gb|ACF02424.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris TIE-1] Length = 500 Score = 43.4 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34 + A +GVPQ RER+++I + +FP P Sbjct: 185 LNAARYGVPQMRERMFLIAYRKELQQTVEFPKPTH 219 >gi|62390655|ref|YP_226057.1| modification methylase [Corynebacterium glutamicum ATCC 13032] gi|21324545|dbj|BAB99169.1| Site-specific DNA methylase or type II 5-cytosine methyltransferase [Corynebacterium glutamicum ATCC 13032] gi|41325993|emb|CAF20156.1| MODIFICATION METHYLASE [Corynebacterium glutamicum ATCC 13032] Length = 363 Score = 43.4 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG 34 ++GVPQ RER+ I+ + +FK P P Sbjct: 152 NFAEYGVPQFRERVLIVGIRRDTGFDFKHPAPTH 185 >gi|257877765|ref|ZP_05657418.1| cytosine specific DNA methyltransferase [Enterococcus casseliflavus EC20] gi|257811931|gb|EEV40751.1| cytosine specific DNA methyltransferase [Enterococcus casseliflavus EC20] Length = 380 Score = 43.4 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPT 31 + A D+GVPQ R+R++ + F F+FP Sbjct: 156 LLAADYGVPQMRKRMFFVGFRKDLNYDYFEFPK 188 >gi|9858807|gb|AAG01143.1|AF283660_1 BsrFI methylase [Geobacillus stearothermophilus] Length = 389 Score = 43.4 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 9/44 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---------FKFPTPLGI 35 + A +FG+PQ R R++++ F +E F++PTP Sbjct: 174 LNALEFGIPQDRTRVFVVGFKKSIIEALQENNMDIFQWPTPTYP 217 >gi|310815203|ref|YP_003963167.1| modification methylase XorII [Ketogulonicigenium vulgare Y25] gi|308753938|gb|ADO41867.1| modification methylase XorII [Ketogulonicigenium vulgare Y25] Length = 437 Score = 43.4 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 22/45 (48%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + A D+GVPQ R+RL ++ +P + +P D L + Sbjct: 155 LNAADYGVPQDRQRLILMGAKKGRSLPDYPKAIAERPTCQDALAD 199 >gi|325298662|ref|YP_004258579.1| DNA-cytosine methyltransferase [Bacteroides salanitronis DSM 18170] gi|324318215|gb|ADY36106.1| DNA-cytosine methyltransferase [Bacteroides salanitronis DSM 18170] Length = 336 Score = 43.4 bits (102), Expect = 0.012, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGD 41 + A D+ V + R+R++ I F +FK+PTPL KP L + Sbjct: 144 LNANDYDVAEDRDRVFYIGFRKDLNIHDFKYPTPLKHKPTLRE 186 >gi|19552978|ref|NP_600980.1| site-specific DNA methylase or [Corynebacterium glutamicum ATCC 13032] Length = 356 Score = 43.4 bits (102), Expect = 0.012, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG 34 ++GVPQ RER+ I+ + +FK P P Sbjct: 145 NFAEYGVPQFRERVLIVGIRRDTGFDFKHPAPTH 178 >gi|311897184|dbj|BAJ29592.1| putative modification methylase [Kitasatospora setae KM-6054] Length = 433 Score = 43.4 bits (102), Expect = 0.012, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-----SVEFKFPTPLGIKPRL 39 + A D+GVPQ R R+ I+ F + + P + L Sbjct: 201 VNAADYGVPQIRNRVIIVAFRRDLKVDIELFKELVKPTHSETAL 244 >gi|326789362|ref|YP_004307183.1| DNA-cytosine methyltransferase [Clostridium lentocellum DSM 5427] gi|326540126|gb|ADZ81985.1| DNA-cytosine methyltransferase [Clostridium lentocellum DSM 5427] Length = 415 Score = 43.0 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 19/29 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF 29 + A DFG+PQ+RER+Y++ L + K Sbjct: 213 LNAKDFGIPQKRERVYMLSVLVGNDALKL 241 >gi|332665156|ref|YP_004447944.1| DNA-cytosine methyltransferase [Haliscomenobacter hydrossis DSM 1100] gi|332333970|gb|AEE51071.1| DNA-cytosine methyltransferase [Haliscomenobacter hydrossis DSM 1100] Length = 416 Score = 43.0 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A ++GVPQRRER +I FP P +K Sbjct: 193 LNAANYGVPQRRERFILIGMKGIKEP-AFPLPTHMK 227 >gi|50914489|ref|YP_060461.1| DNA-cytosine methyltransferase [Streptococcus pyogenes MGAS10394] gi|50903563|gb|AAT87278.1| DNA-cytosine methyltransferase [Streptococcus pyogenes MGAS10394] Length = 422 Score = 43.0 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 10/18 (55%), Positives = 13/18 (72%) Query: 2 KACDFGVPQRRERLYIID 19 + D+GVPQ RER+Y I Sbjct: 152 NSKDYGVPQNRERVYTIG 169 >gi|257466254|ref|ZP_05630565.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium gonidiaformans ATCC 25563] Length = 353 Score = 43.0 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 + A ++GVPQ R+R + + LN F FP P+ Sbjct: 154 LYAPEYGVPQIRKRAFFVGLLNSKEGFTFPEPI 186 >gi|110799652|ref|YP_695464.1| DNA-cytosine methyltransferase [Clostridium perfringens ATCC 13124] gi|110674299|gb|ABG83286.1| DNA-cytosine methyltransferase [Clostridium perfringens ATCC 13124] Length = 446 Score = 43.0 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIK 36 A D+GVPQ RER+++I E + +P + Sbjct: 187 AADYGVPQNRERVFLIGINKMYGENPYIYPEKTHGE 222 >gi|315917412|ref|ZP_07913652.1| cytosine specific DNA methyltransferase [Fusobacterium gonidiaformans ATCC 25563] gi|313691287|gb|EFS28122.1| cytosine specific DNA methyltransferase [Fusobacterium gonidiaformans ATCC 25563] Length = 358 Score = 43.0 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 + A ++GVPQ R+R + + LN F FP P+ Sbjct: 159 LYAPEYGVPQIRKRAFFVGLLNSKEGFTFPEPI 191 >gi|86475982|dbj|BAE79156.1| putative cytosine methyltransferase [Clostridium perfringens] Length = 339 Score = 43.0 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKR 64 RER++I+ + F+F L I E +D+K + + + Sbjct: 159 RERVFIVSIRKDIDNGSFEFKKGNNNLVTLESITESFVDEKYYCKDNSYLKSFLNK 214 >gi|168211060|ref|ZP_02636685.1| Dcm [Clostridium perfringens B str. ATCC 3626] gi|170710923|gb|EDT23105.1| Dcm [Clostridium perfringens B str. ATCC 3626] Length = 339 Score = 43.0 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKR 64 RER++I+ + F+F L I E +D+K + + + Sbjct: 159 RERVFIVSIRKDIDNGSFEFKKGNNNLVTLESITESFVDEKYYCKDNSYLKSFLNK 214 >gi|319779704|ref|YP_004130617.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9] gi|317109728|gb|ADU92474.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9] Length = 339 Score = 43.0 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46 + + D+G+P R R+Y+I + EF+FP P+ + L D L Sbjct: 152 LNSMDYGLPLNRLRVYMIAIRKDVNTREFEFPKPIPLTSYLEDYLLPD 199 >gi|329121769|ref|ZP_08250386.1| DNA (cytosine-5-)-methyltransferase [Dialister micraerophilus DSM 19965] gi|327468239|gb|EGF13725.1| DNA (cytosine-5-)-methyltransferase [Dialister micraerophilus DSM 19965] Length = 416 Score = 43.0 bits (101), Expect = 0.015, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF 29 + A D+G PQRR R +I F N + F + Sbjct: 162 INAADYGYPQRRRRTFIFAFRNETKFFDY 190 >gi|40218563|gb|AAR83217.1| chromosome partitioning protein parB [Streptococcus pyogenes] gi|50261608|gb|AAT72376.1| methylase [Streptococcus pyogenes] Length = 388 Score = 43.0 bits (101), Expect = 0.015, Method: Composition-based stats. Identities = 10/18 (55%), Positives = 13/18 (72%) Query: 2 KACDFGVPQRRERLYIID 19 + D+GVPQ RER+Y I Sbjct: 152 NSKDYGVPQNRERVYTIG 169 >gi|20147457|gb|AAM12503.1|AF416450_1 cytosine methyltransferase [Clostridium perfringens CPE str. F4969] Length = 182 Score = 43.0 bits (101), Expect = 0.015, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKR 64 RER++I+ + FKF L I E +D+K + + + Sbjct: 2 RERVFIVSIRKDIDNGSFKFKEGNDNLVTLESITENFVDEKYYCKDNSYLKSFLNK 57 >gi|282897137|ref|ZP_06305139.1| C-5 cytosine-specific DNA methylase [Raphidiopsis brookii D9] gi|281197789|gb|EFA72683.1| C-5 cytosine-specific DNA methylase [Raphidiopsis brookii D9] Length = 435 Score = 43.0 bits (101), Expect = 0.016, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 18/41 (43%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + A DFGV Q R RL ++ + + +P L K Sbjct: 164 LNAADFGVAQNRSRLILLGWRKDMPKPVYPETLFEKTTANS 204 >gi|296112182|ref|YP_003622593.1| putative C-5 cytosine-specific DNA methylase [Thiomonas sp. 3As] gi|294341994|emb|CAZ90422.1| putative C-5 cytosine-specific DNA methylase [Thiomonas sp. 3As] Length = 304 Score = 42.6 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE 44 + + D GVPQ RERL++I L+ + P DI+E Sbjct: 141 IDSADHGVPQHRERLFLICSLSKHP-LELDLPRRAYVPARDIIE 183 >gi|228474527|ref|ZP_04059258.1| site-specific DNA methylase [Staphylococcus hominis SK119] gi|228271190|gb|EEK12558.1| site-specific DNA methylase [Staphylococcus hominis SK119] Length = 414 Score = 42.6 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 + A D+GVPQ RER+ II VE FP + P Sbjct: 149 LNAADYGVPQARERVIIIG-NRIGVENPFPVISHVAP 184 >gi|269797252|ref|YP_003311152.1| DNA-cytosine methyltransferase [Veillonella parvula DSM 2008] gi|269093881|gb|ACZ23872.1| DNA-cytosine methyltransferase [Veillonella parvula DSM 2008] Length = 423 Score = 42.6 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 23/63 (36%), Gaps = 12/63 (19%) Query: 1 MKACDFGVPQRRERLYIID------FLNPSVEFKF------PTPLGIKPRLGDILEEHID 48 + A DFGV Q RER+ I+ F ++ + P + L +I Sbjct: 196 INANDFGVSQNRERVIIVGHRKDLLFNKSFFDYLYNYVEPSPKLKELFADLPNIRAGKSS 255 Query: 49 DKS 51 K Sbjct: 256 KKY 258 >gi|254450593|ref|ZP_05064030.1| modification methylase FnuDI [Octadecabacter antarcticus 238] gi|198264999|gb|EDY89269.1| modification methylase FnuDI [Octadecabacter antarcticus 238] Length = 365 Score = 42.6 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIK 36 + + D+GVPQRR+RL++I F FPT K Sbjct: 144 INSQDYGVPQRRKRLFVIGVRRDLGGYFHFPTETHCK 180 >gi|1098476|gb|AAC37047.1| orf; homologous to Haemophilus parahaemolyticus hphIM(C) Accession Number M24625 [Neisseria meningitidis] Length = 276 Score = 42.6 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI-KPRLGD 41 + A DFGVPQ R R+ I + FP PL I +G Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGS 195 >gi|238059022|ref|ZP_04603734.1| DNA-cytosine methyltransferase [Micromonospora sp. ATCC 39149] gi|237886458|gb|EEP75286.1| DNA-cytosine methyltransferase [Micromonospora sp. ATCC 39149] Length = 442 Score = 42.6 bits (100), Expect = 0.018, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53 + A DFGVPQ R+RL + + E P G + L L H K + Sbjct: 145 LDAADFGVPQTRKRLVFVGLRSDLGE-TPPVFEGTQATLHLALVRHGKGKYAL 196 >gi|159897859|ref|YP_001544106.1| DNA-cytosine methyltransferase [Herpetosiphon aurantiacus ATCC 23779] gi|159890898|gb|ABX03978.1| DNA-cytosine methyltransferase [Herpetosiphon aurantiacus ATCC 23779] Length = 415 Score = 42.6 bits (100), Expect = 0.018, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 24/53 (45%), Gaps = 8/53 (15%) Query: 1 MKACDFGVPQRRERLYIIDFL-----NPSV---EFKFPTPLGIKPRLGDILEE 45 + A DFGVPQ R+R ++ +P++ +F P + +E+ Sbjct: 194 LDAADFGVPQHRKRFFLFGIRTDLTTDPNIRLEKFINPYRTSTLTTVAQAIED 246 >gi|299820316|gb|ADJ54326.1| C5-cytosine specific methylase [archaeon enrichment culture clone 1(2010)] Length = 396 Score = 42.6 bits (100), Expect = 0.018, Method: Composition-based stats. Identities = 25/106 (23%), Positives = 40/106 (37%), Gaps = 15/106 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF-KFPTPLGIKPRLGDI---------LEEHIDDK 50 + + D+GVPQ+R RL+ I + PTP + + I L E I D Sbjct: 147 LNSADYGVPQKRFRLFTIGIHRSLGKKPSLPTPTHSEKPVVTIFGTMPTWLTLREAIQDI 206 Query: 51 STI--SNKLWEGHQKRKENNKIAGKGFGYGLF---FENSATTNTLS 91 I + L + +R + + KG +G T+S Sbjct: 207 MNIPPTTILRQEQVERIKRERENTKGIHWGKMEFPDNLDRPARTIS 252 >gi|30523050|gb|AAP31838.1| AsiSI methylase [Arthrobacter sp. S] Length = 390 Score = 42.6 bits (100), Expect = 0.019, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 7/60 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GVPQ R+RL +I + EF F P P G + T S+ LW+ Sbjct: 154 LNAADWGVPQARKRLILIAVRD-VAEFSFPPKPTHSGDPSGSL-----RPYRTASDALWD 207 >gi|295836816|ref|ZP_06823749.1| modification methylase NaeI [Streptomyces sp. SPB74] gi|295826219|gb|EDY44437.2| modification methylase NaeI [Streptomyces sp. SPB74] Length = 449 Score = 42.6 bits (100), Expect = 0.019, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPR-LGDILEEHIDDKS 51 + + FGVPQ R R ++ F +F++P + + D+L E + ++ Sbjct: 195 LDSNKFGVPQLRPRAILVAFREDIARFEDFRWPVRSAEEAESVFDVLREEMRERY 249 >gi|94958344|gb|ABF47306.1| Dcm [Clostridium perfringens] gi|94958377|gb|ABF47337.1| Dcm [Clostridium perfringens] Length = 339 Score = 42.6 bits (100), Expect = 0.019, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKRKEN 67 RER++I+ + FKF L I E +D+K + + + Sbjct: 159 RERVFIVSIRKDIDNGSFKFKEGNDNLVTLESITENFVDEKYYCKDNSYLKSFLNKVNK 217 >gi|67922668|ref|ZP_00516173.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] gi|67855516|gb|EAM50770.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] Length = 282 Score = 42.6 bits (100), Expect = 0.019, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 7/55 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP------TPLGIKPRLGDILEEHIDD 49 + A D+GVPQ R R+ + + EF FP + + D+ EE + D Sbjct: 153 LLASDYGVPQNRRRVIFVGV-PKNYEFNFPIGDFTENKITCSQAMNDLPEESMTD 206 >gi|300868191|ref|ZP_07112823.1| Cytosine-specific methyltransferase [Oscillatoria sp. PCC 6506] gi|300333815|emb|CBN58007.1| Cytosine-specific methyltransferase [Oscillatoria sp. PCC 6506] Length = 395 Score = 42.6 bits (100), Expect = 0.020, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A D+GVPQ RER+ I + S P P + Sbjct: 192 LNAADYGVPQVRERVIFIGY-KGSDSVTLPLPTHSQ 226 >gi|307244197|ref|ZP_07526312.1| DNA (cytosine-5-)-methyltransferase [Peptostreptococcus stomatis DSM 17678] gi|306492347|gb|EFM64385.1| DNA (cytosine-5-)-methyltransferase [Peptostreptococcus stomatis DSM 17678] Length = 534 Score = 42.6 bits (100), Expect = 0.020, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIK 36 + A +GVPQ R R+ ++ F + F FP + Sbjct: 339 VNASSYGVPQNRIRVIVVAFRKDLNKMFIFPEEQSKE 375 >gi|238788388|ref|ZP_04632182.1| DNA-cytosine methyltransferase [Yersinia frederiksenii ATCC 33641] gi|238723634|gb|EEQ15280.1| DNA-cytosine methyltransferase [Yersinia frederiksenii ATCC 33641] Length = 380 Score = 42.6 bits (100), Expect = 0.020, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 24/61 (39%), Gaps = 7/61 (11%) Query: 1 MKACDFGVPQRRERLYIIDFL------NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + D+GVPQ R+R+ I N F PTP P L + K IS Sbjct: 154 LNTADYGVPQTRKRIIAIGVKAELFDINQLPAFP-PTPTHCSPDKNSALPAWVTVKDAIS 212 Query: 55 N 55 + Sbjct: 213 D 213 >gi|86559571|ref|YP_473392.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens CPE str. F4969] gi|168215006|ref|ZP_02640631.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens CPE str. F4969] gi|86475843|dbj|BAE79019.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens] gi|94958361|gb|ABF47322.1| Dcm [Clostridium perfringens] gi|170713579|gb|EDT25761.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens CPE str. F4969] Length = 339 Score = 42.6 bits (100), Expect = 0.020, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKRKEN 67 RER++I+ + FKF L I E +D+K + + + Sbjct: 159 RERVFIVSIRKDIDNGSFKFKEGNDNLVTLESITENFVDEKYYCKDNSYLKSFLNKVNK 217 >gi|169342462|ref|ZP_02863522.1| Dcm [Clostridium perfringens C str. JGS1495] gi|169299461|gb|EDS81526.1| Dcm [Clostridium perfringens C str. JGS1495] Length = 339 Score = 42.6 bits (100), Expect = 0.020, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKRKEN 67 RER++I+ + FKF L I E +D+K + + + Sbjct: 159 RERVFIVSIRKDIDNGSFKFKEGNDNLVTLESITENFVDEKYYCKDNSYLKSFLNKVNK 217 >gi|327463101|gb|EGF09422.1| modification methylase DdeI [Streptococcus sanguinis SK1] Length = 351 Score = 42.2 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG----IKPRLGDI--LEEHIDD 49 + A D+GVPQ R+R+ + N F++PT LG + L D+ LE + D Sbjct: 152 LLASDYGVPQNRKRVIFVGTKND--GFEYPTSLGTTITTEMALSDLPTLENELGD 204 >gi|282901524|ref|ZP_06309446.1| C-5 cytosine-specific DNA methylase [Cylindrospermopsis raciborskii CS-505] gi|281193567|gb|EFA68542.1| C-5 cytosine-specific DNA methylase [Cylindrospermopsis raciborskii CS-505] Length = 436 Score = 42.2 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 19/41 (46%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + A DFGV Q R RL ++ + + +P L KP Sbjct: 164 LNAADFGVAQNRSRLILLGWRKDMPKPVYPGVLFEKPTANS 204 >gi|315035876|gb|EFT47808.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0027] Length = 298 Score = 42.2 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKP 37 + + D+ VPQ RER++II FP + Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGERTRKVFPFKKNDRT 183 >gi|256958119|ref|ZP_05562290.1| C5 methyltransferase alpha subunit [Enterococcus faecalis DS5] gi|256948615|gb|EEU65247.1| C5 methyltransferase alpha subunit [Enterococcus faecalis DS5] Length = 298 Score = 42.2 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKP 37 + + D+ VPQ RER++II FP + Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGERTRKVFPFKKNDRT 183 >gi|238922582|ref|YP_002936095.1| cytosine-specific methyltransferase [Eubacterium rectale ATCC 33656] gi|238874254|gb|ACR73961.1| cytosine-specific methyltransferase [Eubacterium rectale ATCC 33656] Length = 443 Score = 42.2 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLG 34 + + D+GVPQ RER++++ + E K P P Sbjct: 164 LNSADYGVPQVRERVFVVAIKGDEGKEIKLPNPTH 198 >gi|182625480|ref|ZP_02953252.1| Dcm [Clostridium perfringens D str. JGS1721] gi|177909320|gb|EDT71778.1| Dcm [Clostridium perfringens D str. JGS1721] Length = 339 Score = 42.2 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKR--KE 66 RER++I+ + FKF L I E +D+K + + + K Sbjct: 159 RERVFIVSIRKDIDNGSFKFKEGNDNLVILESITESFVDEKYYCKDNSYLKSFLNKVNKR 218 Query: 67 NNKIA 71 K Sbjct: 219 ICKDK 223 >gi|284050655|ref|ZP_06380865.1| DNA-cytosine methyltransferase [Arthrospira platensis str. Paraca] gi|79835464|gb|ABB52092.1| Mod [Arthrospira platensis] Length = 406 Score = 42.2 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG-DILEEHIDDKSTISNK 56 D+GVPQ RER+ I+ F F + P G D L + K + + Sbjct: 160 NFADYGVPQYRERVLIVGVR-MDTGFNF---IHPFPEYGSDRLYPYRTAKQALKDV 211 >gi|310817513|ref|YP_003949871.1| cytosine-specific methyltransferase [Stigmatella aurantiaca DW4/3-1] gi|309390585|gb|ADO68044.1| Cytosine-specific methyltransferase [Stigmatella aurantiaca DW4/3-1] Length = 332 Score = 42.2 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGD 41 + A D+GVPQ R R ++ + F +P P +G+ Sbjct: 153 LNASDYGVPQLRPRFILVALRPVAATHFIWPKAQREIPTVGN 194 >gi|291568714|dbj|BAI90986.1| cytosine-specific methyltransferase [Arthrospira platensis NIES-39] Length = 406 Score = 42.2 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG-DILEEHIDDKSTISNK 56 D+GVPQ RER+ I+ F F + P G D L + K + + Sbjct: 160 NFADYGVPQYRERVLIVGVR-MDTGFNF---IHPFPEYGSDRLYPYRTAKQALKDV 211 >gi|196048067|ref|ZP_03115245.1| DNA-cytosine methyltransferase [Bacillus cereus 03BB108] gi|196021323|gb|EDX60052.1| DNA-cytosine methyltransferase [Bacillus cereus 03BB108] Length = 427 Score = 42.2 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 24/52 (46%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 M+A D+GVPQ RER+ +I + F L L DIL+ + Sbjct: 158 MQAHDYGVPQLRERIIVIGTESTCDPFPLIPKLKGPRVLSDILKNCPTSEYF 209 >gi|119503900|ref|ZP_01625982.1| putative cytosine-specific methyltransferase [marine gamma proteobacterium HTCC2080] gi|119460408|gb|EAW41501.1| putative cytosine-specific methyltransferase [marine gamma proteobacterium HTCC2080] Length = 463 Score = 42.2 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 3 ACDFGVPQRRERLYIIDFLNP 23 A D+GVPQ R R+ ++ N Sbjct: 207 AKDYGVPQNRPRVLLVGIRND 227 >gi|115373224|ref|ZP_01460525.1| modification methylase NaeI [Stigmatella aurantiaca DW4/3-1] gi|115369825|gb|EAU68759.1| modification methylase NaeI [Stigmatella aurantiaca DW4/3-1] Length = 303 Score = 42.2 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGD 41 + A D+GVPQ R R ++ + F +P P +G+ Sbjct: 124 LNASDYGVPQLRPRFILVALRPVAATHFIWPKAQREIPTVGN 165 >gi|330997449|ref|ZP_08321300.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT 11841] gi|329570823|gb|EGG52539.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT 11841] Length = 357 Score = 42.2 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 18/30 (60%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32 A D+GVPQ R+RL I + ++FP P Sbjct: 156 AADYGVPQIRKRLVFIGLRDSKASYEFPVP 185 >gi|86559667|ref|YP_473487.1| cytosine methyltransferase [Clostridium perfringens] gi|86475939|dbj|BAE79114.1| cytosine methyltransferase [Clostridium perfringens] Length = 314 Score = 42.2 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Query: 12 RERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LWEGHQKR 64 RER++I+ + FKF L I E +D+K + + + Sbjct: 159 RERVFIVSIRKDIDNGSFKFKEGNDNLVTLESITENFVDEKYYCKDNSYLKSFLNK 214 >gi|229489296|ref|ZP_04383160.1| modification methylase NaeI [Rhodococcus erythropolis SK121] gi|229323789|gb|EEN89546.1| modification methylase NaeI [Rhodococcus erythropolis SK121] Length = 343 Score = 42.2 bits (99), Expect = 0.023, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 + A DFGVPQ R+ +++ F + +F F P I+ R Sbjct: 164 LNAADFGVPQDRKHGFLVAFQGAAADF-FENPQAIRSR 200 >gi|110799020|ref|YP_694603.1| DNA-cytosine methyltransferase [Clostridium perfringens ATCC 13124] gi|110673667|gb|ABG82654.1| DNA-cytosine methyltransferase [Clostridium perfringens ATCC 13124] Length = 361 Score = 42.2 bits (99), Expect = 0.023, Method: Composition-based stats. Identities = 15/76 (19%), Positives = 31/76 (40%), Gaps = 18/76 (23%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG-------------IKPRLGDILEEH 46 + + ++GV Q+RER+ + + ++FP P + LGDI + Sbjct: 173 LNSAEYGVAQKRERVIFVGIRKDLNKVYEFPNPTHGVGRKYPFVTVNDVIQELGDIKHNY 232 Query: 47 IDDKSTISNKLWEGHQ 62 + K S + + + Sbjct: 233 V--KY--SEERLKYMK 244 >gi|46019826|emb|CAE52348.1| putative cytosine-specific methyltransferase [Streptococcus thermophilus] Length = 365 Score = 42.2 bits (99), Expect = 0.023, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPL 33 + A D+GVPQ R+R++ + + FKFP P Sbjct: 155 LLAADYGVPQIRKRMFFVGYRKDLNYEYFKFPEPT 189 >gi|328947611|ref|YP_004364948.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] gi|328447935|gb|AEB13651.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] Length = 391 Score = 42.2 bits (99), Expect = 0.023, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 + A DFGVPQ R+R +I+ NP+ E PTP K Sbjct: 158 LCATDFGVPQTRKRFFILASKNPTTELSAPTPTCKKT 194 >gi|317127846|ref|YP_004094128.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522] gi|315472794|gb|ADU29397.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522] Length = 564 Score = 42.2 bits (99), Expect = 0.023, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPL 33 + A ++GVPQ+R RL+II V+ P P+ Sbjct: 325 LNAANYGVPQQRRRLFIIGVREDLVKKGRRVTLPEPI 361 >gi|302559403|ref|ZP_07311745.1| modification methylase NaeI [Streptomyces griseoflavus Tu4000] gi|302477021|gb|EFL40114.1| modification methylase NaeI [Streptomyces griseoflavus Tu4000] Length = 429 Score = 42.2 bits (99), Expect = 0.024, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDILEEHIDDK 50 + A DFGVPQ R R ++ L E F +P + +G LE + K Sbjct: 153 LHASDFGVPQLRPRFVLVALLPEYAEYFSWPEELPDARLTVGAALEGLMAAK 204 >gi|254413124|ref|ZP_05026896.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196180288|gb|EDX75280.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 416 Score = 42.2 bits (99), Expect = 0.024, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIK 36 + A ++GVPQ RER+ ++ F + + + P K Sbjct: 172 INAIEYGVPQDRERIILLGFRQSLIRDIELPVEPSAK 208 >gi|307152624|ref|YP_003888008.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822] gi|306982852|gb|ADN14733.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822] Length = 708 Score = 42.2 bits (99), Expect = 0.024, Method: Composition-based stats. Identities = 18/77 (23%), Positives = 32/77 (41%), Gaps = 13/77 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD-----ILEEHIDDK---ST 52 + A D+GVPQRR+RL+ + +K+P + L + K T Sbjct: 169 LNASDYGVPQRRQRLFCVA---HQSVWKWPAQTHLHHPYTAGEALGELALIVPAKAKFLT 225 Query: 53 ISNKLWEGHQKRKENNK 69 +S + Q+ + +K Sbjct: 226 LSQD--QYIQRYEAASK 240 >gi|59802210|ref|YP_208922.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae FA 1090] gi|239997871|ref|ZP_04717795.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae 35/02] gi|240015148|ref|ZP_04722061.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae DGI18] gi|240017596|ref|ZP_04724136.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae FA6140] gi|240081740|ref|ZP_04726283.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae FA19] gi|240116752|ref|ZP_04730814.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae PID18] gi|240118973|ref|ZP_04733035.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae PID1] gi|240122219|ref|ZP_04735181.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae PID24-1] gi|240124509|ref|ZP_04737465.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae PID332] gi|240124618|ref|ZP_04737504.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae SK-92-679] gi|240129189|ref|ZP_04741850.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae SK-93-1035] gi|260439487|ref|ZP_05793303.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae DGI2] gi|268593717|ref|ZP_06127884.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae 35/02] gi|268597838|ref|ZP_06132005.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae FA19] gi|268683185|ref|ZP_06150047.1| site-specific DNA-methyltransferase HphI [Neisseria gonorrhoeae SK-92-679] gi|291042721|ref|ZP_06568462.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae DGI2] gi|293398253|ref|ZP_06642458.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|2330911|gb|AAC45838.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae] gi|59719105|gb|AAW90510.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae FA 1090] gi|268547106|gb|EEZ42524.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae 35/02] gi|268551626|gb|EEZ46645.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae FA19] gi|268623469|gb|EEZ55869.1| site-specific DNA-methyltransferase HphI [Neisseria gonorrhoeae SK-92-679] gi|291013155|gb|EFE05121.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae DGI2] gi|291611516|gb|EFF40586.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|317165321|gb|ADV08862.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae TCDC-NG08107] Length = 333 Score = 42.2 bits (99), Expect = 0.024, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI-KPRLGD 41 + A DFGVPQ R R+ I + FP PL I +G Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGS 195 >gi|300933957|ref|ZP_07149213.1| DNA-cytosine methyltransferase [Corynebacterium resistens DSM 45100] Length = 363 Score = 42.2 bits (99), Expect = 0.025, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG 34 ++GVPQ RER+ I+ + FK P P Sbjct: 152 NFAEYGVPQFRERVLIVGIRRDTGFNFKHPAPTH 185 >gi|296393591|ref|YP_003658475.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985] gi|296180738|gb|ADG97644.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985] Length = 372 Score = 42.2 bits (99), Expect = 0.025, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 24/61 (39%), Gaps = 10/61 (16%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 A D+GVPQ+R R+ +I F FP P +L ++ + W Sbjct: 155 AADYGVPQQRWRVLVIGIREDQNPEGFAFPEPTHS---FEALLHSQ-----YVTGEYWHR 206 Query: 61 H 61 H Sbjct: 207 H 207 >gi|111220172|ref|YP_710966.1| putative DNA modification methylase [Frankia alni ACN14a] gi|111147704|emb|CAJ59362.1| putative DNA Modification methylase (Cytosine-specific methyltransferase) [Frankia alni ACN14a] Length = 401 Score = 42.2 bits (99), Expect = 0.025, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 + A ++GVPQRR+R +I + E + P P +P Sbjct: 191 LNAANYGVPQRRQRTIVIG--SRIGEPELPAPTHQEP 225 >gi|268602423|ref|ZP_06136590.1| site-specific DNA-methyltransferase HphI [Neisseria gonorrhoeae PID18] gi|268586554|gb|EEZ51230.1| site-specific DNA-methyltransferase HphI [Neisseria gonorrhoeae PID18] Length = 315 Score = 42.2 bits (99), Expect = 0.025, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI-KPRLGD 41 + A DFGVPQ R R+ I + FP PL I +G Sbjct: 137 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGS 177 >gi|240114016|ref|ZP_04728506.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae MS11] Length = 333 Score = 42.2 bits (99), Expect = 0.025, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI-KPRLGD 41 + A DFGVPQ R R+ I + FP PL I +G Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGS 195 >gi|254416651|ref|ZP_05030402.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196176617|gb|EDX71630.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 428 Score = 42.2 bits (99), Expect = 0.025, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 20/37 (54%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 + A +FGVPQ+R+RL+I+ +P P P Sbjct: 173 LNAVNFGVPQQRQRLFILGNQVGVKPLTYPQPQLQSP 209 >gi|325133150|gb|EGC55821.1| modification methylase HphIA [Neisseria meningitidis M6190] gi|325138766|gb|EGC61318.1| modification methylase HphIA [Neisseria meningitidis ES14902] gi|325197365|gb|ADY92821.1| modification methylase HphIA [Neisseria meningitidis G2136] gi|325203202|gb|ADY98655.1| modification methylase HphIA [Neisseria meningitidis M01-240355] Length = 332 Score = 42.2 bits (99), Expect = 0.025, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI-KPRLGD 41 + A DFGVPQ R R+ I + FP PL I +G Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGS 195 >gi|257419811|ref|ZP_05596805.1| site-specific DNA methylase [Enterococcus faecalis T11] gi|257161639|gb|EEU91599.1| site-specific DNA methylase [Enterococcus faecalis T11] Length = 380 Score = 42.2 bits (99), Expect = 0.025, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Query: 6 FGVPQRRERLYIIDFLNPS----VEFKFPTPLGIKPR 38 +GVPQ R R+ I+ N +EFK P P P Sbjct: 167 YGVPQARHRIIIVGIRNDIAEQGIEFKVPAPTTPNPE 203 >gi|268680630|ref|YP_003305061.1| DNA-cytosine methyltransferase [Sulfurospirillum deleyianum DSM 6946] gi|268618661|gb|ACZ13026.1| DNA-cytosine methyltransferase [Sulfurospirillum deleyianum DSM 6946] Length = 398 Score = 42.2 bits (99), Expect = 0.026, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 24/62 (38%), Gaps = 18/62 (29%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-----------SVEFK-FPTPLGIKPRLGDILEEHID 48 + A ++GVPQ RER+ I + EF +P P DI + + Sbjct: 199 LHAGNYGVPQTRERIIFIGVRKDILSEDLHVKLQNGEFSLYPEPTH------DIKHDFVT 252 Query: 49 DK 50 K Sbjct: 253 VK 254 >gi|315650253|ref|ZP_07903326.1| modification methylase BbvI [Eubacterium saburreum DSM 3986] gi|315487498|gb|EFU77807.1| modification methylase BbvI [Eubacterium saburreum DSM 3986] Length = 349 Score = 42.2 bits (99), Expect = 0.026, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query: 5 DFGVPQRRERLYIIDFLNP-SVEFKFPTP 32 D+G+PQ R R+ I+ N SV+F P+P Sbjct: 159 DYGIPQTRHRIIIVGIRNDISVKFNVPSP 187 >gi|291531290|emb|CBK96875.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3] Length = 425 Score = 42.2 bits (99), Expect = 0.026, Method: Composition-based stats. Identities = 19/95 (20%), Positives = 32/95 (33%), Gaps = 14/95 (14%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLG--IKPRLGDILEEHIDDKST----I 53 + A +FG+PQ R RL +I F+ E K DI++E+ + I Sbjct: 216 LNASNFGLPQNRPRLLMISVFIKDYDEKTIEKIKSFFDKKSSKDIVDEYASSRYYHKIDI 275 Query: 54 SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTN 88 + L + K + N + Sbjct: 276 KDLLRIDYNNAKYREEAK-------ECTPNDTVSR 303 >gi|157691446|ref|YP_001485908.1| DNA (cytosine-5-)-methyltransferase [Bacillus pumilus SAFR-032] gi|157680204|gb|ABV61348.1| DNA (cytosine-5-)-methyltransferase [Bacillus pumilus SAFR-032] Length = 548 Score = 42.2 bits (99), Expect = 0.026, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + + FGVPQ R+R +II + N P + K +I Sbjct: 322 LNSAHFGVPQERKRYFIIGYRNSKP--SLPKSILSKEDFFNIGHA 364 >gi|312200922|ref|YP_004020983.1| DNA-cytosine methyltransferase [Frankia sp. EuI1c] gi|311232258|gb|ADP85113.1| DNA-cytosine methyltransferase [Frankia sp. EuI1c] Length = 384 Score = 42.2 bits (99), Expect = 0.026, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A DFGVPQRR+R +I Sbjct: 172 LNAADFGVPQRRQRTIMIG 190 >gi|217965593|ref|YP_002351271.1| modification methylase (cytosine-specific methyltransferase) [Listeria monocytogenes HCC23] gi|217334863|gb|ACK40657.1| modification methylase (cytosine-specific methyltransferase) [Listeria monocytogenes HCC23] gi|307569856|emb|CAR83035.1| methyltransferase [Listeria monocytogenes L99] Length = 411 Score = 42.2 bits (99), Expect = 0.027, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Query: 1 MKACDFGVPQRRERLYIID---FLNPSVEFKFPTPLGIKPR 38 + + D+GVPQ RER+++I P+ E+ P P + Sbjct: 225 VNSRDYGVPQLRERVFLIGTHETKQPNFEYILPPPTNGTKK 265 >gi|323650451|gb|ADX97303.1| M.FseI [Frankia sp. Eul1b] Length = 374 Score = 41.8 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A DFGVPQRR+R +I Sbjct: 162 LNAADFGVPQRRQRTIMIG 180 >gi|254470861|ref|ZP_05084264.1| DNA-cytosine methyltransferase [Pseudovibrio sp. JE062] gi|211960003|gb|EEA95200.1| DNA-cytosine methyltransferase [Pseudovibrio sp. JE062] Length = 498 Score = 41.8 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG 34 + A +GVPQ RER++++ + + FP P Sbjct: 183 LNAAYYGVPQMRERMFLLAYRREITDSIVFPKPTH 217 >gi|261736050|ref|YP_003257392.1| DNA methylase [Streptomyces sp. ZL12] gi|261349173|gb|ACX71105.1| DNA methylase [Streptomyces sp. ZL12] Length = 368 Score = 41.8 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 + A ++GVPQ RER +I + + P P + D+ Sbjct: 170 LNAANYGVPQTRERAVLIA--SRVRDVTAPEPTHAEHPADDLF 210 >gi|317501747|ref|ZP_07959934.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium 8_1_57FAA] gi|316896869|gb|EFV18953.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium 8_1_57FAA] Length = 499 Score = 41.8 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE---EHIDDKST 52 + + FG+PQ R+R+YI+ L+ + LG++LE ++ T Sbjct: 219 IDSQYFGLPQSRKRVYIVGMLDAKINLD--NFEKKTVTLGEVLEHGLPTVESNFT 271 >gi|1709155|sp|P50196|MTE8_ECOLX RecName: Full=Modification methylase Eco47II; Short=M.Eco47II; AltName: Full=Cytosine-specific methyltransferase Eco47II gi|558571|emb|CAA57629.1| site-specific DNA-methyltransferase (cytosine-specific) [Escherichia coli] gi|1098127|prf||2115269B methyltransferase Eco47IIM Length = 417 Score = 41.8 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEE 45 +KA + VPQ+RERL I+ N +++++P+ L D L++ Sbjct: 225 LKAIFYKVPQKRERLIIVAVRNDLADGIDYEWPSSYNKILTLKDALKK 272 >gi|400287|sp|P31033|MTM4_NEIGO RecName: Full=Modification methylase NgoMIV; Short=M.NgoMIV; AltName: Full=Cytosine-specific methyltransferase NgoMIV Length = 312 Score = 41.8 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLW 58 + A D+GV Q R R+ + N + FK+P P +P+ +G++L + +S W Sbjct: 144 LYAADYGVSQLRPRVLFVALKNEYTNFFKWPEPNSEQPKTVGELLFD------LMSENNW 197 Query: 59 EGHQKRKEN 67 +G + Sbjct: 198 QGAHNWRLK 206 >gi|116748761|ref|YP_845448.1| DNA-cytosine methyltransferase [Syntrophobacter fumaroxidans MPOB] gi|116697825|gb|ABK17013.1| DNA-cytosine methyltransferase [Syntrophobacter fumaroxidans MPOB] Length = 429 Score = 41.8 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49 + A ++GVPQ RER++++ ++ + F+ P GD LE + Sbjct: 185 LNAVNYGVPQSRERVFLLASIDGTT-FQIPPVTHG---CGDRLEPRVTA 229 >gi|290892537|ref|ZP_06555530.1| site-specific DNA-methyltransferase BsuRI [Listeria monocytogenes FSL J2-071] gi|290557846|gb|EFD91367.1| site-specific DNA-methyltransferase BsuRI [Listeria monocytogenes FSL J2-071] Length = 409 Score = 41.8 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Query: 1 MKACDFGVPQRRERLYIID---FLNPSVEFKFPTPLGIKPR 38 + + D+GVPQ RER+++I P+ E+ P P + Sbjct: 225 VNSRDYGVPQLRERVFLIGTHETKQPNFEYILPPPTNGTKK 265 >gi|189459597|ref|ZP_03008382.1| hypothetical protein BACCOP_00223 [Bacteroides coprocola DSM 17136] gi|189433679|gb|EDV02664.1| hypothetical protein BACCOP_00223 [Bacteroides coprocola DSM 17136] Length = 387 Score = 41.8 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 14/59 (23%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A +FGVPQRR+R++II + P+PL P + + +W Sbjct: 290 LNAEEFGVPQRRKRVFIIG-SLEEISIPQPSPLFYMPSVK-------------TPNMWN 334 >gi|305665822|ref|YP_003862109.1| DNA (cytosine-5-)-methyltransferase [Maribacter sp. HTCC2170] gi|88710593|gb|EAR02825.1| DNA (cytosine-5-)-methyltransferase [Maribacter sp. HTCC2170] Length = 408 Score = 41.8 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 + A D+G+PQRR R++ I + + +K L DI Sbjct: 160 INAADYGMPQRRRRIFFIAYHKSTAIYKKLKKADSSQWLNDI 201 >gi|302870498|ref|YP_003839135.1| DNA-cytosine methyltransferase [Micromonospora aurantiaca ATCC 27029] gi|302573357|gb|ADL49559.1| DNA-cytosine methyltransferase [Micromonospora aurantiaca ATCC 27029] Length = 383 Score = 41.8 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 9/50 (18%) Query: 4 CDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP------RLGDILEEHI 47 D GVPQ RERL ++ + K P+ +P + D L+ Sbjct: 165 ADLGVPQHRERLIVVGVRR---DLKVRPPIIPEPYAGRHVTVADALDTSP 211 >gi|298346143|ref|YP_003718830.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii ATCC 43063] gi|298236204|gb|ADI67336.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii ATCC 43063] Length = 355 Score = 41.8 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A ++GV + R+R++ I F +++F FP E K T+ + +W+ Sbjct: 148 VNAKNYGVAEERKRVFYIGFRKDLNIDFVFPKGST----------EDDAKKITLRDVIWD 197 >gi|23100791|ref|NP_694258.1| cytosine-specific methyltransferase [Oceanobacillus iheyensis HTE831] gi|50897489|sp|Q8EL95|MT36_OCEIH RecName: Full=Putative modification methylase OB3336; AltName: Full=Cytosine-specific methyltransferase; AltName: Full=M.OihORF3336P gi|22779025|dbj|BAC15292.1| cytosine-specific methyltransferase [Oceanobacillus iheyensis HTE831] Length = 460 Score = 41.8 bits (98), Expect = 0.030, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIK 36 + A DFGVPQ R RL+++ + KF P P Sbjct: 177 LNAADFGVPQTRVRLFVMAIKKDIGKIKFIPEPTHKP 213 >gi|315657354|ref|ZP_07910236.1| modification methylase NgoPII [Mobiluncus curtisii subsp. holmesii ATCC 35242] gi|315491826|gb|EFU81435.1| modification methylase NgoPII [Mobiluncus curtisii subsp. holmesii ATCC 35242] Length = 355 Score = 41.8 bits (98), Expect = 0.031, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A ++GV + R+R++ I F +++F FP E K T+ + +W+ Sbjct: 148 VNAKNYGVAEERKRVFYIGFRKDLNIDFVFPKGST----------EDDAKKITLRDVIWD 197 >gi|313667096|gb|ADR72993.1| M1.BspMI [Bacillus sp. M(2010)] Length = 348 Score = 41.8 bits (98), Expect = 0.031, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 + D+GVPQ RER+ II E FP + G++ Sbjct: 158 LNMADYGVPQIRERVIIIG-NRLGEEIDFPEKDYSELPTGNL 198 >gi|304390097|ref|ZP_07372051.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii subsp. curtisii ATCC 35241] gi|304326579|gb|EFL93823.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii subsp. curtisii ATCC 35241] Length = 355 Score = 41.8 bits (98), Expect = 0.031, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A ++GV + R+R++ I F +++F FP E K T+ + +W+ Sbjct: 148 VNAKNYGVAEERKRVFYIGFRKDLNIDFVFPKGST----------EDDAKKITLRDVIWD 197 >gi|332704951|ref|ZP_08425037.1| DNA-methyltransferase (dcm) [Lyngbya majuscula 3L] gi|332356303|gb|EGJ35757.1| DNA-methyltransferase (dcm) [Lyngbya majuscula 3L] Length = 360 Score = 41.8 bits (98), Expect = 0.031, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 ++A +G+PQ RERL+ + L +F FP Sbjct: 150 LEAASYGIPQYRERLFFVG-LATKNDFTFPRKTH 182 >gi|170718974|ref|YP_001784137.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336] gi|168827103|gb|ACA32474.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336] Length = 323 Score = 41.8 bits (98), Expect = 0.031, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 22/57 (38%), Gaps = 13/57 (22%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + + +GVPQ RER+Y + ++FP KP +S+ Sbjct: 148 LDSQFYGVPQMRERVYFVGIRKDIKHKPYQFPEMEDAKPI-----------SYYLSD 193 >gi|315654722|ref|ZP_07907628.1| modification methylase NgoPII [Mobiluncus curtisii ATCC 51333] gi|315491186|gb|EFU80805.1| modification methylase NgoPII [Mobiluncus curtisii ATCC 51333] Length = 360 Score = 41.8 bits (98), Expect = 0.031, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 11/60 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A ++GV + R+R++ I F +++F FP E K T+ + +W+ Sbjct: 153 VNAKNYGVAEERKRVFYIGFRKDLNIDFVFPKGST----------EDDAKKITLRDVIWD 202 >gi|307825806|ref|ZP_07656022.1| DNA-cytosine methyltransferase [Methylobacter tundripaludum SV96] gi|307733114|gb|EFO03975.1| DNA-cytosine methyltransferase [Methylobacter tundripaludum SV96] Length = 359 Score = 41.8 bits (98), Expect = 0.031, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH 46 + A D+G+PQRR+R++I+ + +EF P + +E++ Sbjct: 161 LDARDYGLPQRRKRVFILGIRSD-IEFNSVWPPAATHGIEKEIEKN 205 >gi|323485262|ref|ZP_08090612.1| cytosine-specific methyltransferase [Clostridium symbiosum WAL-14163] gi|323401440|gb|EGA93788.1| cytosine-specific methyltransferase [Clostridium symbiosum WAL-14163] Length = 335 Score = 41.8 bits (98), Expect = 0.032, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILE-EHIDDKSTIS 54 + D+G+PQ RER + + L + +F+ +K + + LE + D ++ Sbjct: 167 LDCRDYGIPQARERCFTVSILGDNAFDFELMEKRPMK-NISNFLEYGDVPDCYLVT 221 >gi|254673893|emb|CBA09676.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis alpha275] Length = 326 Score = 41.8 bits (98), Expect = 0.033, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI-KPRLGD 41 + A DFGVPQ R R+ I + FP PL I +G Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGS 195 >gi|21226380|ref|NP_632302.1| DNA-cytosine methyltransferase [Methanosarcina mazei Go1] gi|20904635|gb|AAM29974.1| DNA-cytosine methyltransferase [Methanosarcina mazei Go1] Length = 423 Score = 41.8 bits (98), Expect = 0.033, Method: Composition-based stats. Identities = 20/85 (23%), Positives = 26/85 (30%), Gaps = 17/85 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-------------PRLGDILEEHI 47 + A DF V Q R R+ I + N + +P L P L Sbjct: 200 LNAKDFSVLQERNRIIFIGWKNEH-DLSYPDFLKTPLGRFHVSSLLNDLPPLQAGEGTEG 258 Query: 48 DDKSTISNKLW--EGHQKRKENNKI 70 K T W E Q+ K K Sbjct: 259 PAKYT-KPFSWSSEYLQRFKIREKK 282 >gi|308229522|gb|ADO24174.1| M.AclI [Acinetobacter calcoaceticus] Length = 458 Score = 41.8 bits (98), Expect = 0.033, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGD 41 + A D+GVPQ R R++ + N E FP G GD Sbjct: 272 VNAKDYGVPQSRARVFFLAIRNDIQSELGFPDAEGNNLTFGD 313 >gi|312903177|ref|ZP_07762357.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0635] gi|310633053|gb|EFQ16336.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0635] Length = 398 Score = 41.8 bits (98), Expect = 0.034, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + + D+ VPQ RER++II FP + ++ + K T Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGERTRKVFPLEKKNGTTAKNNIKPINNSKKT 198 >gi|119483468|ref|ZP_01618882.1| site-specific DNA-methyltransferase [Lyngbya sp. PCC 8106] gi|119458235|gb|EAW39357.1| site-specific DNA-methyltransferase [Lyngbya sp. PCC 8106] Length = 407 Score = 41.8 bits (98), Expect = 0.034, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 + A D+G+PQ R RL+I+ V+ P P Sbjct: 157 LNATDYGIPQNRRRLFIVA---SKVKITHPFPPSTHT 190 >gi|157164246|ref|YP_001466260.1| modification methylase HaeIII (cytosine-specificmethyltransferase HaeIII; M.HaeIII) [Campylobacter concisus 13826] gi|112801543|gb|EAT98887.1| modification methylase HaeIII (Cytosine-specificmethyltransferase HaeIII) (M.HaeIII) [Campylobacter concisus 13826] Length = 388 Score = 41.8 bits (98), Expect = 0.035, Method: Composition-based stats. Identities = 11/23 (47%), Positives = 14/23 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A DFGVPQ R+R+ II Sbjct: 171 LNAVDFGVPQDRKRIIIIGTRKD 193 >gi|86360841|ref|YP_472728.1| DNA (cytosine-5-)-methyltransferase protein [Rhizobium etli CFN 42] gi|86284943|gb|ABC94001.1| probable DNA (cytosine-5-)-methyltransferase protein [Rhizobium etli CFN 42] Length = 504 Score = 41.8 bits (98), Expect = 0.035, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLG 34 + A +GVPQ RER+ +I + +FP P Sbjct: 186 LNAAFYGVPQMRERMILIAIRKELADDVEFPAPTH 220 >gi|46019827|emb|CAE52349.1| putative cytosine-specific methyltransferase [Streptococcus thermophilus] Length = 408 Score = 41.4 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 17/35 (48%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL 39 DFGVPQ+R+R+ II + + L L Sbjct: 189 DFGVPQKRKRVIIIGVRRDNQSTDYQEILNQIYSL 223 >gi|332968936|gb|EGK07982.1| DNA-cytosine methyltransferase [Desmospora sp. 8437] Length = 379 Score = 41.4 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE 44 + A D+GVPQ R R +I+ FP +ILE Sbjct: 148 LCAADYGVPQTRYRAFIVG-SKLDTPLNFPPQKTHYNPDKNILE 190 >gi|254804928|ref|YP_003083149.1| putative type II DNA modification methylase [Neisseria meningitidis alpha14] gi|254668470|emb|CBA05754.1| putative type II DNA modification methylase [Neisseria meningitidis alpha14] Length = 312 Score = 41.4 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLW 58 + A D+GV Q R R+ + N + FK+P P +P+ +G++L + +S W Sbjct: 144 LYAADYGVSQLRPRVLFVALKNEYTNFFKWPEPNSEQPKTVGELLFD------LMSENNW 197 Query: 59 EGHQKRKEN 67 +G + Sbjct: 198 QGAHNWRLK 206 >gi|312142618|ref|YP_003994064.1| DNA-cytosine methyltransferase [Halanaerobium sp. 'sapolanicus'] gi|311903269|gb|ADQ13710.1| DNA-cytosine methyltransferase [Halanaerobium sp. 'sapolanicus'] Length = 406 Score = 41.4 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 20/89 (22%), Positives = 35/89 (39%), Gaps = 15/89 (16%) Query: 17 IIDFLNPSVEFK---FPTPLG--IKPRLGDILEEHIDDKSTISNKL---WEGHQKRKENN 68 I F + P +G K ++ DILE ++ + +S+K WE + K Sbjct: 240 IAGFQKDGEIYTSAVDPKEVGEAKKTKIKDILESNVPKRYYLSDKELEDWEYMKGAKAEK 299 Query: 69 KIAGKGFGY-----GLFFENS--ATTNTL 90 ++A G Y + F +S T+ Sbjct: 300 RVAKNGHEYTFREGAIPFPDSVDEPARTI 328 >gi|254416032|ref|ZP_05029788.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196177207|gb|EDX72215.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 398 Score = 41.4 bits (97), Expect = 0.037, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A FG+PQ R+R++ + F + + +PL Sbjct: 210 LSAPSFGIPQMRKRVFFVGFRQEKMASNYQSPLPTH 245 >gi|268611036|ref|ZP_06144763.1| prophage LambdaSa2, type II DNA modification methyltransferase, putative [Ruminococcus flavefaciens FD-1] Length = 425 Score = 41.4 bits (97), Expect = 0.038, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 16/22 (72%) Query: 1 MKACDFGVPQRRERLYIIDFLN 22 + + +FGV Q R+R++II FL Sbjct: 146 LNSANFGVAQARKRVFIIGFLR 167 >gi|194098495|ref|YP_002001557.1| DNA modification methylase [Neisseria gonorrhoeae NCCP11945] gi|239998889|ref|ZP_04718813.1| DNA modification methylase [Neisseria gonorrhoeae 35/02] gi|240115566|ref|ZP_04729628.1| DNA modification methylase [Neisseria gonorrhoeae PID18] gi|240125661|ref|ZP_04738547.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679] gi|254493672|ref|ZP_05106843.1| DNA modification methylase [Neisseria gonorrhoeae 1291] gi|260440624|ref|ZP_05794440.1| DNA modification methylase [Neisseria gonorrhoeae DGI2] gi|268594728|ref|ZP_06128895.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae 35/02] gi|268601236|ref|ZP_06135403.1| DNA modification methylase [Neisseria gonorrhoeae PID18] gi|268684247|ref|ZP_06151109.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679] gi|291043935|ref|ZP_06569651.1| DNA modification methylase [Neisseria gonorrhoeae DGI2] gi|193933785|gb|ACF29609.1| DNA modification methylase [Neisseria gonorrhoeae NCCP11945] gi|226512712|gb|EEH62057.1| DNA modification methylase [Neisseria gonorrhoeae 1291] gi|268548117|gb|EEZ43535.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae 35/02] gi|268585367|gb|EEZ50043.1| DNA modification methylase [Neisseria gonorrhoeae PID18] gi|268624531|gb|EEZ56931.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679] gi|291012398|gb|EFE04387.1| DNA modification methylase [Neisseria gonorrhoeae DGI2] gi|317164179|gb|ADV07720.1| DNA modification methylase [Neisseria gonorrhoeae TCDC-NG08107] Length = 312 Score = 41.4 bits (97), Expect = 0.038, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLW 58 + A D+GV Q R R+ + N + FK+P P +P+ +G++L + +S W Sbjct: 144 LYAADYGVSQLRPRVLFVALKNEYTNFFKWPEPNSEQPKTVGELLFD------LMSENNW 197 Query: 59 EGHQKRKEN 67 +G + Sbjct: 198 QGAHNWRLK 206 >gi|59801274|ref|YP_207986.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA 1090] gi|240014199|ref|ZP_04721112.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae DGI18] gi|240016634|ref|ZP_04723174.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA6140] gi|240080823|ref|ZP_04725366.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA19] gi|240112810|ref|ZP_04727300.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae MS11] gi|240117858|ref|ZP_04731920.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae PID1] gi|240121762|ref|ZP_04734724.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae PID24-1] gi|240123416|ref|ZP_04736372.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae PID332] gi|240128118|ref|ZP_04740779.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae SK-93-1035] gi|268596944|ref|ZP_06131111.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA19] gi|268598881|ref|ZP_06133048.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae MS11] gi|268603557|ref|ZP_06137724.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae PID1] gi|268682037|ref|ZP_06148899.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae PID332] gi|268686505|ref|ZP_06153367.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae SK-93-1035] gi|293399137|ref|ZP_06643302.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] gi|5051442|emb|CAB44950.1| DNA modification methylase [Neisseria gonorrhoeae] gi|5262959|emb|CAB45015.2| DNA modification methylase [Neisseria gonorrhoeae] gi|59718169|gb|AAW89574.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA 1090] gi|268550732|gb|EEZ45751.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA19] gi|268583012|gb|EEZ47688.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae MS11] gi|268587688|gb|EEZ52364.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae PID1] gi|268622321|gb|EEZ54721.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae PID332] gi|268626789|gb|EEZ59189.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae SK-93-1035] gi|291610551|gb|EFF39661.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62] Length = 312 Score = 41.4 bits (97), Expect = 0.038, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 8/69 (11%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLW 58 + A D+GV Q R R+ + N + FK+P P +P+ +G++L + +S W Sbjct: 144 LYAADYGVSQLRPRVLFVALKNEYTNFFKWPEPNSEQPKTVGELLFD------LMSENNW 197 Query: 59 EGHQKRKEN 67 +G + Sbjct: 198 QGAHNWRLK 206 >gi|256419690|ref|YP_003120343.1| DNA-cytosine methyltransferase [Chitinophaga pinensis DSM 2588] gi|256034598|gb|ACU58142.1| DNA-cytosine methyltransferase [Chitinophaga pinensis DSM 2588] Length = 390 Score = 41.4 bits (97), Expect = 0.039, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 + + D+ VPQ R+R ++ L +F FP Sbjct: 162 VNSADYRVPQNRKRFMLVGVLKGK-KFIFPEAP 193 >gi|168467807|ref|ZP_02701644.1| Dmt [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|195629099|gb|EDX48473.1| Dmt [Salmonella enterica subsp. enterica serovar Newport str. SL317] Length = 819 Score = 41.4 bits (97), Expect = 0.039, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 5/43 (11%) Query: 1 MKACDFGVPQRRERLYII-----DFLNPSVEFKFPTPLGIKPR 38 + A FGVPQRR R++++ F ++ F+F P Sbjct: 198 LDAEYFGVPQRRHRVFVVGSAGEGFDPETILFEFEGVRRNTPP 240 >gi|307290179|ref|ZP_07570098.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0411] gi|306498807|gb|EFM68305.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0411] Length = 416 Score = 41.4 bits (97), Expect = 0.039, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS 24 + + D+ VPQ RER++II L Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGK 169 >gi|206972356|ref|ZP_03233302.1| modification methylase [Bacillus cereus AH1134] gi|206732681|gb|EDZ49857.1| modification methylase [Bacillus cereus AH1134] Length = 309 Score = 41.4 bits (97), Expect = 0.040, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 8/53 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL-----GIKPRLGDILEEHID 48 + DF +PQ+R+RL++I F F P P + + DI E + D Sbjct: 154 LDTFDFNLPQKRKRLFVIGFKK---SFSMPDPTQFQFFHRQLTIKDIKETNPD 203 >gi|315162212|gb|EFU06229.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0645] Length = 398 Score = 41.4 bits (97), Expect = 0.041, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + + D+ VPQ RER++II FP + + + K T Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGERTRKVFPFERKNGTTAKNNIRPINNSKKT 198 >gi|257081612|ref|ZP_05575973.1| C-5 cytosine-specific DNA methylase [Enterococcus faecalis E1Sol] gi|256989642|gb|EEU76944.1| C-5 cytosine-specific DNA methylase [Enterococcus faecalis E1Sol] Length = 398 Score = 41.4 bits (97), Expect = 0.041, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + + D+ VPQ RER++II FP + ++ + K T Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGERTRKVFPLERKNGTTAKNNIKPINNSKKT 198 >gi|290968468|ref|ZP_06560007.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1 str. 28L] gi|290781464|gb|EFD94053.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1 str. 28L] Length = 699 Score = 41.4 bits (97), Expect = 0.042, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-LGIKPRLGDILEE 45 ++A D+GVPQ RER+ + N ++ P P + + D +E+ Sbjct: 488 VRASDYGVPQNRERVIFLCSKNKAI--SLPEPTVKKTTTVRDAIED 531 >gi|197124335|ref|YP_002136286.1| DNA-cytosine methyltransferase [Anaeromyxobacter sp. K] gi|196174184|gb|ACG75157.1| DNA-cytosine methyltransferase [Anaeromyxobacter sp. K] Length = 508 Score = 41.4 bits (97), Expect = 0.042, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A +GVPQ RER++ I Sbjct: 177 LNAAMYGVPQLRERIFFIGIRKD 199 >gi|325478716|gb|EGC81827.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus prevotii ACS-065-V-Col13] Length = 480 Score = 41.4 bits (97), Expect = 0.043, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGVPQRR+R++++ Sbjct: 175 LDAKYFGVPQRRKRIFLVA 193 >gi|317126940|ref|YP_004093222.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522] gi|315471888|gb|ADU28491.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522] Length = 382 Score = 41.4 bits (97), Expect = 0.043, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Query: 5 DFGVPQRRERLYIIDFLNP----SVEFKFPTPLGI-----KPRLGDILEEHIDD 49 ++GVPQ R R+ I+ N +EFK P P + K ILE I + Sbjct: 167 EYGVPQARHRIIIVGIRNDLAKEGIEFKVPAPTTLASTEYKTSRQAILEPPIPE 220 >gi|150400370|ref|YP_001324137.1| DNA-cytosine methyltransferase [Methanococcus vannielii SB] gi|150013073|gb|ABR55525.1| DNA-cytosine methyltransferase [Methanococcus vannielii SB] Length = 368 Score = 41.4 bits (97), Expect = 0.044, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 6/60 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + D+GVPQ R R+ I+ N V + +P P+ R + L E + K I + LW+ Sbjct: 190 LNTADYGVPQTRIRVIIMGIRNDYVGDIMYPKPV----RGNEGLFEWMTSKEAI-DDLWD 244 >gi|24527986|emb|CAD33713.1| putative DNA methylase [Escherichia coli] Length = 310 Score = 41.4 bits (97), Expect = 0.044, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPR 38 + D+GVPQ R R+ I+ + + FP P + Sbjct: 142 LNCADYGVPQTRMRVIILGVRKDLPDIENFPPPKTHEKE 180 >gi|304388871|ref|ZP_07370921.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC 13091] gi|302028149|gb|ADK90963.1| unknown [Neisseria meningitidis] gi|304337164|gb|EFM03348.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC 13091] gi|316985914|gb|EFV64853.1| modification methylase HphIA [Neisseria meningitidis H44/76] gi|325143322|gb|EGC65656.1| cytosine-specificmethyltransferase HphIA [Neisseria meningitidis 961-5945] Length = 276 Score = 41.4 bits (97), Expect = 0.045, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A DFGVPQ R R+ I + FP PL I Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQI 188 >gi|255972594|ref|ZP_05423180.1| C-5 cytosine-specific DNA methylase [Enterococcus faecalis T1] gi|256762698|ref|ZP_05503278.1| C-5 cytosine-specific DNA methylase [Enterococcus faecalis T3] gi|257422413|ref|ZP_05599403.1| C-5 cytosine-specific DNA methylase [Enterococcus faecalis X98] gi|255963612|gb|EET96088.1| C-5 cytosine-specific DNA methylase [Enterococcus faecalis T1] gi|256683949|gb|EEU23644.1| C-5 cytosine-specific DNA methylase [Enterococcus faecalis T3] gi|257164237|gb|EEU94197.1| C-5 cytosine-specific DNA methylase [Enterococcus faecalis X98] Length = 351 Score = 41.4 bits (97), Expect = 0.045, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIK 36 + + D+ VPQ RER++II FP + Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGERTRKVFPFKKNDR 182 >gi|261420917|ref|YP_003254598.1| DNA-cytosine methyltransferase [Geobacillus sp. Y412MC61] gi|319768595|ref|YP_004134095.1| DNA-cytosine methyltransferase [Geobacillus sp. Y412MC52] gi|261377375|gb|ACX80116.1| DNA-cytosine methyltransferase [Geobacillus sp. Y412MC61] gi|317113461|gb|ADU95952.1| DNA-cytosine methyltransferase [Geobacillus sp. Y412MC52] Length = 370 Score = 41.4 bits (97), Expect = 0.045, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 9/52 (17%) Query: 5 DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 ++GVPQ R R+ I+ +++FK P P ++++ K I+N Sbjct: 165 EYGVPQMRHRIIIVGIRKDLNLKFKVPAPTTP--------DKYVTAKEAITN 208 >gi|170718749|ref|YP_001783936.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336] gi|168826878|gb|ACA32249.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336] Length = 372 Score = 41.4 bits (97), Expect = 0.045, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 +FGVPQ RER+ I+ F F P+ Sbjct: 159 NFAEFGVPQFRERVLIVGVR-LDTGFNFQHPMPTH 192 >gi|311977229|gb|ADQ20489.1| M.AspCNI [Acinetobacter sp. 1690] Length = 327 Score = 41.4 bits (97), Expect = 0.046, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 8/54 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53 + D+GV Q RER+ I+ VEF+ P + ++ K + Sbjct: 148 VNFADYGVAQLRERVLIVGVRKDLDVEFEAPKKTHSP-------DSYVPSKEAL 194 >gi|159477134|ref|XP_001696666.1| cytosine-C5 specific DNA methyltransferase [Chlamydomonas reinhardtii] gi|158282891|gb|EDP08643.1| cytosine-C5 specific DNA methyltransferase [Chlamydomonas reinhardtii] Length = 1333 Score = 41.0 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A ++GVPQ R+R++II L V +P P+ Sbjct: 994 LNAGNYGVPQSRQRVFIIAALPEEVLPNWPRPMHS 1028 >gi|313144510|ref|ZP_07806703.1| cytosine specific DNA methyltransferase [Helicobacter cinaedi CCUG 18818] gi|313129541|gb|EFR47158.1| cytosine specific DNA methyltransferase [Helicobacter cinaedi CCUG 18818] Length = 323 Score = 41.0 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHID 48 + + DF + Q RER+Y + +F F + K L + L D Sbjct: 145 LNSLDFALAQARERVYFVGIRKDKKRDFSF-SQRMTKKALKEFLTPKQD 192 >gi|298377907|ref|ZP_06987856.1| DNA (cytosine-5-)-methyltransferase [Bacteroides sp. 3_1_19] gi|298265151|gb|EFI06815.1| DNA (cytosine-5-)-methyltransferase [Bacteroides sp. 3_1_19] Length = 409 Score = 41.0 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPT 31 A D+ VPQ RER+ +I N +F Sbjct: 201 DAYDYDVPQHRERVILIGIRNGE-DFTLED 229 >gi|110643909|ref|YP_671639.1| putative type II 5-cytosoine methyltransferase [Escherichia coli 536] gi|110345501|gb|ABG71738.1| putative type II 5-cytosoine methyltransferase [Escherichia coli 536] Length = 305 Score = 41.0 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 11/39 (28%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPR 38 + D+GVPQ R R+ I+ + + FP P + Sbjct: 137 LNCADYGVPQTRMRVIILGVRKDLPDIENFPPPKTHEKE 175 >gi|254671508|emb|CBA09095.1| site-specific DNA-methyltransferase [Neisseria meningitidis alpha153] Length = 258 Score = 41.0 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A DFGVPQ R R+ I + FP PL I Sbjct: 137 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQI 170 >gi|158339669|ref|YP_001520676.1| C-5 cytosine-specific DNA methylase [Acaryochloris marina MBIC11017] gi|158309910|gb|ABW31526.1| C-5 cytosine-specific DNA methylase [Acaryochloris marina MBIC11017] Length = 382 Score = 41.0 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 6/50 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF-KFPT-----PLGIKPRLGDILE 44 + A DFGVPQRR R++II FP PL + + D+LE Sbjct: 154 LDASDFGVPQRRLRIFIIGSRLDLGWKPIFPKSKTKIPLTVGEAISDLLE 203 >gi|152974572|ref|YP_001374089.1| DNA-cytosine methyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98] gi|152023324|gb|ABS21094.1| DNA-cytosine methyltransferase [Bacillus cytotoxicus NVH 391-98] Length = 371 Score = 41.0 bits (96), Expect = 0.048, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 11/59 (18%) Query: 5 DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK----------PRLGDILEEHIDDKST 52 ++GVPQ R R+ I+ N +VE++ P P L DI E+ + + T Sbjct: 166 EYGVPQARHRIIIVGIRNDMNVEYRVPAPTHGPGREHPYVTASQALEDIPEDAPNHEFT 224 >gi|224438066|ref|ZP_03659005.1| DNA-cytosine methyltransferase [Helicobacter cinaedi CCUG 18818] Length = 342 Score = 41.0 bits (96), Expect = 0.049, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHID 48 + + DF + Q RER+Y + +F F + K L + L D Sbjct: 164 LNSLDFALAQARERVYFVGIRKDKKRDFSF-SQRMTKKALKEFLTPKQD 211 >gi|52841468|ref|YP_095267.1| modification methylase (Eco47II, Sau96I) [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52628579|gb|AAU27320.1| modification methylase (Eco47II, Sau96I) [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 416 Score = 41.0 bits (96), Expect = 0.049, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDD---KST 52 ++A VPQ+RERL ++ FP L + L++ D K T Sbjct: 222 LRAQYLDVPQKRERLVMLGIRKDLKGTIAFPKEQDYTISLREALKDVPDAPGQKYT 277 >gi|126700764|ref|YP_001089661.1| putative DNA-methyltransferase [Clostridium difficile 630] gi|115252201|emb|CAJ70040.1| putative DNA-methyltransferase [Clostridium difficile] Length = 541 Score = 41.0 bits (96), Expect = 0.050, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + + D+GVPQ RER +I Sbjct: 314 LNSIDYGVPQNRERFVLIG 332 >gi|313201769|ref|YP_004040427.1| modification methylase [Methylovorus sp. MP688] gi|312441085|gb|ADQ85191.1| putative modification methylase [Methylovorus sp. MP688] Length = 378 Score = 41.0 bits (96), Expect = 0.051, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 17/35 (48%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A FG+PQ R+RL+I + + + I Sbjct: 142 INAIHFGLPQNRQRLFITGIRDHEPKIRLLPKSDI 176 >gi|228989002|ref|ZP_04149032.1| DNA-cytosine methyltransferase [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|228770724|gb|EEM19259.1| DNA-cytosine methyltransferase [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] Length = 445 Score = 41.0 bits (96), Expect = 0.051, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 27/52 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 M+A D+GVPQ RER+ +I + F L LG++L++ + + Sbjct: 165 MQAHDYGVPQLRERVIVIGTKSNINPFSVIPKLDGPRTLGEVLKDCPESEFF 216 >gi|258652183|ref|YP_003201339.1| DNA-cytosine methyltransferase [Nakamurella multipartita DSM 44233] gi|258555408|gb|ACV78350.1| DNA-cytosine methyltransferase [Nakamurella multipartita DSM 44233] Length = 467 Score = 41.0 bits (96), Expect = 0.052, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 30/66 (45%), Gaps = 6/66 (9%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL-EEHIDDKSTISN-----KLW 58 +FG+PQ R+R Y + + +F++P + +L + +D + + +W Sbjct: 158 EFGIPQIRDRAYFVGSRDGLEQFRWPETEKSSTDIKSVLKHDLVDVRPIPAQTTHAINMW 217 Query: 59 EGHQKR 64 + KR Sbjct: 218 DDFLKR 223 >gi|302873652|ref|YP_003842285.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] gi|307686624|ref|ZP_07629070.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] gi|302576509|gb|ADL50521.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] Length = 445 Score = 41.0 bits (96), Expect = 0.053, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 11/70 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 M A ++GVPQRR R+ I + + V ++P P + + K TI + + + Sbjct: 182 MDAANYGVPQRRNRVIFIAYRDDVVAPQYPEPTVTE-----------ETKLTIEDAITDL 230 Query: 61 HQKRKENNKI 70 ++R+ N+I Sbjct: 231 IRERRVRNRI 240 >gi|329960681|ref|ZP_08299024.1| DNA (cytosine-5-)-methyltransferase [Bacteroides fluxus YIT 12057] gi|328532554|gb|EGF59348.1| DNA (cytosine-5-)-methyltransferase [Bacteroides fluxus YIT 12057] Length = 572 Score = 41.0 bits (96), Expect = 0.054, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 17/25 (68%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV 25 + A D+G+PQRR R YI+ + SV Sbjct: 163 INAADYGMPQRRRRTYIVGYRKGSV 187 >gi|323454079|gb|EGB09949.1| hypothetical protein AURANDRAFT_62427 [Aureococcus anophagefferens] Length = 634 Score = 41.0 bits (96), Expect = 0.054, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Query: 8 VPQRRERLYIIDFLNPSV---EFKFPTPLGIKPR-LGDILEEHIDD 49 +PQ RER+YI+ F++P PR + D+LE+ D Sbjct: 353 LPQARERVYIVAIRADLAAARRFRWPALERRGPRSIRDVLEDPPDA 398 >gi|306835815|ref|ZP_07468812.1| modification methylase NaeI [Corynebacterium accolens ATCC 49726] gi|304568289|gb|EFM43857.1| modification methylase NaeI [Corynebacterium accolens ATCC 49726] Length = 345 Score = 41.0 bits (96), Expect = 0.055, Method: Composition-based stats. Identities = 12/46 (26%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEE 45 ++A ++GVPQ R R ++ E F +P + + +G+ L++ Sbjct: 154 LQAANYGVPQLRPRFILVALKKEFSEFFAWPNKVPHQVTVGEALKD 199 >gi|253997214|ref|YP_003049278.1| DNA-cytosine methyltransferase [Methylotenera mobilis JLW8] gi|253983893|gb|ACT48751.1| DNA-cytosine methyltransferase [Methylotenera mobilis JLW8] Length = 358 Score = 41.0 bits (96), Expect = 0.056, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 5 DFGVPQRRERLYIIDFL-NPSVEFKFPTPLGI 35 ++G+PQ R R+ ++ F + +++F P P Sbjct: 168 EYGIPQSRHRIILVGFRSDLNIKFSPPAPTHK 199 >gi|323484104|ref|ZP_08089474.1| hypothetical protein HMPREF9474_01225 [Clostridium symbiosum WAL-14163] gi|323402546|gb|EGA94874.1| hypothetical protein HMPREF9474_01225 [Clostridium symbiosum WAL-14163] Length = 430 Score = 41.0 bits (96), Expect = 0.056, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + + D GVPQ RER++ I Sbjct: 151 LNSKDHGVPQNRERVFFIA 169 >gi|320527420|ref|ZP_08028601.1| DNA (cytosine-5-)-methyltransferase [Solobacterium moorei F0204] gi|320132133|gb|EFW24682.1| DNA (cytosine-5-)-methyltransferase [Solobacterium moorei F0204] Length = 428 Score = 41.0 bits (96), Expect = 0.057, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 A +FGV Q R R+ I+ +L S K+P L I+ Sbjct: 207 NARNFGVLQNRRRMIIVGWLKES-GLKYPDFLKIE 240 >gi|310657622|ref|YP_003935343.1| cytosine-specific methyltransferase [Clostridium sticklandii DSM 519] gi|308824400|emb|CBH20438.1| Cytosine-specific methyltransferase [Clostridium sticklandii] Length = 344 Score = 41.0 bits (96), Expect = 0.057, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 A D+GVPQ R+R+ + + EF+FP + Sbjct: 150 ASDYGVPQSRKRVIFVG--HQDKEFEFPEKMNTYVT 183 >gi|257421714|ref|ZP_05598704.1| predicted protein [Enterococcus faecalis X98] gi|257163538|gb|EEU93498.1| predicted protein [Enterococcus faecalis X98] Length = 286 Score = 41.0 bits (96), Expect = 0.057, Method: Composition-based stats. Identities = 25/99 (25%), Positives = 39/99 (39%), Gaps = 18/99 (18%) Query: 4 CDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID---DKSTISNKLWEG 60 +F +PQ R+RL +I P + +P + RL DILE++ + S++L G Sbjct: 141 ANFWLPQERKRLIVIGSKRPFPKLDYPGQI-TNLRLKDILEKNPNVSIPDYV-SSRL-NG 197 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99 + K + T A Y KD S Sbjct: 198 KYRDKP------------IITNLDGIAPTAVAHYAKDKS 224 >gi|153870986|ref|ZP_02000267.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS] gi|152072545|gb|EDN69730.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS] Length = 350 Score = 41.0 bits (96), Expect = 0.059, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A D+G PQ+R RL+ + N F+FP P + Sbjct: 266 LMAADYGTPQKRRRLFFVA-ANDLQGFQFPAPTHCE 300 >gi|109947738|ref|YP_664966.1| site-specific DNA methyltransferase [Helicobacter acinonychis str. Sheeba] gi|109714959|emb|CAJ99967.1| site-specific DNA methyltransferase [Helicobacter acinonychis str. Sheeba] Length = 327 Score = 41.0 bits (96), Expect = 0.060, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 24/60 (40%), Gaps = 13/60 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R R++ I F + + P RL T+ + +W+ Sbjct: 144 VNAKDYGVAQERLRVFYIGFRRDLKINYTLPKGSTHLKRL------------TLKDVIWD 191 >gi|145641419|ref|ZP_01796998.1| cytosine specific DNA methyltransferase (BSP6IM) [Haemophilus influenzae R3021] gi|145273962|gb|EDK13829.1| cytosine specific DNA methyltransferase (BSP6IM) [Haemophilus influenzae 22.4-21] Length = 298 Score = 40.7 bits (95), Expect = 0.060, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP 32 + + +G PQ RER+Y + ++ FP P Sbjct: 121 LDSQFYGTPQMRERIYFVGIRKDIHHSDYIFPEP 154 >gi|268589649|ref|ZP_06123870.1| modification methylase Eco47II [Providencia rettgeri DSM 1131] gi|291314961|gb|EFE55414.1| modification methylase Eco47II [Providencia rettgeri DSM 1131] Length = 424 Score = 40.7 bits (95), Expect = 0.062, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 +KA + VPQ+RERL ++ S+++ +P+P + D L Sbjct: 219 LKAIFYQVPQKRERLILVAIRKDLVNSIKYDWPSPYHKVMTMRDAL 264 >gi|170077471|ref|YP_001734109.1| site-specific DNA-methyltransferase [Synechococcus sp. PCC 7002] gi|169885140|gb|ACA98853.1| site-specific DNA-methyltransferase [Synechococcus sp. PCC 7002] Length = 413 Score = 40.7 bits (95), Expect = 0.062, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 + D+G PQRR+RL ++ + +P P Sbjct: 158 LNGADYGAPQRRKRLILLGYRRDVPSVAYPAPSH 191 >gi|86151502|ref|ZP_01069717.1| type II DNA-methyltransferase [Campylobacter jejuni subsp. jejuni 260.94] gi|85841849|gb|EAQ59096.1| type II DNA-methyltransferase [Campylobacter jejuni subsp. jejuni 260.94] Length = 187 Score = 40.7 bits (95), Expect = 0.062, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK 28 + A DFGVPQ R+R ++I +F Sbjct: 153 LNALDFGVPQNRQRAFLIASKIFKFDFS 180 >gi|318042684|ref|ZP_07974640.1| DNA-cytosine methyltransferase [Synechococcus sp. CB0101] Length = 361 Score = 40.7 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + DFG+ Q R R ++ + F+F +P Sbjct: 152 NSADFGLAQTRHRFMLVGIRRD-IGFRFLSPPPT 184 >gi|308063355|gb|ADO05242.1| site-specific DNA methyltransferase [Helicobacter pylori Sat464] Length = 327 Score = 40.7 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 13/60 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R R++ I F + + FP +L T+ + +W+ Sbjct: 144 VNAKDYGVAQERLRVFYIGFRKDLKINYIFPKGSTHLKKL------------TLKDVIWD 191 >gi|315586485|gb|ADU40866.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 35A] gi|317178791|dbj|BAJ56579.1| Type II modification enzyme [Helicobacter pylori F30] Length = 327 Score = 40.7 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 13/60 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R R++ I F + + FP +L T+ + +W+ Sbjct: 144 VNAKDYGVAQERLRVFYIGFRKDLKINYIFPKGSTHLKKL------------TLKDVIWD 191 >gi|217034513|ref|ZP_03439924.1| hypothetical protein HP9810_873g29 [Helicobacter pylori 98-10] gi|216943054|gb|EEC22533.1| hypothetical protein HP9810_873g29 [Helicobacter pylori 98-10] Length = 327 Score = 40.7 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 13/60 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R R++ I F + + FP +L T+ + +W+ Sbjct: 144 VNAKDYGVAQERLRVFYIGFRKDLKINYIFPKGSTHLKKL------------TLKDVIWD 191 >gi|169829195|ref|YP_001699353.1| modification methylase SPRI [Lysinibacillus sphaericus C3-41] gi|168993683|gb|ACA41223.1| Modification methylase SPRI [Lysinibacillus sphaericus C3-41] Length = 418 Score = 40.7 bits (95), Expect = 0.065, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 6/36 (16%) Query: 1 MKACDFGV-----PQRRERLYIIDFLNPSVEFK-FP 30 + DF PQ RER++I+ L + + FP Sbjct: 148 LNTKDFSTKERPTPQNRERIFIVGHLRGTSTREVFP 183 >gi|217033005|ref|ZP_03438476.1| hypothetical protein HPB128_151g1 [Helicobacter pylori B128] gi|298736554|ref|YP_003729080.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8] gi|216945262|gb|EEC23940.1| hypothetical protein HPB128_151g1 [Helicobacter pylori B128] gi|298355744|emb|CBI66616.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8] Length = 327 Score = 40.7 bits (95), Expect = 0.067, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 13/60 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R R++ I F V + FP +L T+ + +W+ Sbjct: 144 VNAKDYGVAQERLRVFYIGFRRDLKVNYIFPKGSTHLKKL------------TLKDVIWD 191 >gi|147919344|ref|YP_686920.1| C-5 cytosine-specific DNA methyltransferase [uncultured methanogenic archaeon RC-I] gi|110622316|emb|CAJ37594.1| C-5 cytosine-specific DNA methyltransferase [uncultured methanogenic archaeon RC-I] Length = 419 Score = 40.7 bits (95), Expect = 0.067, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR--LGDILEEHIDDK 50 + A +F V Q R+R+ II + +P + + D+L + + K Sbjct: 200 LNASNFNVLQNRKRIIIIGWKKE-YNLSYPDFAKSQTPYIINDLLSDLPELK 250 >gi|57116673|gb|AAW33810.1| M.HinP1I methyltransferase [Haemophilus influenzae] Length = 322 Score = 40.7 bits (95), Expect = 0.067, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP 32 + + +G PQ RER+Y + ++ FP P Sbjct: 145 LDSQFYGTPQMRERIYFVGIRKDIHHSDYVFPEP 178 >gi|51245886|ref|YP_065770.1| modification methylase [Desulfotalea psychrophila LSv54] gi|50876923|emb|CAG36763.1| probable modification methylase [Desulfotalea psychrophila LSv54] Length = 360 Score = 40.7 bits (95), Expect = 0.067, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 5 DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGI 35 ++GVPQ R R+ I+ + EFK P P Sbjct: 167 EYGVPQARHRIIIVGIRKDLNTEFKVPAPTTP 198 >gi|317180612|dbj|BAJ58398.1| Type II modification enzyme [Helicobacter pylori F32] Length = 327 Score = 40.7 bits (95), Expect = 0.068, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 13/60 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R R++ I F V + FP +L T+ + +W+ Sbjct: 144 VNAKDYGVAQERLRVFYIGFRKDLKVNYIFPKGSTHLKKL------------TLKDVIWD 191 >gi|308184264|ref|YP_003928397.1| type II DNA modification enzyme [Helicobacter pylori SJM180] gi|308060184|gb|ADO02080.1| type II DNA modification enzyme [Helicobacter pylori SJM180] Length = 188 Score = 40.7 bits (95), Expect = 0.069, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A D+G PQ RER++++ Sbjct: 145 LNALDYGAPQVRERVFLVG 163 >gi|188527304|ref|YP_001909991.1| site-specific DNA methyltransferase [Helicobacter pylori Shi470] gi|188143544|gb|ACD47961.1| site-specific DNA methyltransferase [Helicobacter pylori Shi470] Length = 327 Score = 40.7 bits (95), Expect = 0.069, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 13/60 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+GV Q R R++ I F + + FP +L T+ + +W+ Sbjct: 144 VNAKDYGVAQERLRVFYIGFRKDLKINYIFPKGSTHLKKL------------TLKDVIWD 191 >gi|322418052|ref|YP_004197275.1| DNA-cytosine methyltransferase [Geobacter sp. M18] gi|320124439|gb|ADW11999.1| DNA-cytosine methyltransferase [Geobacter sp. M18] Length = 385 Score = 40.7 bits (95), Expect = 0.069, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRL 39 + A D+G Q+R R+ I N ++ P P + RL Sbjct: 174 VNAADYGAAQKRHRVIIAGIRNDLGIKLNLPAPTHSRERL 213 >gi|295110825|emb|CBL24778.1| DNA-methyltransferase (dcm) [Ruminococcus obeum A2-162] Length = 311 Score = 40.7 bits (95), Expect = 0.073, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIK 36 + ++GVPQ R+R+ II E F+FP P K Sbjct: 142 VNMANYGVPQTRQRVLIIGQRKDYGEEMLFQFPQPTFSK 180 >gi|241661827|ref|YP_002980187.1| DNA-cytosine methyltransferase [Ralstonia pickettii 12D] gi|240863854|gb|ACS61515.1| DNA-cytosine methyltransferase [Ralstonia pickettii 12D] Length = 398 Score = 40.7 bits (95), Expect = 0.073, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK 28 + A ++GVPQRR R++++ N ++F Sbjct: 199 LDARNYGVPQRRVRVFVLGVRND-IDFD 225 >gi|270157659|ref|ZP_06186316.1| DNA-cytosine methyltransferase family protein [Legionella longbeachae D-4968] gi|269989684|gb|EEZ95938.1| DNA-cytosine methyltransferase family protein [Legionella longbeachae D-4968] Length = 414 Score = 40.7 bits (95), Expect = 0.075, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILE---EHIDDKST 52 ++A VPQ+RERL II +P L L+ E K T Sbjct: 222 LRAQYLDVPQKRERLVIIGIRKDLQGNIAYPREQDYTVSLRQALQNVPESPGQKYT 277 >gi|228950066|ref|ZP_04112251.1| DNA-cytosine methyltransferase [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228809593|gb|EEM56029.1| DNA-cytosine methyltransferase [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] Length = 445 Score = 40.7 bits (95), Expect = 0.076, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 26/52 (50%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 M+A D+GVPQ RER+ +I + F L LG++L++ + Sbjct: 165 MQAHDYGVPQLRERVIVIGTKSNINPFSVIPKLDGPRTLGEVLKDCPKSEFF 216 >gi|255591450|ref|XP_002535514.1| cytosine-specific methyltransferase, putative [Ricinus communis] gi|223522828|gb|EEF26867.1| cytosine-specific methyltransferase, putative [Ricinus communis] Length = 206 Score = 40.7 bits (95), Expect = 0.077, Method: Composition-based stats. Identities = 7/16 (43%), Positives = 10/16 (62%) Query: 9 PQRRERLYIIDFLNPS 24 PQ RER+ I+ F + Sbjct: 190 PQHRERIIIVGFRGKT 205 >gi|127416|sp|P10283|MTB1_BREEP RecName: Full=Modification methylase BepI; Short=M.BepI; AltName: Full=Cytosine-specific methyltransferase BepI gi|580766|emb|CAA31907.1| unnamed protein product [Brevibacterium epidermidis] Length = 403 Score = 40.7 bits (95), Expect = 0.078, Method: Composition-based stats. Identities = 21/96 (21%), Positives = 33/96 (34%), Gaps = 23/96 (23%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK--------------FPTP-------LGIKP-- 37 + A ++GV Q RER+ I K +P P +KP Sbjct: 202 LNAKNYGVAQNRERVIFIGISKRYANKKILDELISLQEKSEVYPYPPYTHGTDPELKPYA 261 Query: 38 RLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGK 73 L IL + + ++K + + K K K G Sbjct: 262 TLNQILAHLPEPELASTDKSQQSYSKAKLFKKTQGN 297 >gi|218848105|ref|YP_002454768.1| DNA-cytosine methyltransferase [Bacillus cereus G9842] gi|218546236|gb|ACK98629.1| DNA-cytosine methyltransferase [Bacillus cereus G9842] Length = 438 Score = 40.3 bits (94), Expect = 0.079, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 26/52 (50%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 M+A D+GVPQ RER+ +I + F L LG++L++ + Sbjct: 158 MQAHDYGVPQLRERVIVIGTKSNINPFSVIPKLDGPRTLGEVLKDCPKSEFF 209 >gi|86141746|ref|ZP_01060270.1| DNA-cytosine methyltransferase [Leeuwenhoekiella blandensis MED217] gi|85831309|gb|EAQ49765.1| DNA-cytosine methyltransferase [Leeuwenhoekiella blandensis MED217] Length = 410 Score = 40.3 bits (94), Expect = 0.079, Method: Composition-based stats. Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 14/75 (18%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDIL---------EEHIDDK 50 K+ FGV Q+R R+ +I + F++P+ + K L IL E++ K Sbjct: 196 KSEHFGVLQKRRRIILIGW-QKGFSFQYPSFTKVKEKYTLDQILSDLKKLKPGEQNNVTK 254 Query: 51 ST--ISNKLWEGHQK 63 T I+ L + + Sbjct: 255 YTGQITPYLEKYELR 269 >gi|159025987|emb|CAO87894.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 329 Score = 40.3 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 14/69 (20%), Positives = 27/69 (39%), Gaps = 7/69 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKST--ISNK 56 + + F +PQ R R +++ F F+FP P + + I+ + + IS K Sbjct: 142 IDSKYFQIPQSRPRFFLLAFRKDLGIKNFQFPQPCHAEVGIEKII---VPGDYSIPISEK 198 Query: 57 LWEGHQKRK 65 + Sbjct: 199 WQQYIDYYA 207 >gi|34451612|gb|AAQ72361.1| BsaWI methylase [Geobacillus stearothermophilus] Length = 411 Score = 40.3 bits (94), Expect = 0.082, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 9/59 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP-----TPLGIKPRLGDILEEHIDDKSTIS 54 + A DFGVPQ RER +I+ ++ + P + ++ D+ EE K TI+ Sbjct: 160 LNAEDFGVPQSRERFFILA-SREKLDLRVPVAKNRKIVTVEEAFIDLPEE---PKETIN 214 >gi|294084926|ref|YP_003551686.1| DNA-cytosine methyltransferase [Candidatus Puniceispirillum marinum IMCC1322] gi|292664501|gb|ADE39602.1| DNA-cytosine methyltransferase [Candidatus Puniceispirillum marinum IMCC1322] Length = 393 Score = 40.3 bits (94), Expect = 0.083, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 11/54 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-----------SVEFKFPTPLGIKPRLGDIL 43 +KA +GVPQRRER+++I ++ FP P + D L Sbjct: 197 LKAHHYGVPQRRERMFVIGVRKDICEKIGIKEEVEIKKLFPIGSSYAPSVSDAL 250 >gi|22091184|ref|NP_665998.1| M.PhiCh1-II [Natrialba phage PhiCh1] gi|289594296|ref|YP_003482303.1| DNA-cytosine methyltransferase [Natrialba magadii ATCC 43099] gi|22003505|gb|AAM88754.1|AF440695_80 putative C5-cytosine methyltransferase [Natrialba phage PhiCh1] gi|289533393|gb|ADD07741.1| DNA-cytosine methyltransferase [Natrialba magadii ATCC 43099] Length = 283 Score = 40.3 bits (94), Expect = 0.083, Method: Composition-based stats. Identities = 10/18 (55%), Positives = 13/18 (72%) Query: 2 KACDFGVPQRRERLYIID 19 A D+GVPQ RER+ +I Sbjct: 189 DAADYGVPQHRERVLVIG 206 >gi|182437151|ref|YP_001824870.1| putative SacI methylase [Streptomyces griseus subsp. griseus NBRC 13350] gi|178465667|dbj|BAG20187.1| putative SacI methylase [Streptomyces griseus subsp. griseus NBRC 13350] Length = 363 Score = 40.3 bits (94), Expect = 0.087, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 + A DFGVPQ R RL++I + P P Sbjct: 174 LNAADFGVPQARPRLFLIGVPKGKKVPQHPDPTH 207 >gi|260890952|ref|ZP_05902215.1| modification methylase NgoFVII [Leptotrichia hofstadii F0254] gi|260859505|gb|EEX74005.1| modification methylase NgoFVII [Leptotrichia hofstadii F0254] Length = 452 Score = 40.3 bits (94), Expect = 0.089, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A D+GVPQ+RER+ I+ Sbjct: 154 LNAADYGVPQQRERVIIMG 172 >gi|299531463|ref|ZP_07044871.1| DNA-cytosine methyltransferase [Comamonas testosteroni S44] gi|298720626|gb|EFI61575.1| DNA-cytosine methyltransferase [Comamonas testosteroni S44] Length = 435 Score = 40.3 bits (94), Expect = 0.091, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 + A DFGVPQ R R++ + F ++ P +P GD+ Sbjct: 263 LAAHDFGVPQARRRVFFVGFRAARDAARWAEP---EPTHGDV 301 >gi|159029905|emb|CAO90959.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 346 Score = 40.3 bits (94), Expect = 0.091, Method: Composition-based stats. Identities = 14/69 (20%), Positives = 27/69 (39%), Gaps = 7/69 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKST--ISNK 56 + + F +PQ R R +++ F F+FP P + + I+ + + IS K Sbjct: 159 IDSKYFQIPQSRPRFFLLAFRKDLGIKNFQFPQPCHAEVGIEKII---VPGDYSIPISEK 215 Query: 57 LWEGHQKRK 65 + Sbjct: 216 WQQYIDYYA 224 >gi|37693466|dbj|BAC99051.1| chloroplast-resident DNA methyltransferase [Chlamydomonas reinhardtii] Length = 1344 Score = 40.3 bits (94), Expect = 0.091, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A ++GVPQ R+R++II L V +P P+ Sbjct: 1006 LNAGNYGVPQSRKRVFIIAALPEEVLPNWPRPMHS 1040 >gi|20278869|dbj|BAB91073.1| chloroplast-resident DNA methyltransferase [Chlamydomonas reinhardtii] Length = 1344 Score = 40.3 bits (94), Expect = 0.091, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A ++GVPQ R+R++II L V +P P+ Sbjct: 1006 LNAGNYGVPQSRKRVFIIAALPEEVLPNWPRPMHS 1040 >gi|229061562|ref|ZP_04198906.1| C5 methyltransferase alpha subunit [Bacillus cereus AH603] gi|228717796|gb|EEL69446.1| C5 methyltransferase alpha subunit [Bacillus cereus AH603] Length = 353 Score = 40.3 bits (94), Expect = 0.095, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 14/22 (63%), Gaps = 3/22 (13%) Query: 1 MKACDFG---VPQRRERLYIID 19 + + D G VPQ RER++II Sbjct: 134 LNSKDIGPKPVPQNRERVFIIG 155 >gi|303328045|ref|ZP_07358484.1| modification methylase MspI [Desulfovibrio sp. 3_1_syn3] gi|302861871|gb|EFL84806.1| modification methylase MspI [Desulfovibrio sp. 3_1_syn3] Length = 417 Score = 40.3 bits (94), Expect = 0.096, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Query: 4 CDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 FG+PQ RER++++ ++EF+ I + IL Sbjct: 151 KQFGIPQNRERVFVVASKRHAIEFE--DRPEIACDVNSIL 188 >gi|307293581|ref|ZP_07573425.1| DNA-cytosine methyltransferase [Sphingobium chlorophenolicum L-1] gi|306879732|gb|EFN10949.1| DNA-cytosine methyltransferase [Sphingobium chlorophenolicum L-1] Length = 418 Score = 40.3 bits (94), Expect = 0.097, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKF 29 A DFGVPQ RER++ ++F F Sbjct: 153 AADFGVPQTRERVFFFG-TRDDIKFPF 178 >gi|332710136|ref|ZP_08430089.1| DNA-methyltransferase [Lyngbya majuscula 3L] gi|332351094|gb|EGJ30681.1| DNA-methyltransferase [Lyngbya majuscula 3L] Length = 370 Score = 40.3 bits (94), Expect = 0.099, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Query: 6 FGVPQRRER-LYIIDFLNPSVEFKFPTPLGIKPR---LGDI 42 FGVPQ R R ++I F F +PTP P LGD+ Sbjct: 153 FGVPQTRRRFIFIASFDRFPSGFHWPTPEPDTPASVYLGDL 193 >gi|296163057|ref|ZP_06845831.1| C-5 cytosine-specific DNA methylase [Burkholderia sp. Ch1-1] gi|295886701|gb|EFG66545.1| C-5 cytosine-specific DNA methylase [Burkholderia sp. Ch1-1] Length = 304 Score = 40.3 bits (94), Expect = 0.100, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE 44 + A D GVPQ R+RL+++ + PL + D++E Sbjct: 141 IDAADHGVPQHRKRLFLVC-TRSAAPIGLELPLRDHRPIRDVIE 183 >gi|17231665|ref|NP_488213.1| cytosine-specific DNA methyltransferase [Nostoc sp. PCC 7120] gi|8453097|gb|AAF75232.1|AF220508_2 cytosine-specific DNA methyltransferase [Nostoc sp. PCC 7120] gi|17133308|dbj|BAB75872.1| cytosine-specific DNA methyltransferase [Nostoc sp. PCC 7120] Length = 385 Score = 39.9 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 16/26 (61%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A ++GVPQ RER+ ++ F + Sbjct: 172 INAIEYGVPQDRERIILLGFSKSFIH 197 >gi|255530844|ref|YP_003091216.1| DNA-cytosine methyltransferase [Pedobacter heparinus DSM 2366] gi|255343828|gb|ACU03154.1| DNA-cytosine methyltransferase [Pedobacter heparinus DSM 2366] Length = 350 Score = 39.9 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 17/74 (22%), Positives = 26/74 (35%), Gaps = 22/74 (29%) Query: 1 MKACDFGVPQRRERLYIID-----------------FLNPSVEFKFPTPLGIKPRLGDIL 43 + FG+PQRR R++ + F N L + DIL Sbjct: 156 LDTQSFGLPQRRSRIFFVCSKKELEIELTEEAIVRNFNNIDHH-----GLHTYSNVLDIL 210 Query: 44 EEHIDDKSTISNKL 57 + D K +S K+ Sbjct: 211 GKDADQKYYLSEKI 224 >gi|240143787|ref|ZP_04742388.1| Phi-3T prophage-derived modification methylase Phi3TI [Roseburia intestinalis L1-82] gi|257204222|gb|EEV02507.1| Phi-3T prophage-derived modification methylase Phi3TI [Roseburia intestinalis L1-82] Length = 333 Score = 39.9 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVE-FKFPTP---LGIKPRLGDILEEHIDDKSTI 53 + + V Q RER YI + + + P P+L L++++ ++ I Sbjct: 180 NSKFWNVAQNRERYYIAATRDDLPDVLQMPAQNEDPENVPKLSLFLDDNVPERFYI 235 >gi|257887107|ref|ZP_05666760.1| site-specific DNA-methyltransferase [Enterococcus faecium 1,141,733] gi|257823161|gb|EEV50093.1| site-specific DNA-methyltransferase [Enterococcus faecium 1,141,733] Length = 360 Score = 39.9 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + + DFGVPQ RER +I Sbjct: 163 LNSLDFGVPQDRERFFIFG 181 >gi|85710855|ref|ZP_01041916.1| DNA modification methylase M.NGOI [Idiomarina baltica OS145] gi|85695259|gb|EAQ33196.1| DNA modification methylase M.NGOI [Idiomarina baltica OS145] Length = 345 Score = 39.9 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDK 50 + FGVPQ R R ++ FK+P P +G+ L + + K Sbjct: 163 SSQFGVPQLRPRTILVALRPEVASHFKWPQPQSKIVTVGEALGDLMASK 211 >gi|167042310|gb|ABZ07039.1| putative C-5 cytosine-specific DNA methylase [uncultured marine crenarchaeote HF4000_ANIW97J3] Length = 380 Score = 39.9 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A D+GVPQ R+R +I+ Sbjct: 165 LNAADYGVPQIRKRAFIVG 183 >gi|190892898|ref|YP_001979440.1| DNA-cytosine methyltransferase [Rhizobium etli CIAT 652] gi|190698177|gb|ACE92262.1| putative DNA-cytosine methyltransferase protein [Rhizobium etli CIAT 652] Length = 638 Score = 39.9 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 23/96 (23%), Positives = 38/96 (39%), Gaps = 20/96 (20%) Query: 3 ACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKLWEG 60 A D+G+ Q R R+ II F+ P + LGD+L +D ++ WEG Sbjct: 425 AEDYGLAQERSRVLIIGIRRDLGTAFRMPPTFPQRRTNLGDVL---VD---LMAANGWEG 478 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 + + E++A +T+ R K Sbjct: 479 AYEWARERR------------ESNAIASTIVTRRGK 502 >gi|297159178|gb|ADI08890.1| DNA-cytosine methyltransferase [Streptomyces bingchenggensis BCW-1] Length = 386 Score = 39.9 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 18/82 (21%), Positives = 30/82 (36%), Gaps = 17/82 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLG---------IKPRLGDILEEHIDDK 50 ++ACD+GVPQ R R ++ F++ P + P + E+ D + Sbjct: 163 LEACDYGVPQLRPRAILVAMREEYAQHFQWTDPEEGALVTVAQALAPSMRKRFEDSGDPR 222 Query: 51 STISNKLWEGHQKRKENNKIAG 72 WE +R G Sbjct: 223 -------WEIFYERWLKEAEKG 237 >gi|145218897|ref|YP_001129606.1| DNA-cytosine methyltransferase [Prosthecochloris vibrioformis DSM 265] gi|145205061|gb|ABP36104.1| DNA-cytosine methyltransferase [Chlorobium phaeovibrioides DSM 265] Length = 467 Score = 39.9 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVE 26 A D+G+PQ R R+ ++ ++ Sbjct: 215 AKDYGIPQNRPRVLLVGLRKDIIK 238 >gi|242237482|ref|YP_002985663.1| DNA-cytosine methyltransferase [Dickeya dadantii Ech703] gi|242129539|gb|ACS83841.1| DNA-cytosine methyltransferase [Dickeya dadantii Ech703] Length = 465 Score = 39.9 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 20/98 (20%), Positives = 33/98 (33%), Gaps = 22/98 (22%) Query: 2 KACDFGVPQRRERLYIIDFLN------------PSVEFKFPTPLGIKPRLGDIL------ 43 A +FG PQ RER+ II N F+ P ++ + D+ Sbjct: 247 NAANFGTPQIRERVIIICSRNGKTPPYLTPTHSDDPYFELPHWNTLESSISDLKNHDHLN 306 Query: 44 EEHIDDKST--ISN-KLWEGHQKRKENNKIAGKGFGYG 78 K + + W+ + + + GK F G Sbjct: 307 FPEKRLKYYRMLKPGQNWKNLPEYLQK-EAMGKSFYSG 343 >gi|84686808|ref|ZP_01014695.1| DNA methylase, C-5 cytosine-specific family protein [Maritimibacter alkaliphilus HTCC2654] gi|84665239|gb|EAQ11718.1| DNA methylase, C-5 cytosine-specific family protein [Rhodobacterales bacterium HTCC2654] Length = 336 Score = 39.9 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKP 37 + A FGVPQ R R II + FP P+ P Sbjct: 88 LYAPHFGVPQTRWRTVIIGIRGDQADPLRAFPEPVRNAP 126 >gi|238765010|ref|ZP_04625947.1| DNA-cytosine methyltransferase [Yersinia kristensenii ATCC 33638] gi|238696779|gb|EEP89559.1| DNA-cytosine methyltransferase [Yersinia kristensenii ATCC 33638] Length = 338 Score = 39.9 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 24/61 (39%), Gaps = 7/61 (11%) Query: 1 MKACDFGVPQRRERLYIIDFL------NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54 + D+GVPQ R+R+ I N F PTP P L + K IS Sbjct: 150 LNTADYGVPQTRKRVIAIGVKAELFDINQLPAFP-PTPTHCSPDKNSALPAWVTVKDAIS 208 Query: 55 N 55 + Sbjct: 209 D 209 >gi|310819714|ref|YP_003952072.1| cytosine-specific methyltransferase [Stigmatella aurantiaca DW4/3-1] gi|309392786|gb|ADO70245.1| Cytosine-specific methyltransferase [Stigmatella aurantiaca DW4/3-1] Length = 421 Score = 39.9 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 + A +GVPQ R+RL I+ + V F P+P Sbjct: 165 VNAASYGVPQLRKRLIIVGARDGKV-FNVPSPTH 197 >gi|213964765|ref|ZP_03392965.1| modification methylase NaeI [Corynebacterium amycolatum SK46] gi|213952958|gb|EEB64340.1| modification methylase NaeI [Corynebacterium amycolatum SK46] Length = 333 Score = 39.9 bits (93), Expect = 0.13, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDIL 43 A + GVPQ R R ++ F +P P G P +G+ L Sbjct: 155 ASEHGVPQLRPRFVLVAVKQEYAPFFHWPEPQGEAPTVGETL 196 >gi|187736717|ref|YP_001840974.1| hypothetical protein pEspB_p20 [Exiguobacterium arabatum] gi|183223750|emb|CAQ35235.1| m5C DNA methyltransferase M.Lsp1109I [Exiguobacterium arabatum] Length = 377 Score = 39.9 bits (93), Expect = 0.13, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Query: 6 FGVPQRRERLYIIDFLNP----SVEFKFPTPLGI 35 +GVPQ R R+ I+ +EFK P PL Sbjct: 168 YGVPQARHRIIIVGIRKDLAEQGIEFKVPAPLNT 201 >gi|294084868|ref|YP_003551628.1| DNA-cytosine methyltransferase [Candidatus Puniceispirillum marinum IMCC1322] gi|292664443|gb|ADE39544.1| DNA-cytosine methyltransferase [Candidatus Puniceispirillum marinum IMCC1322] Length = 538 Score = 39.9 bits (93), Expect = 0.13, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 28/72 (38%), Gaps = 20/72 (27%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-------------PRLGDILEEHI 47 +K+ DFG+PQ R RL I+ K P L PRL L + Sbjct: 255 LKSEDFGIPQTRHRLIIVGIREDIQ--KIPDSLVPNEKTYTVQDAISDLPRLRSGLSKEK 312 Query: 48 DDKSTISNKLWE 59 DD KLW+ Sbjct: 313 DD-----AKLWK 319 >gi|288958310|ref|YP_003448651.1| DNA (cytosine-5-)-methyltransferase [Azospirillum sp. B510] gi|288910618|dbj|BAI72107.1| DNA (cytosine-5-)-methyltransferase [Azospirillum sp. B510] Length = 375 Score = 39.9 bits (93), Expect = 0.13, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 16/35 (45%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A DFGVPQ+R+R II PT Sbjct: 171 LHAADFGVPQKRQRAIIIGSRVGKPRLPMPTHQQK 205 >gi|218244975|ref|YP_002370346.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] gi|218165453|gb|ACK64190.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801] Length = 423 Score = 39.9 bits (93), Expect = 0.13, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 8 VPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDD 49 VPQ+RER+ II N ++ FPTP L + L+ D Sbjct: 223 VPQKRERVVIIAVRNDLAIPALFPTPKNYTISLREALQNCPDS 265 >gi|322510825|gb|ADX06139.1| putative C-5 cytosine-specific DNA methyltransferase [Organic Lake phycodnavirus 1] Length = 390 Score = 39.5 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 9/67 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + + + PQ R+R+YII N + E+ F + I++ I D ++ Sbjct: 227 IDSRYYNSPQSRQRIYIIC--NKNTEYIFREIKNPIVPVSTIIDNSITD-------FFDY 277 Query: 61 HQKRKEN 67 +K K Sbjct: 278 TKKYKLE 284 >gi|325685522|gb|EGD27614.1| modification methylase BbvI [Lactobacillus delbrueckii subsp. lactis DSM 20072] Length = 380 Score = 39.5 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Query: 6 FGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPR 38 +GVPQ R R+ I+ N E F P P P Sbjct: 167 YGVPQMRHRIIIVGIRNDLAEQGIKFHVPAPTTPNPE 203 >gi|256390614|ref|YP_003112178.1| DNA-cytosine methyltransferase [Catenulispora acidiphila DSM 44928] gi|256356840|gb|ACU70337.1| DNA-cytosine methyltransferase [Catenulispora acidiphila DSM 44928] Length = 419 Score = 39.5 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 1 MKACDFGVPQRRERLYIIDFL 21 + A +FGVPQ R R+ I+ F Sbjct: 199 VNAANFGVPQVRYRVIIVAFR 219 >gi|322510834|gb|ADX06148.1| putative C-5 cytosine-specific DNA methyltransferase [Organic Lake phycodnavirus 1] Length = 344 Score = 39.5 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 28/61 (45%), Gaps = 8/61 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV------EFKFPTPLGIKPRLGDILEEHIDDK--ST 52 +K D+G+PQ R+RL I+ N + + + L ++L ++ + K T Sbjct: 209 IKCSDYGLPQMRKRLIIVGVRNDTALINHIDKLLDLDEYKKETTLTELLGKNFEKKIAYT 268 Query: 53 I 53 I Sbjct: 269 I 269 >gi|257453711|ref|ZP_05618997.1| modification methylase Eco47II [Enhydrobacter aerosaccus SK60] gi|257448894|gb|EEV23851.1| modification methylase Eco47II [Enhydrobacter aerosaccus SK60] Length = 415 Score = 39.5 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Query: 2 KACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEE 45 KA + VPQ+RERL II N +F P+P + D L+ Sbjct: 227 KAVFYKVPQKRERLIIIGVRNDLVAKAKFVKPSPYYRLLTVKDALQA 273 >gi|254465219|ref|ZP_05078630.1| modification methylase XorII [Rhodobacterales bacterium Y4I] gi|206686127|gb|EDZ46609.1| modification methylase XorII [Rhodobacterales bacterium Y4I] Length = 437 Score = 39.5 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DF VPQ R RL ++ + ++P + +P D L + D ++ ++LW Sbjct: 155 LNAADFCVPQDRHRLILMGTKKGAKLPEYPKVISKRPTCEDALGDLPDAETF--DELWSS 212 >gi|116514211|ref|YP_813117.1| site-specific DNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] gi|116093526|gb|ABJ58679.1| Site-specific DNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] Length = 380 Score = 39.5 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Query: 6 FGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKP 37 +GVPQ R R+ I+ N E F P P P Sbjct: 167 YGVPQMRHRIIIVGIRNDLAERGIKFHVPAPTTPNP 202 >gi|127439|sp|P05302|MTD1_DESNO RecName: Full=Modification methylase DdeI; Short=M.DdeI; AltName: Full=Cytosine-specific methyltransferase DdeI gi|79418|pir||S00543 site-specific DNA-methyltransferase (cytosine-specific) (EC 2.1.1.73) DdeI - Desulfovibrio desulfuricans gi|40795|emb|CAA68505.1| DdeI methylase [Desulfovibrio vulgaris] Length = 415 Score = 39.5 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + ACD+GVPQ R+R++ I Sbjct: 149 LNACDYGVPQSRQRVFFIG 167 >gi|228947350|ref|ZP_04109643.1| hypothetical protein bthur0007_34800 [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228812349|gb|EEM58677.1| hypothetical protein bthur0007_34800 [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] Length = 290 Score = 39.5 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + + +FGVPQ R+R++II L + FP Sbjct: 137 LNSREFGVPQSRDRVFIIGHLRGHSRREVFP 167 >gi|229100187|ref|ZP_04231087.1| hypothetical protein bcere0020_53880 [Bacillus cereus Rock3-29] gi|228683229|gb|EEL37207.1| hypothetical protein bcere0020_53880 [Bacillus cereus Rock3-29] Length = 306 Score = 39.5 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + + +FGVPQ R+R++II L + FP Sbjct: 153 LNSREFGVPQSRDRVFIIGHLRGHSRREVFP 183 >gi|239624728|ref|ZP_04667759.1| DNA (cytosine-5-)-methyltransferase [Clostridiales bacterium 1_7_47_FAA] gi|239521114|gb|EEQ60980.1| DNA (cytosine-5-)-methyltransferase [Clostridiales bacterium 1_7_47FAA] Length = 554 Score = 39.5 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32 + A +G PQRRER I+ ++ P Sbjct: 342 LNAIHYGAPQRRERFIIVGLKKEMDAKYTAPEI 374 >gi|228964036|ref|ZP_04125166.1| hypothetical protein bthur0004_8960 [Bacillus thuringiensis serovar sotto str. T04001] gi|228795688|gb|EEM43165.1| hypothetical protein bthur0004_8960 [Bacillus thuringiensis serovar sotto str. T04001] Length = 478 Score = 39.5 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31 + + DFGVPQ+R+R+ II +E +P Sbjct: 181 LNSADFGVPQQRKRVVIIA-NKHGIENTYPK 210 >gi|333024772|ref|ZP_08452836.1| putative 5-methylcytosine methyltransferase [Streptomyces sp. Tu6071] gi|332744624|gb|EGJ75065.1| putative 5-methylcytosine methyltransferase [Streptomyces sp. Tu6071] Length = 324 Score = 39.5 bits (92), Expect = 0.16, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIK-PRLGDILEEHIDDK 50 + A DFGV QRRE +++ F +P PL P LG+ L + + Sbjct: 149 LDAKDFGVSQRREHGFLVAMSGERMKRFSWPVPLATPCPTLGETLRASMGAR 200 >gi|269792571|ref|YP_003317475.1| DNA-cytosine methyltransferase [Thermanaerovibrio acidaminovorans DSM 6589] gi|269100206|gb|ACZ19193.1| DNA-cytosine methyltransferase [Thermanaerovibrio acidaminovorans DSM 6589] Length = 350 Score = 39.5 bits (92), Expect = 0.16, Method: Composition-based stats. Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query: 6 FGVPQRRERLYIIDFLNP-SVEFKFPTP 32 +G+PQ R R+ I+ N +V FK P+P Sbjct: 160 YGIPQARHRIIIVGIRNDINVTFKVPSP 187 >gi|113478170|ref|YP_724231.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101] gi|110169218|gb|ABG53758.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101] Length = 379 Score = 39.5 bits (92), Expect = 0.16, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 20/51 (39%), Gaps = 10/51 (19%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 D+GVPQ RER+ ++ F F + P G I K T Sbjct: 159 NFADYGVPQFRERVILVGIR-MDTGFNF---IHPSPEYG------IGRKYT 199 >gi|218134945|ref|ZP_03463749.1| hypothetical protein BACPEC_02850 [Bacteroides pectinophilus ATCC 43243] gi|217990330|gb|EEC56341.1| hypothetical protein BACPEC_02850 [Bacteroides pectinophilus ATCC 43243] Length = 416 Score = 39.5 bits (92), Expect = 0.16, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDIL 43 + A DFGV Q R+R+ I+ +L + +++P+ + K + D+L Sbjct: 202 LNAQDFGVLQSRKRVIIVGWLKGT-GYEYPSFDVIHSKAEVWDLL 245 >gi|293407987|ref|ZP_06651827.1| modification methylase NmeDIP [Escherichia coli B354] gi|301328020|ref|ZP_07221181.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1] gi|291472238|gb|EFF14720.1| modification methylase NmeDIP [Escherichia coli B354] gi|300845467|gb|EFK73227.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1] Length = 379 Score = 39.5 bits (92), Expect = 0.16, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 18/29 (62%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF 29 + + ++G PQ RER+ ++ F N ++ F Sbjct: 166 INSIEYGAPQDRERIILLGFQNKNLTKSF 194 >gi|210610975|ref|ZP_03288684.1| hypothetical protein CLONEX_00874 [Clostridium nexile DSM 1787] gi|210152200|gb|EEA83207.1| hypothetical protein CLONEX_00874 [Clostridium nexile DSM 1787] Length = 423 Score = 39.5 bits (92), Expect = 0.17, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 3/45 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDIL 43 + A DFGV Q R+R+ I+ +L + +++P+ + K + D+L Sbjct: 202 LNAQDFGVLQSRKRVIIVGWLKGT-GYEYPSFDVIHSKAEVWDLL 245 >gi|18313899|ref|NP_560566.1| C-5 cytosine-specific DNA methylase [Pyrobaculum aerophilum str. IM2] gi|18161467|gb|AAL64748.1| C-5 cytosine-specific DNA methylase [Pyrobaculum aerophilum str. IM2] Length = 463 Score = 39.5 bits (92), Expect = 0.17, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Query: 5 DF---GVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 DF GVPQ+RERL II + + + L + + K ++ Sbjct: 186 DFAAAGVPQKRERLIIIGIRRDLIR-SAEQIWHARAVIDRALRKTVFAKFPLTP 238 >gi|303236370|ref|ZP_07322960.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN] gi|302483428|gb|EFL46433.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN] Length = 415 Score = 39.5 bits (92), Expect = 0.17, Method: Composition-based stats. Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 4 CDFGVPQRRERLYIIDFLNPSVE 26 DFG+PQ R R+ I+ + Sbjct: 188 ADFGIPQHRRRVIIVGIRLDTFG 210 >gi|15828514|ref|NP_325874.1| CpG DNA methylase (cytosine-specific methyltransferase) [Mycoplasma pulmonis UAB CTIP] gi|14089456|emb|CAC13216.1| CPG DNA METHYLASE (CYTOSINE-SPECIFIC METHYLTRANSFERASE) [Mycoplasma pulmonis] Length = 296 Score = 39.1 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + + D+ Q R+R +++ + S +FK+P K L +L ++K T Sbjct: 116 LNSADYNSCQNRQRFFMVSSFDLS-KFKWPEKRSRKKDLSTLL----NNKYT 162 >gi|313124726|ref|YP_004034985.1| modification methyltransferase, cytosine-specific [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|312281289|gb|ADQ62008.1| Modification methyltransferase, cytosine-specific [Lactobacillus delbrueckii subsp. bulgaricus ND02] Length = 284 Score = 39.1 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPT 31 A DFGV Q R R+ I+ +L + + +P Sbjct: 62 NAQDFGVLQNRRRMIIVGWLK-NSDLAYPD 90 >gi|169825537|ref|YP_001695712.1| modification methylase [Lysinibacillus sphaericus C3-41] gi|168994814|gb|ACA42353.1| Modification methylase [Lysinibacillus sphaericus C3-41] Length = 296 Score = 39.1 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 25/95 (26%), Positives = 35/95 (36%), Gaps = 19/95 (20%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNKLWEGHQKR 64 +PQ R+RL +I P +P IK + DI++ E K K EGH + Sbjct: 155 LPQERKRLIVIGTKRPFNNLDYPESTPIK--MRDIIDVGTEVYTPKYV--QKRLEGHYRD 210 Query: 65 KENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99 K + + T A Y KD S Sbjct: 211 KP------------IITDLDGIAPTCVAHYSKDRS 233 >gi|40063394|gb|AAR38205.1| C-5 cytosine-specific DNA methylase [uncultured marine bacterium 580] Length = 435 Score = 39.1 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPL 33 + A D+G+PQRR R++I F S KF P+ Sbjct: 181 INAADYGMPQRRRRVFIFAFKKSSALHKKFKKPI 214 >gi|309783383|ref|ZP_07678091.1| C-5 cytosine-specific DNA methylase family protein [Ralstonia sp. 5_7_47FAA] gi|330827391|ref|YP_004390629.1| C-5 cytosine-specific DNA methylase [Alicycliphilus denitrificans K601] gi|308917844|gb|EFP63533.1| C-5 cytosine-specific DNA methylase family protein [Ralstonia sp. 5_7_47FAA] gi|329312699|gb|AEB87113.1| C-5 cytosine-specific DNA methylase [Alicycliphilus denitrificans K601] Length = 304 Score = 39.1 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE 44 + A D GVPQ R+RL+++ + + P + D+++ Sbjct: 141 VDAADHGVPQNRQRLFLVCTRSRRP-LRLSLPRREHRPIADVIQ 183 >gi|121582518|ref|YP_974050.1| C-5 cytosine-specific DNA methylase [Acidovorax sp. JS42] gi|120608576|gb|ABM44315.1| C-5 cytosine-specific DNA methylase [Acidovorax sp. JS42] Length = 304 Score = 39.1 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE 44 + A D GVPQ R+RL+++ + + P + D+++ Sbjct: 141 VDAADHGVPQNRQRLFLVCTRSRRP-LRLSLPRREHRPIADVIQ 183 >gi|88854619|ref|ZP_01129286.1| C-5 cytosine-specific DNA methylase family protein [marine actinobacterium PHSC20C1] gi|88816427|gb|EAR26282.1| C-5 cytosine-specific DNA methylase family protein [marine actinobacterium PHSC20C1] Length = 352 Score = 39.1 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDIL 43 + A D+G PQ R+R II L P F PT G + ++L Sbjct: 144 LNAADYGAPQARKRAVIIGHLKTLPFPGFPTPTHAGRHVPVKNVL 188 >gi|331091354|ref|ZP_08340194.1| hypothetical protein HMPREF9477_00837 [Lachnospiraceae bacterium 2_1_46FAA] gi|330404515|gb|EGG84059.1| hypothetical protein HMPREF9477_00837 [Lachnospiraceae bacterium 2_1_46FAA] Length = 391 Score = 39.1 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 7/57 (12%) Query: 7 GVPQRRERLYIIDFLN----PSVEFKFPTPLGIKPRLGD--ILE-EHIDDKSTISNK 56 GVPQ RER+ I+ + ++ + P ILE +D+K IS+ Sbjct: 154 GVPQFRERVVILGIHSSLGIQNLNIELPDKSKDDINFLTSGILETTDVDEKYYISSH 210 >gi|12229856|sp|P94147|MTA1_RUEGE RecName: Full=Modification methylase AgeI; Short=M.AgeI; AltName: Full=Cytosine-specific methyltransferase AgeI gi|8037880|gb|AAF71525.1|AF247972_2 AgeI methylase [Thalassobius gelatinovorus] gi|1695647|dbj|BAA11333.1| ageI metylase [Thalassobius gelatinovorus] gi|1588637|prf||2209243A AgeI methylase Length = 429 Score = 39.1 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + AC++GVPQ R R++I Sbjct: 150 LDACEYGVPQHRRRVFIFG 168 >gi|326564851|gb|EGE15057.1| DNA-cytosine methyltransferase [Moraxella catarrhalis 103P14B1] Length = 288 Score = 39.1 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 16/29 (55%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF 29 + + FGVPQ+R R++++ L F Sbjct: 160 LDSRYFGVPQKRRRVFLVAGLGKYPPFSL 188 >gi|18202059|sp|O52702|MTA1_ACEPA RecName: Full=Modification methylase ApaLI; Short=M.ApaLI; AltName: Full=Cytosine-specific methyltransferase ApaLI gi|2865599|gb|AAC97180.1| ApaLI methyltransferase [Acetobacter pasteurianus] Length = 429 Score = 39.1 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 + +GVPQ R+R+ II ++F+FP L Sbjct: 151 VNLAAYGVPQTRKRVLIIG-NRLGIDFQFPEEL 182 >gi|331003101|ref|ZP_08326612.1| hypothetical protein HMPREF0491_01474 [Lachnospiraceae oral taxon 107 str. F0167] gi|330412985|gb|EGG92361.1| hypothetical protein HMPREF0491_01474 [Lachnospiraceae oral taxon 107 str. F0167] Length = 356 Score = 39.1 bits (91), Expect = 0.20, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 + D+GVPQ R+RL + +++ F L K Sbjct: 152 LNTADYGVPQVRKRLVLHGIKKENIDRNFKIQLPPKT 188 >gi|257058000|ref|YP_003135888.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] gi|256588166|gb|ACU99052.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802] Length = 423 Score = 39.1 bits (91), Expect = 0.20, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 8 VPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDD 49 VPQ+RER+ II N ++ FPTP L + L+ D Sbjct: 223 VPQKRERVVIIAVRNDLAIPALFPTPKNYTISLREALKNCPDS 265 >gi|1644234|dbj|BAA11339.1| ApaLI methylase [Acetobacter pasteurianus] Length = 429 Score = 39.1 bits (91), Expect = 0.20, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 + +GVPQ R+R+ II ++F+FP L Sbjct: 151 VNLAAYGVPQTRKRVLIIG-NRLGIDFQFPEEL 182 >gi|170084587|ref|XP_001873517.1| predicted protein [Laccaria bicolor S238N-H82] gi|164651069|gb|EDR15309.1| predicted protein [Laccaria bicolor S238N-H82] Length = 1273 Score = 39.1 bits (91), Expect = 0.20, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 21/38 (55%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 ++A +G PQRRER ++I L+ + P P P+ Sbjct: 930 LQAAHYGTPQRRERFFLIAALDGTPLPALPQPTHDFPK 967 >gi|291539767|emb|CBL12878.1| Site-specific DNA methylase [Roseburia intestinalis XB6B4] Length = 337 Score = 39.1 bits (91), Expect = 0.20, Method: Composition-based stats. Identities = 9/20 (45%), Positives = 13/20 (65%) Query: 1 MKACDFGVPQRRERLYIIDF 20 + A D+ VPQ RER+ I+ Sbjct: 186 VNASDYSVPQNRERMIIVGV 205 >gi|326776070|ref|ZP_08235335.1| DNA-cytosine methyltransferase [Streptomyces cf. griseus XylebKG-1] gi|326656403|gb|EGE41249.1| DNA-cytosine methyltransferase [Streptomyces cf. griseus XylebKG-1] Length = 463 Score = 39.1 bits (91), Expect = 0.21, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 1 MKACDFGVPQRRERLYIIDFL 21 + A D+G PQ R R+ I+ F Sbjct: 224 VNAADYGAPQVRNRVVIVAFR 244 >gi|254410214|ref|ZP_05023994.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196183250|gb|EDX78234.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 392 Score = 39.1 bits (91), Expect = 0.21, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32 + A G+PQ R+R+ I+ L+ + FP Sbjct: 148 VNAMHLGLPQNRQRVVILGTLDKDTKDDFPNI 179 >gi|240119361|dbj|BAH79224.1| methylase EcoO109IM [Escherichia coli O157:H7] Length = 414 Score = 39.1 bits (91), Expect = 0.21, Method: Composition-based stats. Identities = 18/75 (24%), Positives = 29/75 (38%), Gaps = 14/75 (18%) Query: 1 MKACDFGVPQRRERLYIID--------FLNPSVEFKFPTPLGIKPRLGDIL--EEHIDDK 50 + A ++G PQ RER+ +I F +P + L LGD++ E DK Sbjct: 175 VNAANYGAPQIRERVILIGNRFGMIANFASPLFSNRVEDNLPPFKTLGDVIGPESGFVDK 234 Query: 51 S----TISNKLWEGH 61 S + + Sbjct: 235 YPEVMNFSPRKLKYL 249 >gi|189404646|ref|ZP_02809925.2| modification methylase SinI [Escherichia coli O157:H7 str. EC869] gi|189375083|gb|EDU93499.1| modification methylase SinI [Escherichia coli O157:H7 str. EC869] Length = 417 Score = 39.1 bits (91), Expect = 0.21, Method: Composition-based stats. Identities = 18/75 (24%), Positives = 29/75 (38%), Gaps = 14/75 (18%) Query: 1 MKACDFGVPQRRERLYIID--------FLNPSVEFKFPTPLGIKPRLGDIL--EEHIDDK 50 + A ++G PQ RER+ +I F +P + L LGD++ E DK Sbjct: 178 VNAANYGAPQIRERVILIGNRFGMIANFASPLFSNRVEDNLPPFKTLGDVIGPESGFVDK 237 Query: 51 S----TISNKLWEGH 61 S + + Sbjct: 238 YPEVMNFSPRKLKYL 252 >gi|6318608|gb|AAF06965.1|AF157599_4 EcoO109IM [Escherichia coli] Length = 414 Score = 39.1 bits (91), Expect = 0.21, Method: Composition-based stats. Identities = 18/75 (24%), Positives = 29/75 (38%), Gaps = 14/75 (18%) Query: 1 MKACDFGVPQRRERLYIID--------FLNPSVEFKFPTPLGIKPRLGDIL--EEHIDDK 50 + A ++G PQ RER+ +I F +P + L LGD++ E DK Sbjct: 175 VNAANYGAPQIRERVILIGNRFGMIANFASPLFSNRVEDNLPPFKTLGDVIGPESGFVDK 234 Query: 51 S----TISNKLWEGH 61 S + + Sbjct: 235 YPEVMNFSPRKLKYL 249 >gi|300868938|ref|ZP_07113543.1| putative modification methylase NmeDIP [Oscillatoria sp. PCC 6506] gi|300333061|emb|CBN58735.1| putative modification methylase NmeDIP [Oscillatoria sp. PCC 6506] Length = 399 Score = 39.1 bits (91), Expect = 0.22, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 17/26 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A ++GVPQ R+R+ ++ F ++ Sbjct: 172 INAIEYGVPQDRDRIILLGFRKDLIK 197 >gi|261225387|ref|ZP_05939668.1| C-5 cytosine-specific DNA methylase [Escherichia coli O157:H7 str. FRIK2000] gi|261255360|ref|ZP_05947893.1| C-5 cytosine-specific DNA methylase [Escherichia coli O157:H7 str. FRIK966] gi|323182002|gb|EFZ67413.1| modification methylase XorII [Escherichia coli 1357] Length = 401 Score = 39.1 bits (91), Expect = 0.22, Method: Composition-based stats. Identities = 18/75 (24%), Positives = 29/75 (38%), Gaps = 14/75 (18%) Query: 1 MKACDFGVPQRRERLYIID--------FLNPSVEFKFPTPLGIKPRLGDIL--EEHIDDK 50 + A ++G PQ RER+ +I F +P + L LGD++ E DK Sbjct: 162 VNAANYGAPQIRERVILIGNRFGMIANFASPLFSNRVEDNLPPFKTLGDVIGPESGFVDK 221 Query: 51 S----TISNKLWEGH 61 S + + Sbjct: 222 YPEVMNFSPRKLKYL 236 >gi|127487|sp|P09795|MTS1_SALIN RecName: Full=Modification methylase SinI; Short=M.SinI; AltName: Full=Cytosine-specific methyltransferase SinI gi|79032|pir||A32008 site-specific DNA-methyltransferase (cytosine-specific) (EC 2.1.1.73) - Salmonella sp gi|154350|gb|AAA27212.1| modification methylase (M.SinI) [Salmonella enterica subsp. enterica serovar Infantis] Length = 461 Score = 39.1 bits (91), Expect = 0.22, Method: Composition-based stats. Identities = 24/97 (24%), Positives = 39/97 (40%), Gaps = 24/97 (24%) Query: 2 KACDFGVPQRRERLYIID--------FLNP----SVEFKFPTPLGIK---PRLGDILEEH 46 + +FGVPQ RER+ II FL P E+ P + ++ L +I EH Sbjct: 247 NSANFGVPQIRERVIIICSRDGSRVPFLQPTHSEKGEYGLPKWITLRETITNLKNITHEH 306 Query: 47 I-----DDKST--ISN-KLWEGHQKRKENNKIAGKGF 75 + K + + W+ + + + GK F Sbjct: 307 VLFPEKRLKYYRLLKEGQYWKHLPEDLQK-EALGKSF 342 >gi|309790027|ref|ZP_07684601.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6] gi|308227882|gb|EFO81536.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6] Length = 438 Score = 39.1 bits (91), Expect = 0.22, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32 + A D+GVPQRR+RL+I ++P Sbjct: 211 LNAVDYGVPQRRQRLFIQG-NRLGQNIRWPKI 241 >gi|228911341|ref|ZP_04075144.1| Phage-related DNA methylase [Bacillus thuringiensis IBL 200] gi|228848278|gb|EEM93129.1| Phage-related DNA methylase [Bacillus thuringiensis IBL 200] Length = 236 Score = 39.1 bits (91), Expect = 0.22, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 5/24 (20%) Query: 1 MKACDFG-----VPQRRERLYIID 19 + DF VPQ RER++II Sbjct: 151 LNTKDFSTAARPVPQNRERVFIIG 174 >gi|69244913|ref|ZP_00603103.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium DO] gi|257883136|ref|ZP_05662789.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium 1,231,502] gi|257891884|ref|ZP_05671537.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium 1,231,410] gi|258616872|ref|ZP_05714642.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium DO] gi|289567034|ref|ZP_06447433.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium D344SRF] gi|293563825|ref|ZP_06678258.1| methyl transferase [Enterococcus faecium E1162] gi|294619669|ref|ZP_06699086.1| methyl transferase [Enterococcus faecium E1679] gi|68196079|gb|EAN10510.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium DO] gi|257818794|gb|EEV46122.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium 1,231,502] gi|257828244|gb|EEV54870.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium 1,231,410] gi|289161170|gb|EFD09071.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium D344SRF] gi|291594089|gb|EFF25546.1| methyl transferase [Enterococcus faecium E1679] gi|291604195|gb|EFF33696.1| methyl transferase [Enterococcus faecium E1162] Length = 380 Score = 39.1 bits (91), Expect = 0.23, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Query: 1 MKACDFGVPQRRERLYIID 19 + + + VPQ RER+++I Sbjct: 147 LNSKAY-VPQNRERIFLIG 164 >gi|314942783|ref|ZP_07849602.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecium TX0133C] gi|314953681|ref|ZP_07856564.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecium TX0133A] gi|313594323|gb|EFR73168.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecium TX0133A] gi|313598474|gb|EFR77319.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecium TX0133C] Length = 380 Score = 38.7 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Query: 1 MKACDFGVPQRRERLYIID 19 + + + VPQ RER+++I Sbjct: 147 LNSKAY-VPQNRERIFLIG 164 >gi|314994133|ref|ZP_07859442.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium TX0133B] gi|313591442|gb|EFR70287.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium TX0133B] Length = 250 Score = 38.7 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Query: 1 MKACDFGVPQRRERLYIID 19 + + + VPQ RER+++I Sbjct: 17 LNSKAY-VPQNRERIFLIG 34 >gi|226330016|ref|ZP_03805534.1| hypothetical protein PROPEN_03929 [Proteus penneri ATCC 35198] gi|225200811|gb|EEG83165.1| hypothetical protein PROPEN_03929 [Proteus penneri ATCC 35198] Length = 325 Score = 38.7 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43 +KA + VPQ+RERL +I S+ + +P+P + D L Sbjct: 120 LKAIFYQVPQKRERLILIAIRKDLVNSINYTWPSPYHKVMTMRDAL 165 >gi|313123965|ref|YP_004034224.1| modification methylase rho11Si family protein [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|312280528|gb|ADQ61247.1| Modification methylase Rho11sI family protein [Lactobacillus delbrueckii subsp. bulgaricus ND02] Length = 349 Score = 38.7 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Query: 2 KACDFGVPQRRERLYIIDFLNPSV 25 D+ +PQ RER+YI+ L Sbjct: 151 NTADY-LPQNRERVYIVGHLRKKN 173 >gi|323143137|ref|ZP_08077837.1| DNA (cytosine-5-)-methyltransferase [Succinatimonas hippei YIT 12066] gi|322417087|gb|EFY07721.1| DNA (cytosine-5-)-methyltransferase [Succinatimonas hippei YIT 12066] Length = 541 Score = 38.7 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A DFGVPQ+RER ++ + + Sbjct: 318 LCAADFGVPQKRERFVVMGVNSDISD 343 >gi|314998281|ref|ZP_07863147.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecium TX0133a01] gi|313587745|gb|EFR66590.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecium TX0133a01] Length = 171 Score = 38.7 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Query: 1 MKACDFGVPQRRERLYIID 19 + + + VPQ RER+++I Sbjct: 147 LNSKAY-VPQNRERIFLIG 164 >gi|260559315|ref|ZP_05831497.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium C68] gi|261207983|ref|ZP_05922662.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium TC 6] gi|260074675|gb|EEW62995.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium C68] gi|260077782|gb|EEW65494.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium TC 6] Length = 331 Score = 38.7 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Query: 1 MKACDFGVPQRRERLYIID 19 + + + VPQ RER+++I Sbjct: 98 LNSKAY-VPQNRERIFLIG 115 >gi|281420885|ref|ZP_06251884.1| modification methylase DdeI [Prevotella copri DSM 18205] gi|281405177|gb|EFB35857.1| modification methylase DdeI [Prevotella copri DSM 18205] Length = 624 Score = 38.7 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS 24 + + ++GVPQ RER+ I N Sbjct: 365 LLSSNYGVPQNRERVVFIGCRNDQ 388 >gi|331035537|gb|AEC53094.1| DNA-cytosine methyltransferase [Synechococcus phage S-CRM01] Length = 381 Score = 38.7 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 14/61 (22%) Query: 1 MKACDFGVPQRRER-LYI---------ID--FLNPSVEFKFPTPLGIKPRLGDILEEHID 48 M AC GVPQ R+R ++I + FLN S F P G K G+ + ++ Sbjct: 190 MNACRHGVPQNRQRVIFIAVRQDIAEKVGMTFLNISSLF--PPESGTKMTFGEGMVGLVN 247 Query: 49 D 49 D Sbjct: 248 D 248 >gi|168697993|ref|ZP_02730270.1| DNA methyltransferase [Gemmata obscuriglobus UQM 2246] Length = 489 Score = 38.7 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A FGVPQRR R++++ +L Sbjct: 142 LDAQHFGVPQRRRRVFVVGYLGD 164 >gi|229008070|ref|ZP_04165613.1| Phage-related DNA methylase [Bacillus mycoides Rock1-4] gi|228753185|gb|EEM02680.1| Phage-related DNA methylase [Bacillus mycoides Rock1-4] Length = 184 Score = 38.7 bits (90), Expect = 0.26, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 5/24 (20%) Query: 1 MKACDFG-----VPQRRERLYIID 19 + DF VPQ RER++II Sbjct: 101 LNTKDFSTATRPVPQNRERVFIIG 124 >gi|226945654|ref|YP_002800727.1| C-5 cytosine-specific DNA methylase [Azotobacter vinelandii DJ] gi|226720581|gb|ACO79752.1| C-5 cytosine-specific DNA methylase [Azotobacter vinelandii DJ] Length = 501 Score = 38.7 bits (90), Expect = 0.26, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 3/36 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF--KFPTPLG 34 + A +GVPQ RERL+++ + +++ +FP+P Sbjct: 199 LNAAFYGVPQLRERLFLVAV-DATLDVIPQFPSPTH 233 >gi|110834520|ref|YP_693379.1| C-5 cytosine-specific DNA methylase family protein [Alcanivorax borkumensis SK2] gi|110647631|emb|CAL17107.1| C-5 cytosine-specific DNA methylase family protein [Alcanivorax borkumensis SK2] Length = 308 Score = 38.7 bits (90), Expect = 0.26, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Query: 5 DFGVPQRRERLYIIDFLNPSVE-FKFPT 31 DFGVPQ R+RL + + E F FP Sbjct: 141 DFGVPQERKRLIFVGVRSDLGEVFAFPE 168 >gi|303285300|ref|XP_003061940.1| predicted protein [Micromonas pusilla CCMP1545] gi|226456351|gb|EEH53652.1| predicted protein [Micromonas pusilla CCMP1545] Length = 341 Score = 38.7 bits (90), Expect = 0.26, Method: Composition-based stats. Identities = 25/116 (21%), Positives = 41/116 (35%), Gaps = 30/116 (25%) Query: 8 VPQRRERLYIIDFLNPSV---EFKFPTPL-GIKPRLGDIL-------------EEHIDDK 50 VPQ R+R+Y++ F + F++P + DIL + ++D Sbjct: 155 VPQSRKRVYLVGFRKDAALATPFRWPPRRDDCGGTVDDILEEEVEEESPDDGYDADVEDD 214 Query: 51 ----ST---ISNKLWEGHQKRKEN--NKIAGK-GFGYGLFFENSATTNTLSARYYK 96 T +S + + ++ GF LF E TL A Y K Sbjct: 215 DANVFTSCEVSEYQMDRASAYFKRVHHREPDHPGF---LFAETGGVARTLCASYRK 267 >gi|189500352|ref|YP_001959822.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides BS1] gi|189495793|gb|ACE04341.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides BS1] Length = 420 Score = 38.7 bits (90), Expect = 0.26, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP--RLGDILEE 45 + A D+GV QRR+R+ ++ F +P P P ++ ++ E+ Sbjct: 198 LSASDYGVLQRRKRVILVGKKGRQTGF-YPEPQKWNPNVKVSEVFED 243 >gi|229547357|ref|ZP_04436082.1| possible DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX1322] gi|256854885|ref|ZP_05560249.1| predicted protein [Enterococcus faecalis T8] gi|307292237|ref|ZP_07572101.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0411] gi|229307506|gb|EEN73493.1| possible DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX1322] gi|256710445|gb|EEU25489.1| predicted protein [Enterococcus faecalis T8] gi|306496743|gb|EFM66296.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0411] gi|315028686|gb|EFT40618.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX4000] Length = 391 Score = 38.7 bits (90), Expect = 0.26, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 16/26 (61%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A DFGVPQ R R +++ N +E Sbjct: 218 LNALDFGVPQSRSRTFMLSIRNKDIE 243 >gi|159477138|ref|XP_001696668.1| cytosine-C5 specific DNA methyltransferase [Chlamydomonas reinhardtii] gi|158282893|gb|EDP08645.1| cytosine-C5 specific DNA methyltransferase [Chlamydomonas reinhardtii] Length = 1263 Score = 38.7 bits (90), Expect = 0.26, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A ++GVPQ R+R++II L V +P P+ Sbjct: 916 LNAGNYGVPQSRKRMFIIAALPEEVLPNWPRPMHS 950 >gi|145294975|ref|YP_001137796.1| hypothetical protein cgR_0920 [Corynebacterium glutamicum R] gi|140844895|dbj|BAF53894.1| hypothetical protein [Corynebacterium glutamicum R] Length = 331 Score = 38.7 bits (90), Expect = 0.27, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL 39 ++A +FGVPQ R+RL +I +P P ++ Sbjct: 129 LQAAEFGVPQSRKRLVLIGARKDVPLPVYPEPTHSARKI 167 >gi|291525775|emb|CBK91362.1| DNA-methyltransferase (dcm) [Eubacterium rectale DSM 17629] Length = 510 Score = 38.7 bits (90), Expect = 0.27, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 21/69 (30%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A +GVPQRR R++++ +F G+IL E S+ +W Sbjct: 190 LDAQFWGVPQRRNRIFLV------ADF-------GGHSAGEILFE--------SDNVWRN 228 Query: 61 HQKRKENNK 69 +QK++E K Sbjct: 229 YQKKREERK 237 >gi|307149806|ref|YP_003890849.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822] gi|306986606|gb|ADN18484.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822] Length = 645 Score = 38.7 bits (90), Expect = 0.27, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIK 36 + A DFGVPQ R+R +++ N E P L I Sbjct: 164 LDAADFGVPQCRKRFFLVATNNLIPLELTLPKKLSIT 200 >gi|300861667|ref|ZP_07107751.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TUSoD Ef11] gi|300849128|gb|EFK76881.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TUSoD Ef11] Length = 385 Score = 38.7 bits (90), Expect = 0.27, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 16/26 (61%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A DFGVPQ R R +++ N +E Sbjct: 212 LNALDFGVPQSRSRTFMLSIRNKDIE 237 >gi|312890850|ref|ZP_07750379.1| DNA-cytosine methyltransferase [Mucilaginibacter paludis DSM 18603] gi|311296633|gb|EFQ73773.1| DNA-cytosine methyltransferase [Mucilaginibacter paludis DSM 18603] Length = 336 Score = 38.7 bits (90), Expect = 0.28, Method: Composition-based stats. Identities = 13/51 (25%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIK-PRLGDILEEHIDD 49 + + D+GV Q R R ++ + F +P + P +G +L E I Sbjct: 155 INSSDYGVSQLRPRAILVALKKEYFDLFTWPEKNQLFVPSVGQLLFEEITS 205 >gi|301321463|gb|ADK70106.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale] Length = 493 Score = 38.7 bits (90), Expect = 0.28, Method: Composition-based stats. Identities = 22/95 (23%), Positives = 38/95 (40%), Gaps = 14/95 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTI------- 53 + A DFGVPQ R R II N ++ P+G ++ +E+ I D + + Sbjct: 126 LNAYDFGVPQTRSRTTIICHKNHPIKL----PIGNHKKVN--IEDAISDLNYLNSNQGEF 179 Query: 54 -SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATT 87 SN L E + ++ + + +S Sbjct: 180 ESNYLLEPKSEYQKMMRKNSNKLYNHITTNHSKIA 214 >gi|2894387|emb|CAA74997.1| Bpu10I (5m)cytosine-specific DNA modification methyltransferase (C2) [Bacillus pumilus] Length = 392 Score = 38.7 bits (90), Expect = 0.29, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Query: 1 MKACDFGVPQRRERLYII-----DFLNPSVEFKFPTPLGIKPRLGDILEE 45 + DFGVPQ R+R+++I F+ + ++ K +G+ LE+ Sbjct: 152 LNTSDFGVPQGRQRVFVIAARNEAFIPLEIIGEYTQGKKAKRTVGEALED 201 >gi|311899150|dbj|BAJ31558.1| putative modification methylase [Kitasatospora setae KM-6054] Length = 430 Score = 38.7 bits (90), Expect = 0.29, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIK-PRLGDILEEHIDDKSTISN 55 ++A FGVPQ R R ++ F +P + + D L++ + + ++ Sbjct: 173 LEAASFGVPQLRPRAILVAIRKDLYRGFTWPKRTEAEGRTVFDALDKSMRKRFGMNP 229 >gi|298206640|ref|YP_003714819.1| site-specific DNA-methyltransferase [Croceibacter atlanticus HTCC2559] gi|83849270|gb|EAP87138.1| site-specific DNA-methyltransferase [Croceibacter atlanticus HTCC2559] Length = 735 Score = 38.7 bits (90), Expect = 0.29, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 12/23 (52%) Query: 2 KACDFGVPQRRERLYIIDFLNPS 24 A ++GVPQ RER+ I Sbjct: 470 NASNYGVPQNRERVLFIGCRKDQ 492 >gi|332655061|ref|ZP_08420802.1| modification methylase NgoFVII (Cytosine-specificmethyltransferase NgoFVII) (M.NgoFVII) (M.NgoVII) [Ruminococcaceae bacterium D16] gi|332515921|gb|EGJ45530.1| modification methylase NgoFVII (Cytosine-specificmethyltransferase NgoFVII) (M.NgoFVII) (M.NgoVII) [Ruminococcaceae bacterium D16] Length = 369 Score = 38.7 bits (90), Expect = 0.30, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 ++GVPQ RER+ + F F P G++ Sbjct: 158 NFAEYGVPQFRERVLFVGVR-IDTGFNFVHPKPTHGPNGEL 197 >gi|172038906|ref|YP_001805407.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142] gi|171700360|gb|ACB53341.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142] Length = 427 Score = 38.7 bits (90), Expect = 0.30, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 15/59 (25%) Query: 1 MKACDFGVPQRRERLYIID------------F---LNPSVEFKFPTPLGIKPRLGDILE 44 + A ++GVPQ RERL+++ F N P +K + D+ E Sbjct: 157 LNAANYGVPQLRERLFLLGAKQGLKLPNYPDFVTKYNQQDNLSLPLTPTVKDAIQDLPE 215 >gi|149373121|ref|ZP_01892009.1| site-specific DNA-methyltransferase [unidentified eubacterium SCB49] gi|149354269|gb|EDM42838.1| site-specific DNA-methyltransferase [unidentified eubacterium SCB49] Length = 735 Score = 38.4 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 12/23 (52%) Query: 2 KACDFGVPQRRERLYIIDFLNPS 24 A ++GVPQ RER+ I Sbjct: 470 NASNYGVPQNRERVLFIGCRKDQ 492 >gi|91976449|ref|YP_569108.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris BisB5] gi|91682905|gb|ABE39207.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris BisB5] Length = 490 Score = 38.4 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 7/23 (30%), Positives = 13/23 (56%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A FG PQ R R++++ + Sbjct: 171 LNARYFGSPQSRSRVFMVAWRGD 193 >gi|260890544|ref|ZP_05901807.1| hypothetical protein GCWU000323_01722 [Leptotrichia hofstadii F0254] gi|260859786|gb|EEX74286.1| site-specific DNA-methyltransferase [Leptotrichia hofstadii F0254] Length = 425 Score = 38.4 bits (89), Expect = 0.31, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKS 51 + + +G +RERL I+ N +EF FP P + I + ++ +K Sbjct: 203 LNSAWYGAATKRERLIIVAVKNEIDIEFNFPKPKYMNKL---IYKSNLPEKY 251 >gi|159899163|ref|YP_001545410.1| C-5 cytosine-specific DNA methylase [Herpetosiphon aurantiacus ATCC 23779] gi|159892202|gb|ABX05282.1| C-5 cytosine-specific DNA methylase [Herpetosiphon aurantiacus ATCC 23779] Length = 362 Score = 38.4 bits (89), Expect = 0.31, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 + A D+G PQ R+R+ I+ P P Sbjct: 296 VNAADYGTPQLRKRIIILGCKQDLGFVNLPLPTH 329 >gi|227524411|ref|ZP_03954460.1| possible DNA (cytosine-5-)-methyltransferase [Lactobacillus hilgardii ATCC 8290] gi|227088642|gb|EEI23954.1| possible DNA (cytosine-5-)-methyltransferase [Lactobacillus hilgardii ATCC 8290] Length = 193 Score = 38.4 bits (89), Expect = 0.31, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 14/27 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF 27 + +FGVPQ R+RL ++ F Sbjct: 4 INVKNFGVPQNRKRLVLLGSKKQQPNF 30 >gi|197105892|ref|YP_002131269.1| DNA (cytosine-5-)-methyltransferase protein [Phenylobacterium zucineum HLK1] gi|196479312|gb|ACG78840.1| DNA (cytosine-5-)-methyltransferase protein [Phenylobacterium zucineum HLK1] Length = 508 Score = 38.4 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34 + A +GVPQ RER+ +I VE +FP P Sbjct: 198 LNAAFYGVPQMRERMILIATRRELGVEIRFPAPTH 232 >gi|68249825|ref|YP_248937.1| modification methylase BepI-like [Haemophilus influenzae 86-028NP] gi|68058024|gb|AAX88277.1| modification methylase BepI-like [Haemophilus influenzae 86-028NP] gi|309973261|gb|ADO96462.1| DNA (cytosine-5-)-methyltransferase [Haemophilus influenzae R2846] Length = 407 Score = 38.4 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A +GVPQ RER+ F ++ K L + Sbjct: 205 LNAQFYGVPQSRERVIFFGFKKNALNKKALEELQKE 240 >gi|314940601|ref|ZP_07847733.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecium TX0133a04] gi|313640221|gb|EFS04802.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecium TX0133a04] Length = 289 Score = 38.4 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Query: 1 MKACDFGVPQRRERLYIID 19 + + + VPQ RER+++I Sbjct: 56 LNSKAY-VPQNRERIFLIG 73 >gi|228931114|ref|ZP_04094051.1| Phage-related DNA methylase [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] gi|228828566|gb|EEM74265.1| Phage-related DNA methylase [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] Length = 221 Score = 38.4 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 5/24 (20%) Query: 1 MKACDFG-----VPQRRERLYIID 19 + DF VPQ RER++II Sbjct: 133 LNTRDFSTAERPVPQNRERVFIIG 156 >gi|255608013|ref|XP_002538828.1| cytosine-specific methyltransferase, putative [Ricinus communis] gi|223510238|gb|EEF23555.1| cytosine-specific methyltransferase, putative [Ricinus communis] Length = 209 Score = 38.4 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 14/57 (24%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISN 55 + A DFGVPQ R RL ++ LG KP L LE + K ISN Sbjct: 29 LDAADFGVPQHRRRLIVVA------------GLGWKPTLPVPLEGRALVSAKEAISN 73 >gi|160894869|ref|ZP_02075643.1| hypothetical protein CLOL250_02419 [Clostridium sp. L2-50] gi|156863300|gb|EDO56731.1| hypothetical protein CLOL250_02419 [Clostridium sp. L2-50] Length = 423 Score = 38.4 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE 45 + A +FGV Q R+R+ I+ +L + +++P+ + K + D+L++ Sbjct: 202 LNAQNFGVLQSRKRVIIVGWLKGT-GYEYPSFDVIHSKAEVWDLLKD 247 >gi|56899928|ref|YP_173301.1| phage-related DNA methylase, N-terminal region [Bacillus thuringiensis serovar konkukian str. 97-27] gi|56800362|gb|AAW31029.1| phage-related DNA methylase, N-terminal region [Bacillus thuringiensis serovar konkukian str. 97-27] Length = 239 Score = 38.4 bits (89), Expect = 0.33, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 13/24 (54%), Gaps = 5/24 (20%) Query: 1 MKACDFG-----VPQRRERLYIID 19 + DF VPQ RER++II Sbjct: 151 LNTRDFSTAERPVPQNRERVFIIG 174 >gi|229847093|ref|ZP_04467198.1| modification methylase BepI-like protein [Haemophilus influenzae 7P49H1] gi|229809922|gb|EEP45643.1| modification methylase BepI-like protein [Haemophilus influenzae 7P49H1] Length = 395 Score = 38.4 bits (89), Expect = 0.34, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A +GVPQ RER+ F ++ K L + Sbjct: 193 LNAQFYGVPQSRERVIFFGFKKNALNKKALEELQKE 228 >gi|325126553|gb|ADY85883.1| DNA-cytosine methyltransferase family protein [Lactobacillus delbrueckii subsp. bulgaricus 2038] Length = 380 Score = 38.4 bits (89), Expect = 0.35, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Query: 6 FGVPQRRERLYIIDFLNP-SVEF---KFPTPLGIKP 37 +GVPQ R R+ I+ N +V+F + P P P Sbjct: 167 YGVPQMRHRIIIVGIRNDLAVKFIMSQLPAPTTPNP 202 >gi|288559285|ref|YP_003422771.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1] gi|288541995|gb|ADC45879.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1] Length = 342 Score = 38.4 bits (89), Expect = 0.35, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 + A + GVPQ+R+R+ I + + +FP P K + + L Sbjct: 152 LDASEHGVPQKRKRVIFIG--SRIGDVEFPKPKDKKVSVMEAL 192 >gi|169834887|ref|YP_001715830.1| modification methylase [Clostridium botulinum A3 str. Loch Maree] gi|169408994|gb|ACA57404.1| DNA (cytosine-5-)-methyltransferase [Clostridium botulinum A3 str. Loch Maree] Length = 284 Score = 38.4 bits (89), Expect = 0.36, Method: Composition-based stats. Identities = 23/93 (24%), Positives = 33/93 (35%), Gaps = 19/93 (20%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID---DKSTISNKLWEGHQKR 64 +PQ+R+RL +I P K+P IK L D+LE+ + K G + Sbjct: 144 LPQKRKRLILIGTKRPFDNLKYPESNPIK--LKDLLEDDPEIDIPNYVY--KRLNGAYRD 199 Query: 65 KENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97 K + T A Y KD Sbjct: 200 KP------------IISTPEGVAPTCVAHYSKD 220 >gi|90408525|ref|ZP_01216682.1| DNA-methyltransferase (cytosine-specific) [Psychromonas sp. CNPT3] gi|90310344|gb|EAS38472.1| DNA-methyltransferase (cytosine-specific) [Psychromonas sp. CNPT3] Length = 380 Score = 38.4 bits (89), Expect = 0.37, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 1 MKACDFG-VPQRRERLYIIDFLNPSVEFKF 29 + + +PQ RER++I+ FL S KF Sbjct: 173 LNTKTYTTLPQNRERMFIVCFLKQSDADKF 202 >gi|225561042|gb|EEH09323.1| C-5 cytosine methyltransferase DmtA [Ajellomyces capsulatus G186AR] Length = 650 Score = 38.4 bits (89), Expect = 0.38, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 17/37 (45%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 + D+GVPQ R+RL I+ FP P P Sbjct: 467 LNCRDYGVPQSRQRLVILASGPGEPLPPFPKPTHTSP 503 >gi|89055349|ref|YP_510800.1| DNA-cytosine methyltransferase [Jannaschia sp. CCS1] gi|88864898|gb|ABD55775.1| DNA-cytosine methyltransferase [Jannaschia sp. CCS1] Length = 502 Score = 38.0 bits (88), Expect = 0.39, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 12/47 (25%) Query: 1 MKACDF-------GVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40 + A DF GVPQ R R++++ N PTP G P + Sbjct: 220 LAARDFIVRAEEHGVPQARHRVFVVGIRND-----LPTPEGDMPLMP 261 >gi|238922584|ref|YP_002936097.1| modification methylase, putative [Eubacterium rectale ATCC 33656] gi|238874256|gb|ACR73963.1| modification methylase, putative [Eubacterium rectale ATCC 33656] Length = 433 Score = 38.0 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 10/18 (55%), Positives = 15/18 (83%) Query: 1 MKACDFGVPQRRERLYII 18 + A +FG+PQ+RER Y+I Sbjct: 227 LNAQNFGIPQKRERAYMI 244 >gi|240280401|gb|EER43905.1| C-5 cytosine methyltransferase DmtA [Ajellomyces capsulatus H143] Length = 651 Score = 38.0 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 17/37 (45%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 + D+GVPQ R+RL I+ FP P P Sbjct: 468 LNCRDYGVPQSRQRLVILASGPGEPLPPFPKPTHTSP 504 >gi|255692343|ref|ZP_05416018.1| DNA (cytosine-5-)-methyltransferase [Bacteroides finegoldii DSM 17565] gi|260621969|gb|EEX44840.1| DNA (cytosine-5-)-methyltransferase [Bacteroides finegoldii DSM 17565] Length = 297 Score = 38.0 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 21/64 (32%), Gaps = 8/64 (12%) Query: 8 VPQRRERLYIIDFLNPSVE---FKFPTP-LGIKPRLGDILEEH----IDDKSTISNKLWE 59 +PQ RER+Y++ + F FP P G P D + H I Sbjct: 151 LPQNRERIYLVGRVADRCTGDVFPFPAPGGGNHPCRKDTVHSHTCGTITRNYYKQPNFGN 210 Query: 60 GHQK 63 Sbjct: 211 YLIN 214 >gi|239927639|ref|ZP_04684592.1| DNA methylase [Streptomyces ghanaensis ATCC 14672] gi|291435979|ref|ZP_06575369.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291338874|gb|EFE65830.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 387 Score = 38.0 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A D+GVPQ R+R +I V P P K Sbjct: 162 LNAADYGVPQTRQRAILIASRTRKV--TAPDPTHAK 195 >gi|218556814|ref|YP_002389728.1| putative modification methylase NmeDIP [Escherichia coli IAI1] gi|218363583|emb|CAR01240.1| putative modification methylase NmeDIP [Escherichia coli IAI1] Length = 379 Score = 38.0 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 18/29 (62%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKF 29 + + ++G PQ R+R+ +I FL+ +F Sbjct: 166 INSIEYGAPQDRQRIILIGFLDEKYASQF 194 >gi|325096531|gb|EGC49841.1| C-5 cytosine methyltransferase DmtA [Ajellomyces capsulatus H88] Length = 651 Score = 38.0 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 17/37 (45%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 + D+GVPQ R+RL I+ FP P P Sbjct: 468 LNCRDYGVPQSRQRLVILASGPGEPLPPFPKPTHTSP 504 >gi|320007884|gb|ADW02734.1| DNA-cytosine methyltransferase [Streptomyces flavogriseus ATCC 33331] Length = 660 Score = 38.0 bits (88), Expect = 0.42, Method: Composition-based stats. Identities = 21/100 (21%), Positives = 43/100 (43%), Gaps = 7/100 (7%) Query: 6 FGVPQRRERLYIIDFLNPSVEFKFPTPL--GIKPRLGDILEEHIDDKSTISNKLWEGHQK 63 +GVPQ R+RL ++ N F + L + L D + + + ++ + Sbjct: 205 YGVPQHRKRLILLA-RNDVERFSWRQELEQEQRTTLRDAIGDLPVLPVVPTERVGQRELP 263 Query: 64 RKENNKIAGKGFGYGL--FFENSATTNTLSARYYKDGSEI 101 E ++++ GFG + + + ++ R KD +EI Sbjct: 264 YDEPSELS--GFGKDMRKWARKDRVWDHMTRRVRKDDAEI 301 >gi|257386518|ref|YP_003176291.1| DNA-cytosine methyltransferase [Halomicrobium mukohataei DSM 12286] gi|257168825|gb|ACV46584.1| DNA-cytosine methyltransferase [Halomicrobium mukohataei DSM 12286] Length = 452 Score = 38.0 bits (88), Expect = 0.42, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + + D+G+PQ R+RL+ I Sbjct: 172 LDSADYGIPQHRKRLFFIG 190 >gi|218460006|ref|ZP_03500097.1| DNA-cytosine methyltransferase [Rhizobium etli Kim 5] Length = 343 Score = 38.0 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40 A DFG+PQ R R+ I+ P PRL Sbjct: 202 AEDFGIPQARHRVIIVGVRRDIAS---RLPHWFSPRLK 236 >gi|182438469|ref|YP_001826188.1| putative 5-methylcytosine methyltransferase [Streptomyces griseus subsp. griseus NBRC 13350] gi|178466985|dbj|BAG21505.1| putative 5-methylcytosine methyltransferase [Streptomyces griseus subsp. griseus NBRC 13350] Length = 317 Score = 38.0 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKP-RLGDILEEHIDDK 50 + A DFGVPQ R++ ++ + + F P P + +G L + + Sbjct: 149 LNAADFGVPQDRKQGVLVALKDRYFDAFVPPAPTVTEHLPVGPALRSSVGAR 200 >gi|126657178|ref|ZP_01728344.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. CCY0110] gi|126621449|gb|EAZ92160.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. CCY0110] Length = 433 Score = 38.0 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 15/59 (25%) Query: 1 MKACDFGVPQRRERLYIID------------F---LNPSVEFKFPTPLGIKPRLGDILE 44 + A ++GVPQ RERL+++ F N PT +K + D+ E Sbjct: 157 LNAANYGVPQLRERLFLLGAKQGLILPNYPNFVTQYNQQDNLFLPTTPNVKDAIQDLPE 215 >gi|331219056|ref|XP_003322205.1| hypothetical protein PGTG_03742 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] gi|309301195|gb|EFP77786.1| hypothetical protein PGTG_03742 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 1194 Score = 38.0 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG-DILEEHIDDK 50 ++A FG PQ R R+ + K P P P G IL D+K Sbjct: 694 LQAAQFGSPQARRRIIFAGTRHGLTAIKLPEPTHHYPDEGLAILLPTNDEK 744 >gi|291539795|emb|CBL12906.1| Site-specific DNA methylase [Roseburia intestinalis XB6B4] Length = 251 Score = 38.0 bits (88), Expect = 0.44, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 16/41 (39%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + D+GVPQ R+RL + N + K L Sbjct: 34 LNCADYGVPQTRKRLVLHGIRNDVYQLLIQNQPNFKISLPS 74 >gi|193071751|ref|ZP_03052649.1| DNA-cytosine methyltransferase [Escherichia coli E110019] gi|192954951|gb|EDV85456.1| DNA-cytosine methyltransferase [Escherichia coli E110019] Length = 374 Score = 38.0 bits (88), Expect = 0.44, Method: Composition-based stats. Identities = 11/50 (22%), Positives = 17/50 (34%), Gaps = 4/50 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF----KFPTPLGIKPRLGDILEEH 46 + D+GVPQ R+R I + FP + D+ Sbjct: 152 LNTADYGVPQTRKRTIAIGIKRELFDVHSIPAFPPAPTHRSPDKDVALPE 201 >gi|194335097|ref|YP_002016957.1| DNA-cytosine methyltransferase [Prosthecochloris aestuarii DSM 271] gi|194312915|gb|ACF47310.1| DNA-cytosine methyltransferase [Prosthecochloris aestuarii DSM 271] Length = 340 Score = 38.0 bits (88), Expect = 0.46, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 + D+GVPQ R+RL ++ + + P K + ++ Sbjct: 152 VNIKDYGVPQSRKRLVLVG--SRLAPLRIAEPTKKKKTVRQVI 192 >gi|310815193|ref|YP_003963157.1| DNA-cytosine methyltransferase [Ketogulonicigenium vulgare Y25] gi|308753928|gb|ADO41857.1| DNA-cytosine methyltransferase [Ketogulonicigenium vulgare Y25] Length = 555 Score = 38.0 bits (88), Expect = 0.46, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---GIKPRLGDILEEHIDDKSTIS 54 ++A FGVPQRR R+ I+ + + G+ + D++E +S IS Sbjct: 281 VRAEAFGVPQRRHRVIIVGIRSDLAGRAADAEIAVSGMARTVRDVIETMPALRSGIS 337 >gi|313676237|ref|YP_004054233.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] gi|312942935|gb|ADR22125.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] Length = 448 Score = 38.0 bits (88), Expect = 0.47, Method: Composition-based stats. Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 1 MKACDFGVPQRRERLYIIDFLN 22 + + D+GVPQ RER++ I Sbjct: 239 LHSADYGVPQSRERVFFIGIKK 260 >gi|302876801|ref|YP_003845434.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] gi|307687484|ref|ZP_07629930.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] gi|302579658|gb|ADL53670.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B] Length = 406 Score = 38.0 bits (88), Expect = 0.48, Method: Composition-based stats. Identities = 8/23 (34%), Positives = 13/23 (56%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A ++ VPQ RER+ I+ Sbjct: 185 INASEYSVPQNRERMIIVGIDKK 207 >gi|210630626|ref|ZP_03296529.1| hypothetical protein COLSTE_00414 [Collinsella stercoris DSM 13279] gi|210160401|gb|EEA91372.1| hypothetical protein COLSTE_00414 [Collinsella stercoris DSM 13279] Length = 402 Score = 38.0 bits (88), Expect = 0.48, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILE---EHIDDKSTISN 55 + ++GVPQRRER+ ++ V+ F+ I+ R I +D+ + Sbjct: 291 VNCANYGVPQRRERVIVLGAAQHVVDSFELAPITRIEVRTKSISRITNAGVDESYPLVP 349 >gi|149919032|ref|ZP_01907517.1| DNA-cytosine methyltransferase family protein [Plesiocystis pacifica SIR-1] gi|149820185|gb|EDM79604.1| DNA-cytosine methyltransferase family protein [Plesiocystis pacifica SIR-1] Length = 401 Score = 38.0 bits (88), Expect = 0.48, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 + A D+GVPQ R+RL+++ + +F P+P Sbjct: 168 VNAADYGVPQFRQRLFVLASIEGK-DFSMPSPTH 200 >gi|119384793|ref|YP_915849.1| DNA-cytosine methyltransferase [Paracoccus denitrificans PD1222] gi|119374560|gb|ABL70153.1| DNA-cytosine methyltransferase [Paracoccus denitrificans PD1222] Length = 511 Score = 38.0 bits (88), Expect = 0.48, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---GIKPRLGDILEEHIDDKSTIS 54 ++A FGVPQRR R+ I+ + + G+ + D++E +S IS Sbjct: 237 VRAEAFGVPQRRHRVIIVGIRSDLAGRAADAEIAVSGMARTVRDVIETMPALRSGIS 293 >gi|294629551|ref|ZP_06708111.1| modification methylase NaeI [Streptomyces sp. e14] gi|292832884|gb|EFF91233.1| modification methylase NaeI [Streptomyces sp. e14] Length = 328 Score = 38.0 bits (88), Expect = 0.49, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP-RLGDILEEHIDDK 50 + A D+GVPQ R++ ++ + F+ PTP +P +G LE + + Sbjct: 146 VNAVDYGVPQNRKQGLLVAVERRWAEAFRPPTPTVRQPMTVGAALEASMAAR 197 >gi|85706642|ref|ZP_01037734.1| modification methylase (Cytosine-specific methyltransferase [Roseovarius sp. 217] gi|85668700|gb|EAQ23569.1| modification methylase (Cytosine-specific methyltransferase [Roseovarius sp. 217] Length = 511 Score = 38.0 bits (88), Expect = 0.49, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 ++A +FGVPQRR R+ I+ + Sbjct: 237 VRAEEFGVPQRRHRVIIVGIRSD 259 >gi|154277578|ref|XP_001539629.1| predicted protein [Ajellomyces capsulatus NAm1] gi|150413214|gb|EDN08597.1| predicted protein [Ajellomyces capsulatus NAm1] Length = 699 Score = 38.0 bits (88), Expect = 0.49, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 17/37 (45%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 + D+GVPQ R+RL I+ FP P P Sbjct: 467 LNCRDYGVPQSRQRLVILASGPGEPLPPFPKPTHASP 503 >gi|120402107|ref|YP_951936.1| DNA-cytosine methyltransferase [Mycobacterium vanbaalenii PYR-1] gi|119954925|gb|ABM11930.1| DNA-cytosine methyltransferase [Mycobacterium vanbaalenii PYR-1] Length = 386 Score = 38.0 bits (88), Expect = 0.49, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Query: 4 CDFGVPQRRERLYIIDFLNPSVEF--KFPTPLGIKPR-LGDILEEHI 47 D GVPQ R+RL ++ P P PR + + L+E+ Sbjct: 174 ADLGVPQHRDRLIVVGVRRDLGIRPPAIPRPFAGNPRTVREALDENP 220 >gi|186683285|ref|YP_001866481.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102] gi|186465737|gb|ACC81538.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102] Length = 419 Score = 38.0 bits (88), Expect = 0.50, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A D+GVPQ R+R++ + Sbjct: 161 LNASDYGVPQARKRVFFVA 179 >gi|327439466|dbj|BAK15831.1| site-specific DNA methylase [Solibacillus silvestris StLB046] Length = 286 Score = 38.0 bits (88), Expect = 0.50, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 1 MKACDFGVPQRRERLYIID 19 + + G PQ RER++II Sbjct: 148 INSKHHGQPQNRERVFIIG 166 >gi|325679553|ref|ZP_08159133.1| DNA (cytosine-5-)-methyltransferase [Ruminococcus albus 8] gi|324108840|gb|EGC03076.1| DNA (cytosine-5-)-methyltransferase [Ruminococcus albus 8] Length = 708 Score = 38.0 bits (88), Expect = 0.50, Method: Composition-based stats. Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Query: 1 MKACDFGVPQRRER-LYIIDFLNPSVEFKFPTPLGIK-PRLGDILEE 45 + + D+GVPQ R+R ++I + + + P P K + D + + Sbjct: 499 LNSADYGVPQLRQRAIFI---CSKDIPIELPKPTAKKVTTVRDAIFD 542 >gi|257877766|ref|ZP_05657419.1| C-5 cytosine-specific DNA methylase [Enterococcus casseliflavus EC20] gi|257811932|gb|EEV40752.1| C-5 cytosine-specific DNA methylase [Enterococcus casseliflavus EC20] Length = 416 Score = 37.6 bits (87), Expect = 0.52, Method: Composition-based stats. Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKF 29 +FGVPQ+R+R+ II + + Sbjct: 189 EFGVPQKRKRVIIIGIRRDNDNLNY 213 >gi|67924379|ref|ZP_00517809.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] gi|67853772|gb|EAM49101.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501] Length = 435 Score = 37.6 bits (87), Expect = 0.52, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 21/41 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + + ++GVPQ RERL+++ +P+ + + D Sbjct: 157 LNSANYGVPQLRERLFLLGSKKGLNLPNYPSFITDYTHIND 197 >gi|327438866|dbj|BAK15231.1| site-specific DNA methylase [Solibacillus silvestris StLB046] Length = 392 Score = 37.6 bits (87), Expect = 0.52, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Query: 5 DFGVPQRRERLYIIDFLNPSVE----FKFPTPLGI 35 ++G+PQ R R+ I+ + FK P P Sbjct: 167 EYGIPQARHRIIIVGIRKDLADEGIVFKVPAPTTP 201 >gi|154508844|ref|ZP_02044486.1| hypothetical protein ACTODO_01354 [Actinomyces odontolyticus ATCC 17982] gi|153798478|gb|EDN80898.1| hypothetical protein ACTODO_01354 [Actinomyces odontolyticus ATCC 17982] Length = 355 Score = 37.6 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + A D+GVPQ R R++ + Sbjct: 157 LNAADYGVPQLRRRMFFVG 175 >gi|108763142|ref|YP_631786.1| DNA-cytosine methyltransferase [Myxococcus xanthus DK 1622] gi|108467022|gb|ABF92207.1| DNA-cytosine methyltransferase [Myxococcus xanthus DK 1622] Length = 505 Score = 37.6 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPL 33 + A + VPQ RER +++ + + FP P Sbjct: 187 LNAASYDVPQMRERFFLVAVHKETRSDPSFPVPT 220 >gi|220930206|ref|YP_002507115.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10] gi|220000534|gb|ACL77135.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10] Length = 719 Score = 37.6 bits (87), Expect = 0.54, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVE 26 + A FGVPQRR R+Y++ F + S Sbjct: 176 IDAQYFGVPQRRRRIYLVADFADRSAG 202 >gi|168485680|ref|ZP_02710188.1| modification methylase HaeIII (Cytosine-specificmethyltransferase HaeIII) (M.HaeIII) [Streptococcus pneumoniae CDC1087-00] gi|183571278|gb|EDT91806.1| modification methylase HaeIII (Cytosine-specificmethyltransferase HaeIII) (M.HaeIII) [Streptococcus pneumoniae CDC1087-00] Length = 363 Score = 37.6 bits (87), Expect = 0.54, Method: Composition-based stats. Identities = 11/48 (22%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDIL 43 + D+GVPQ R+RL + ++ P+ D+L Sbjct: 152 LNTADYGVPQSRKRLVLHGIRKEILDNTNLTLNLPSKTHSNIPELDLL 199 >gi|313674498|ref|YP_004052494.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] gi|312941196|gb|ADR20386.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126] Length = 735 Score = 37.6 bits (87), Expect = 0.57, Method: Composition-based stats. Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 2 KACDFGVPQRRERLYIIDFLNPS 24 + ++GVPQ RER+ I Sbjct: 472 NSSNYGVPQNRERVLFIGCRKDQ 494 >gi|308062818|gb|ADO04706.1| site-specific DNA-methyltransferase [Helicobacter pylori Cuz20] Length = 418 Score = 37.6 bits (87), Expect = 0.57, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILE 44 + + +G +RERL I+ N F FP P + + L+ Sbjct: 214 LNSAWYGSATKRERLIIVAIRNDLPFNFTFPKPTHLSDEINTKLD 258 >gi|317132208|ref|YP_004091522.1| DNA-cytosine methyltransferase [Ethanoligenens harbinense YUAN-3] gi|315470187|gb|ADU26791.1| DNA-cytosine methyltransferase [Ethanoligenens harbinense YUAN-3] Length = 346 Score = 37.6 bits (87), Expect = 0.57, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL 39 + A D+G+PQ+R R++ E P + P + Sbjct: 161 LLASDYGLPQKRNRIFFCGIRKDLTE---PKGISEPPVV 196 >gi|126667824|ref|ZP_01738791.1| C-5 cytosine-specific DNA methylase [Marinobacter sp. ELB17] gi|126627772|gb|EAZ98402.1| C-5 cytosine-specific DNA methylase [Marinobacter sp. ELB17] Length = 327 Score = 37.6 bits (87), Expect = 0.57, Method: Composition-based stats. Identities = 26/106 (24%), Positives = 44/106 (41%), Gaps = 16/106 (15%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPR---LGDILEEHIDDKSTIS 54 + D+G + R+RL +I L F + ++ + L DIL+ +D Sbjct: 209 LNGNDYGCIENRDRLVVIAISKSLQALGGFDMSDIIPVRTKEATLNDILDPISED----- 263 Query: 55 NKLWEGHQKRKENNK----IAGKGFGYGLFFENSATTNTLSARYYK 96 + W+ H + E + AGKGF L+ + N L+ Y K Sbjct: 264 DSAWKIH-EYLEKKEVSDIAAGKGFRRQLYTGAEESINVLTRGYAK 308 >gi|311234076|gb|ADP86930.1| DNA-cytosine methyltransferase [Desulfovibrio vulgaris RCH1] Length = 489 Score = 37.6 bits (87), Expect = 0.57, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGVPQRR R++++ Sbjct: 145 LDAQYFGVPQRRRRVFVVG 163 >gi|46579926|ref|YP_010734.1| type II DNA modification methyltransferase [Desulfovibrio vulgaris str. Hildenborough] gi|46449342|gb|AAS95993.1| type II DNA modification methyltransferase, putative [Desulfovibrio vulgaris str. Hildenborough] Length = 487 Score = 37.6 bits (87), Expect = 0.57, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGVPQRR R++++ Sbjct: 143 LDAQYFGVPQRRRRVFVVG 161 >gi|315150308|gb|EFT94324.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0012] Length = 334 Score = 37.6 bits (87), Expect = 0.58, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFP----TPLGIKPRLGDILEEHIDDKS 51 + + + VPQ RER++II FP I P+ G I+ + +K Sbjct: 147 LNSKAY-VPQNRERVFIIGHSRAERTPQIFPLTREDKPVIHPKKGIIVVGKLPEKY 201 >gi|124486003|ref|YP_001030619.1| hypothetical protein Mlab_1183 [Methanocorpusculum labreanum Z] gi|124363544|gb|ABN07352.1| DNA-cytosine methyltransferase [Methanocorpusculum labreanum Z] Length = 352 Score = 37.6 bits (87), Expect = 0.58, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Query: 1 MKACDFGVPQRRERLYIID---FLNPSVEFKF-PTPLGIKPRL 39 + A D+GVPQ+R+RL II F+ + ++ P G KP + Sbjct: 158 VNANDYGVPQKRKRLVIIASRFFIPKIPDGEYGPNNSGKKPYV 200 >gi|320094594|ref|ZP_08026360.1| DNA (cytosine-5-)-methyltransferase [Actinomyces sp. oral taxon 178 str. F0338] gi|319978509|gb|EFW10086.1| DNA (cytosine-5-)-methyltransferase [Actinomyces sp. oral taxon 178 str. F0338] Length = 365 Score = 37.6 bits (87), Expect = 0.59, Method: Composition-based stats. Identities = 16/69 (23%), Positives = 26/69 (37%), Gaps = 9/69 (13%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP---RLGDILEEHIDDKSTISNKLWE 59 A D+GV QRR R+ + F + V F P + + ++E D Sbjct: 193 ALDYGVAQRRYRVIVSGFRDREVSRAF-KPKKAETGNLTVRSVIEGLPDPVFFT-----H 246 Query: 60 GHQKRKENN 68 G Q+ + Sbjct: 247 GLQRTAIPH 255 >gi|306829493|ref|ZP_07462683.1| DNA (cytosine-5-)-methyltransferase [Streptococcus mitis ATCC 6249] gi|304428579|gb|EFM31669.1| DNA (cytosine-5-)-methyltransferase [Streptococcus mitis ATCC 6249] Length = 450 Score = 37.6 bits (87), Expect = 0.59, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 7/54 (12%) Query: 3 ACDFGVPQRRER-LYIIDFLNPSVEFKFPTPLGIKPRLGDI------LEEHIDD 49 A ++GV Q RER +Y++ ++ +++++FP P + D L+ + D Sbjct: 225 AKNYGVAQSRERCVYLLSRIDTNIQWEFPEPSTKIVTMRDAIGDLPSLDPDVTD 278 >gi|256819720|ref|YP_003140999.1| DNA-cytosine methyltransferase [Capnocytophaga ochracea DSM 7271] gi|256581303|gb|ACU92438.1| DNA-cytosine methyltransferase [Capnocytophaga ochracea DSM 7271] Length = 389 Score = 37.6 bits (87), Expect = 0.59, Method: Composition-based stats. Identities = 21/92 (22%), Positives = 38/92 (41%), Gaps = 29/92 (31%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67 +PQ RER+Y+I + G+ P D ++L++ + RKE Sbjct: 151 LPQNRERIYLIG------HLAGRSECGVFPITED-------------DRLFK-RETRKE- 189 Query: 68 NKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99 G + ++ T+++RY+K GS Sbjct: 190 -----NGEFPSI---KTSPARTITSRYHKMGS 213 >gi|325286536|ref|YP_004262326.1| DNA-cytosine methyltransferase [Cellulophaga lytica DSM 7489] gi|324321990|gb|ADY29455.1| DNA-cytosine methyltransferase [Cellulophaga lytica DSM 7489] Length = 414 Score = 37.6 bits (87), Expect = 0.59, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 24/61 (39%), Gaps = 13/61 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A ++ VPQ+RER+ I N + L KP L DK + + E Sbjct: 247 LNAANYYVPQKRERIIFIA--NRIGK----KNLHPKPLLT-------PDKYITTKQAIED 293 Query: 61 H 61 Sbjct: 294 L 294 >gi|172038386|ref|YP_001804887.1| site-specific DNA-methyltransferase [Cyanothece sp. ATCC 51142] gi|171699840|gb|ACB52821.1| probable site-specific DNA-methyltransferase [Cyanothece sp. ATCC 51142] Length = 461 Score = 37.6 bits (87), Expect = 0.62, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Query: 2 KACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGI 35 + +FG PQ RER+ II N F PT Sbjct: 243 NSANFGTPQIRERVVIICSRNGEKPPFLIPTHSEK 277 >gi|51892448|ref|YP_075139.1| site-specific DNA-methyltransferase [Symbiobacterium thermophilum IAM 14863] gi|51856137|dbj|BAD40295.1| site-specific DNA-methyltransferase [Symbiobacterium thermophilum IAM 14863] Length = 486 Score = 37.6 bits (87), Expect = 0.63, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34 + A +GVPQ RER+++I VE +FP P Sbjct: 181 LNAVHYGVPQMRERMFLIAVAGELGVEPEFPVPTH 215 >gi|331090154|ref|ZP_08339042.1| hypothetical protein HMPREF1025_02625 [Lachnospiraceae bacterium 3_1_46FAA] gi|330402100|gb|EGG81672.1| hypothetical protein HMPREF1025_02625 [Lachnospiraceae bacterium 3_1_46FAA] Length = 428 Score = 37.6 bits (87), Expect = 0.63, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 10/59 (16%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR--LGDILEE-------HIDDKS 51 A FGV Q R R+ I+ +L K+P L IK + D+ + DK Sbjct: 207 NAHTFGVLQNRRRMIIVGWLK-KSGLKYPDFLEIKTDAIVNDLFADLPKLHPGESSDKY 264 >gi|325690436|gb|EGD32439.1| DNA (cytosine-5-)-methyltransferase [Streptococcus sanguinis SK115] Length = 390 Score = 37.6 bits (87), Expect = 0.63, Method: Composition-based stats. Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 2 KACDFGVPQRRERLYIID 19 + D+GV Q RER+Y + Sbjct: 151 NSKDYGVAQNRERVYTLG 168 >gi|145301342|ref|YP_001144182.1| C-5 cytosine-specific DNA methylase [Aeromonas salmonicida subsp. salmonicida A449] gi|142856119|gb|ABO92434.1| C-5 cytosine-specific DNA methylase [Aeromonas salmonicida subsp. salmonicida A449] Length = 541 Score = 37.6 bits (87), Expect = 0.63, Method: Composition-based stats. Identities = 22/102 (21%), Positives = 42/102 (41%), Gaps = 11/102 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR---LGDILEEHIDDKSTISNKL 57 + +FGV + R+RL ++ + F ++ + + DILE + ++ Sbjct: 281 LDGNEFGVIEARKRLCVVAVSHGIDGFDLEQVQPVRTKESCINDILEPIP-----LDSQR 335 Query: 58 WE---GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 W+ +++ +K AGKGF L T+ Y K Sbjct: 336 WKSFDYLAEKELRDKAAGKGFARQLLAGAETFCGTVGKGYSK 377 >gi|42779474|ref|NP_976721.1| DNA-cytosine methyltransferase [Bacillus cereus ATCC 10987] gi|42735390|gb|AAS39329.1| DNA-cytosine methyltransferase [Bacillus cereus ATCC 10987] Length = 719 Score = 37.6 bits (87), Expect = 0.65, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGVPQRR R+Y++ Sbjct: 176 IDAQYFGVPQRRRRIYLVA 194 >gi|254825325|ref|ZP_05230326.1| deoxycytosine methylase [Listeria monocytogenes FSL J1-194] gi|255521307|ref|ZP_05388544.1| modification methylase, putative [Listeria monocytogenes FSL J1-175] gi|293594568|gb|EFG02329.1| deoxycytosine methylase [Listeria monocytogenes FSL J1-194] Length = 385 Score = 37.6 bits (87), Expect = 0.65, Method: Composition-based stats. Identities = 27/103 (26%), Positives = 38/103 (36%), Gaps = 26/103 (25%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL-----GIKPRLGDIL-----EEHID-- 48 + A DFG+PQ R R +++ N +E P + I+ L D L EE +D Sbjct: 212 LNALDFGIPQSRSRTFMLSIRNSEIE---PEEISNLDYSIESNLADFLRFEYVEEGVDAM 268 Query: 49 DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91 T S E R G + TNT+S Sbjct: 269 PNYTPS---REKIYNRNRLLAKNG--------VVKADFTNTIS 300 >gi|207092664|ref|ZP_03240451.1| type II DNA modification enzyme [Helicobacter pylori HPKX_438_AG0C1] gi|207108938|ref|ZP_03243100.1| type II DNA modification enzyme [Helicobacter pylori HPKX_438_CA4C1] Length = 160 Score = 37.6 bits (87), Expect = 0.65, Method: Composition-based stats. Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 1 MKACDFGVPQRRERLY 16 + A D+GVPQ RER++ Sbjct: 145 LNALDYGVPQIRERVF 160 >gi|118431236|ref|NP_147563.2| DNA (cytosine-5-)-methyltransferase [Aeropyrum pernix K1] gi|116062559|dbj|BAA79854.2| DNA (cytosine-5-)-methyltransferase [Aeropyrum pernix K1] Length = 469 Score = 37.6 bits (87), Expect = 0.65, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 5/56 (8%) Query: 5 DF---GVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISN 55 DF GVPQ+RERL II F T ++ R+ +L + + ++ Sbjct: 191 DFSKLGVPQKRERLVIIGLRKDLAGGGFETISRLRARIDHVLSGKRWLLHRYPLTP 246 >gi|172037464|ref|YP_001803965.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142] gi|171698918|gb|ACB51899.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142] Length = 430 Score = 37.2 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A +FG+PQ+RERL++I Sbjct: 203 LYAPNFGIPQKRERLFLIGLKKE 225 >gi|220926735|ref|YP_002502037.1| DNA-cytosine methyltransferase [Methylobacterium nodulans ORS 2060] gi|219951342|gb|ACL61734.1| DNA-cytosine methyltransferase [Methylobacterium nodulans ORS 2060] Length = 454 Score = 37.2 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDIL 43 + A GVPQ R+RL + + FP PL + + D L Sbjct: 251 LDAQWLGVPQARQRLIFVGVRDDLGLSPAFPKPLPFRYSVRDAL 294 >gi|2760954|gb|AAB95336.1| EaeI methyltransferase alpha subunit [Enterobacter aerogenes] Length = 309 Score = 37.2 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FG PQRR R+YI+ Sbjct: 152 LDAKYFGTPQRRRRVYIVA 170 >gi|284989342|ref|YP_003407896.1| DNA-cytosine methyltransferase [Geodermatophilus obscurus DSM 43160] gi|284062587|gb|ADB73525.1| DNA-cytosine methyltransferase [Geodermatophilus obscurus DSM 43160] Length = 671 Score = 37.2 bits (86), Expect = 0.68, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL----GDILE 44 + +G+PQ R+RL I+ N V F++P + GD+ E Sbjct: 206 LDCRAYGIPQFRQRLIIVALRNGHV-FEWPAVAEQTVNVWNAIGDLPE 252 >gi|262118158|ref|YP_003275928.1| C-5 cytosine-specific DNA methylase [Gordonia bronchialis DSM 43247] gi|262088068|gb|ACY24035.1| C-5 cytosine-specific DNA methylase [Gordonia bronchialis DSM 43247] Length = 652 Score = 37.2 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 11/52 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG------DILEEH 46 + + FGVPQ R+RLYI+ F + K P P L DI+E Sbjct: 202 LNSMFFGVPQSRDRLYIV-FWDR----KLPAPDLDHRPLAHCAHCDDIVESK 248 >gi|317132209|ref|YP_004091523.1| DNA-cytosine methyltransferase [Ethanoligenens harbinense YUAN-3] gi|315470188|gb|ADU26792.1| DNA-cytosine methyltransferase [Ethanoligenens harbinense YUAN-3] Length = 438 Score = 37.2 bits (86), Expect = 0.70, Method: Composition-based stats. Identities = 8/23 (34%), Positives = 11/23 (47%) Query: 2 KACDFGVPQRRERLYIIDFLNPS 24 DFG PQ R+R +I+ Sbjct: 203 NTKDFGFPQNRKRAFILGIKKEH 225 >gi|315585937|gb|ADU40318.1| site-specific DNA-methyltransferase [Helicobacter pylori 35A] Length = 295 Score = 37.2 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILE 44 + + +G RRERL I+ N F FP P + + L+ Sbjct: 91 LNSAWYGSATRRERLIIVAIRNDLPFNFTFPKPTHLSDEINTKLD 135 >gi|261838825|gb|ACX98591.1| cytosine-methyltransferase [Helicobacter pylori 51] Length = 413 Score = 37.2 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILE 44 + + +G +RERL I+ N F FP P + + L+ Sbjct: 214 LNSAWYGSATKRERLIIVAIRNDLPFHFAFPKPTHLSDEINTKLD 258 >gi|227357019|ref|ZP_03841390.1| DNA-cytosine methyltransferase [Proteus mirabilis ATCC 29906] gi|261345118|ref|ZP_05972762.1| DNA (cytosine-5-)-methyltransferase [Providencia rustigianii DSM 4541] gi|227162822|gb|EEI47782.1| DNA-cytosine methyltransferase [Proteus mirabilis ATCC 29906] gi|282566805|gb|EFB72340.1| DNA (cytosine-5-)-methyltransferase [Providencia rustigianii DSM 4541] Length = 301 Score = 37.2 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FG PQRR R+YII Sbjct: 152 LDAKYFGTPQRRRRVYIIG 170 >gi|308183509|ref|YP_003927636.1| DNA-cytosine methyltransferase [Helicobacter pylori PeCan4] gi|308065694|gb|ADO07586.1| DNA-cytosine methyltransferase [Helicobacter pylori PeCan4] Length = 238 Score = 37.2 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 19/99 (19%), Positives = 36/99 (36%), Gaps = 13/99 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIK-PRLGDILEEHIDDKSTISNK- 56 +K DFGV Q RER+ ++ F F P + +IL++ + ++ Sbjct: 83 LKVSDFGVSQLRERVIMVGVNESYFKEPFNFKILKKSHAPFVYEILKDLEN----LTEGA 138 Query: 57 LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95 + + + NK G T+ A ++ Sbjct: 139 MPNHFYSKAKRNKGQGNN-----AINKDTYAPTMRAEHH 172 >gi|26553946|ref|NP_757880.1| cytosine-specific DNA methyltransferase [Mycoplasma penetrans HF-2] gi|26453954|dbj|BAC44284.1| cytosine-specific DNA methyltransferase [Mycoplasma penetrans HF-2] Length = 395 Score = 37.2 bits (86), Expect = 0.73, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 23/57 (40%), Gaps = 6/57 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKF---PTPLGIKPRLGDILEEHIDDKS 51 + + +F Q RER++ + + FKF ++ DIL + + K Sbjct: 217 LNSKNFDNCQNRERVFCLSIRDDYLEKTGFKFKELEKVKNPPKKIKDILVDSSNYKY 273 >gi|168698288|ref|ZP_02730565.1| cytosine-specific methyltransferase [Gemmata obscuriglobus UQM 2246] Length = 293 Score = 37.2 bits (86), Expect = 0.74, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI 47 ++A FGVPQ R RL+I+ + P + +P G+ L + + Sbjct: 51 LEASAFGVPQVRRRLFIVG-----NRLQLP-IITPQPIFGEGLAKPV 91 >gi|328543334|ref|YP_004303443.1| DNA methylase, C-5 cytosine-specific family [polymorphum gilvum SL003B-26A1] gi|326415695|gb|ADZ72758.1| DNA methylase, C-5 cytosine-specific family [Polymorphum gilvum SL003B-26A1] Length = 418 Score = 37.2 bits (86), Expect = 0.75, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 18/40 (45%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40 + A +FG PQ R R++I+ + P P P L Sbjct: 172 LSAEEFGTPQLRRRVFIVASRIGAASELLPNPTHWSPALA 211 >gi|207094141|ref|ZP_03241928.1| hypothetical protein HpylHP_15485 [Helicobacter pylori HPKX_438_AG0C1] Length = 35 Score = 37.2 bits (86), Expect = 0.75, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 13/26 (50%) Query: 4 CDFGVPQRRERLYIIDFLNPSVEFKF 29 F VPQ RER +I+ S +F Sbjct: 9 KTFCVPQNRERAFIVGASRFSFDFNL 34 >gi|301020988|ref|ZP_07185039.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1] gi|3660493|emb|CAA57706.1| M.EcoHK31I alpha polypeptide [Escherichia coli] gi|300398362|gb|EFJ81900.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1] Length = 309 Score = 37.2 bits (86), Expect = 0.75, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FG PQRR R+YI+ Sbjct: 152 LDAKYFGTPQRRRRVYIVA 170 >gi|328914001|gb|AEB65597.1| DNA (cytosine-5)-methyltransferase [Bacillus amyloliquefaciens LL3] Length = 600 Score = 37.2 bits (86), Expect = 0.75, Method: Composition-based stats. Identities = 21/88 (23%), Positives = 28/88 (31%), Gaps = 16/88 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF--KFPTPLGIKPR---------LGDI-----LE 44 + A DFGVPQ R R I+ N E K P L L DI +E Sbjct: 369 LTATDFGVPQIRRRFIILGVRNDLFENSPKLPDALVHSTPFTVRDAIQDLADITPLTDME 428 Query: 45 EHIDDKSTISNKLWEGHQKRKENNKIAG 72 + S+ + + G Sbjct: 429 KAKPLDYIESDAQASPMLRYFRKDADKG 456 >gi|308175642|ref|YP_003922347.1| DNA (cytosine-5)-methyltransferase [Bacillus amyloliquefaciens DSM 7] gi|307608506|emb|CBI44877.1| DNA (cytosine-5)-methyltransferase [Bacillus amyloliquefaciens DSM 7] gi|328555623|gb|AEB26115.1| DNA (cytosine-5)-methyltransferase [Bacillus amyloliquefaciens TA208] Length = 597 Score = 37.2 bits (86), Expect = 0.76, Method: Composition-based stats. Identities = 21/88 (23%), Positives = 28/88 (31%), Gaps = 16/88 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF--KFPTPLGIKPR---------LGDI-----LE 44 + A DFGVPQ R R I+ N E K P L L DI +E Sbjct: 366 LTATDFGVPQIRRRFIILGVRNDLFENSPKLPDALVHSTPFTVRDAIQDLADITPLTDME 425 Query: 45 EHIDDKSTISNKLWEGHQKRKENNKIAG 72 + S+ + + G Sbjct: 426 KAKPLDYIESDAQASPMLRYFRKDADKG 453 >gi|332674342|gb|AEE71159.1| site-specific DNA-methyltransferase [Helicobacter pylori 83] Length = 418 Score = 37.2 bits (86), Expect = 0.76, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILE 44 + + +G +RERL I+ N F FP P + + L+ Sbjct: 214 LNSAWYGSATKRERLIIVAIRNDLPFHFAFPKPTHLSDEINTKLD 258 >gi|317504402|ref|ZP_07962385.1| modification methylase Sau3AI [Prevotella salivae DSM 15606] gi|315664482|gb|EFV04166.1| modification methylase Sau3AI [Prevotella salivae DSM 15606] Length = 579 Score = 37.2 bits (86), Expect = 0.76, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 17/25 (68%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV 25 + A ++G+PQRR R+YII + S Sbjct: 167 INAAEYGMPQRRRRIYIIGYYKGST 191 >gi|327534643|gb|AEA93477.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis OG1RF] Length = 334 Score = 37.2 bits (86), Expect = 0.76, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Query: 1 MKACDFGVPQRRERLYIID 19 + + + VPQ RER++II Sbjct: 147 LNSKAY-VPQNRERVFIIG 164 >gi|114570713|ref|YP_757393.1| DNA (cytosine-5-)-methyltransferase [Maricaulis maris MCS10] gi|114341175|gb|ABI66455.1| DNA (cytosine-5-)-methyltransferase [Maricaulis maris MCS10] Length = 375 Score = 37.2 bits (86), Expect = 0.78, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A DFG RER+ I+ F ++ Sbjct: 148 LNAADFGAATSRERVLIVGFNPSEMD 173 >gi|108805045|ref|YP_644982.1| DNA (cytosine-5-)-methyltransferase [Rubrobacter xylanophilus DSM 9941] gi|108766288|gb|ABG05170.1| DNA (cytosine-5-)-methyltransferase [Rubrobacter xylanophilus DSM 9941] Length = 405 Score = 37.2 bits (86), Expect = 0.82, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEHIDDKSTISN 55 ++A ++GVPQRR R+ ++ + VE + P LG L + L + + +S+ Sbjct: 304 LRAEEYGVPQRRTRVILVGDSSGDVESEPPKTVTQLGNNMSLFNELPAAVSVRDALSD 361 >gi|150024948|ref|YP_001295774.1| type II modification methyltransferase [Flavobacterium psychrophilum JIP02/86] gi|149771489|emb|CAL42958.1| Probable type II modification methyltransferase [Flavobacterium psychrophilum JIP02/86] Length = 425 Score = 37.2 bits (86), Expect = 0.82, Method: Composition-based stats. Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLN 22 + + +GVPQ RER+ I F Sbjct: 209 LHSGQYGVPQSRERIIFIGFKK 230 >gi|171911440|ref|ZP_02926910.1| DNA-cytosine methyltransferase [Verrucomicrobium spinosum DSM 4136] Length = 292 Score = 37.2 bits (86), Expect = 0.83, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGVPQRR RL+++ Sbjct: 159 LDAAGFGVPQRRRRLFMVG 177 >gi|313678719|ref|YP_004056459.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45] gi|312950602|gb|ADR25197.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45] Length = 324 Score = 37.2 bits (86), Expect = 0.85, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + + +FGVPQ+RER+ I Sbjct: 153 LDSSNFGVPQKRERVIFIG 171 >gi|112983066|ref|NP_001036934.1| DNA cytosine-5 methyltransferase [Bombyx mori] gi|54888741|dbj|BAD67190.1| DNA cytosine-5 methyltransferase [Bombyx mori] Length = 336 Score = 37.2 bits (86), Expect = 0.85, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 8/60 (13%) Query: 7 GVPQRRERLYIIDFLNPSVEFK--------FPTPLGIKPRLGDILEEHIDDKSTISNKLW 58 GVP R R Y I N + FK P L DI+E ++ D + +K+ Sbjct: 157 GVPNSRLRYYCIAKRNNTWNFKRKDELITCLPKTFAKPHCLKDIIENNVPDDYLVPDKML 216 >gi|169825443|ref|YP_001695618.1| modification methylase PspPI [Lysinibacillus sphaericus C3-41] gi|168994720|gb|ACA42259.1| Modification methylase PspPI [Lysinibacillus sphaericus C3-41] Length = 475 Score = 37.2 bits (86), Expect = 0.86, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 6/57 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A D+ PQRRER +II + + + PTP+ + E +S+ L Sbjct: 286 LDAVDYNSPQRRERTFIIG--SKIGKIELPTPITTPDNYKTVQEAFAG----LSDNL 336 >gi|206579328|ref|YP_002239202.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342] gi|206568386|gb|ACI10162.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342] Length = 347 Score = 37.2 bits (86), Expect = 0.87, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + D+G+PQ R RL +I + F K + D Sbjct: 149 VNCSDYGLPQNRRRLILIGSRLGPISFD-QEKKDRKTTVKD 188 >gi|34451616|gb|AAQ72364.1| methylase fusion protein [Geobacillus stearothermophilus] Length = 1007 Score = 37.2 bits (86), Expect = 0.87, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPR 38 + + D+ VPQ+R+R++II + FPTP+ +P Sbjct: 921 LMSSDYAVPQKRKRVFIICTRDDMDVKPADLFPTPITEEPE 961 >gi|228950284|ref|ZP_04112461.1| Cytosine-specific methyltransferase [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228809446|gb|EEM55890.1| Cytosine-specific methyltransferase [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] Length = 346 Score = 36.8 bits (85), Expect = 0.87, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP 30 + A G+PQRRER++ F+ E P Sbjct: 181 LNAATMGIPQRRERIF---FIARQKELSLP 207 >gi|187934831|ref|YP_001884812.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum B str. Eklund 17B] gi|187722984|gb|ACD24205.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum B str. Eklund 17B] Length = 424 Score = 36.8 bits (85), Expect = 0.87, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 10/63 (15%) Query: 38 RLGDILEEHIDDKSTISN---KLWEGHQKRKENNKIAGKGFGY-----GLFFEN--SATT 87 L DILEEH+D+K +S + W + K + + G Y G+ F + Sbjct: 270 TLRDILEEHVDEKYILSEGDLEKWTYLKGPKAIERTSKDGHKYTFREGGIAFPDPIDKPA 329 Query: 88 NTL 90 T+ Sbjct: 330 RTM 332 >gi|182677759|ref|YP_001831905.1| DNA-cytosine methyltransferase [Beijerinckia indica subsp. indica ATCC 9039] gi|182633642|gb|ACB94416.1| DNA-cytosine methyltransferase [Beijerinckia indica subsp. indica ATCC 9039] Length = 488 Score = 36.8 bits (85), Expect = 0.88, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 13/26 (50%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A +GVPQ R R+ ++ + Sbjct: 209 LNAAHYGVPQERFRVVVVGTRKDVAD 234 >gi|109946897|ref|YP_664125.1| site-specific DNA-methyltransferase [Helicobacter acinonychis str. Sheeba] gi|109714118|emb|CAJ99126.1| site-specific DNA-methyltransferase [Helicobacter acinonychis str. Sheeba] Length = 418 Score = 36.8 bits (85), Expect = 0.88, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILE 44 + + +G +RERL I+ N F FP P + + L+ Sbjct: 214 LNSAWYGSATKRERLIIVAIRNDLPFNFAFPKPTHLNDEINTKLD 258 >gi|317489194|ref|ZP_07947712.1| C-5 cytosine-specific DNA methylase [Eggerthella sp. 1_3_56FAA] gi|325832321|ref|ZP_08165320.1| DNA (cytosine-5-)-methyltransferase [Eggerthella sp. HGA1] gi|316911702|gb|EFV33293.1| C-5 cytosine-specific DNA methylase [Eggerthella sp. 1_3_56FAA] gi|325486157|gb|EGC88611.1| DNA (cytosine-5-)-methyltransferase [Eggerthella sp. HGA1] Length = 447 Score = 36.8 bits (85), Expect = 0.90, Method: Composition-based stats. Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 1 MKACDFGVPQRRERLYIIDFL 21 + A FG+ QRRER++++ L Sbjct: 142 LDAQFFGLAQRRERVFLVGVL 162 >gi|222149028|ref|YP_002549985.1| DNA methylase [Agrobacterium vitis S4] gi|221736013|gb|ACM36976.1| DNA methylase [Agrobacterium vitis S4] Length = 492 Score = 36.8 bits (85), Expect = 0.90, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLG 34 + + +GVPQ RERL++I + + V FP P Sbjct: 188 LNSAFYGVPQMRERLFLIAYDRSLGVTPTFPHPSH 222 >gi|318057150|ref|ZP_07975873.1| putative 5-methylcytosine methyltransferase [Streptomyces sp. SA3_actG] gi|318076182|ref|ZP_07983514.1| putative 5-methylcytosine methyltransferase [Streptomyces sp. SA3_actF] Length = 324 Score = 36.8 bits (85), Expect = 0.92, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 10/56 (17%) Query: 1 MKACDFGVPQRRERLYIIDFL-----NPSVEFKFPTPLGIK-PRLGDILEEHIDDK 50 + A DFGV QRRE FL F +P PL P LG+ L + + Sbjct: 149 LDARDFGVSQRREH----GFLLAMSGERMKRFSWPVPLATPCPTLGETLRASMGAR 200 >gi|299065518|emb|CBJ36687.1| Cytosine-specific methyltransferase [Ralstonia solanacearum CMR15] Length = 441 Score = 36.8 bits (85), Expect = 0.92, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-------IKPRLGDILEEH 46 + A ++G PQ RER I +V FP P +P G ++E Sbjct: 176 VNAVNYGAPQLRERALFIG-NRYNVVVDFPDPTHGPAHSISAQPEQGSLIEPD 227 >gi|196048102|ref|ZP_03115280.1| type II DNA-methyltransferase, putative [Bacillus cereus 03BB108] gi|196021358|gb|EDX60087.1| type II DNA-methyltransferase, putative [Bacillus cereus 03BB108] Length = 464 Score = 36.8 bits (85), Expect = 0.92, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 + A DFG +R R Y + F + F P + L E++D K+ I W+ Sbjct: 263 IDAVDFGSIAKRNRTYAVAFRSEEAFLNFEFPSPPRTVKRSKLREYLDGKNVI--HQWKD 320 Query: 61 HQ 62 + Sbjct: 321 LR 322 >gi|209525992|ref|ZP_03274525.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] gi|209493518|gb|EDZ93840.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328] Length = 430 Score = 36.8 bits (85), Expect = 0.93, Method: Composition-based stats. Identities = 21/100 (21%), Positives = 34/100 (34%), Gaps = 20/100 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK--PRLGDILEEHIDDKST-----I 53 + A ++G PQ+R+RL +I ++P + I + D T I Sbjct: 170 LDASEYGAPQKRKRLILIGSRFDVKIAEYPATNKSEMFTVYQAISDLEKIDNFTNYDPGI 229 Query: 54 SNKLWEGHQKRKENNKIAGKGFGYGLFFENS---ATTNTL 90 S E RK+ Y L +S T+ Sbjct: 230 SPAFLEYEGDRKK----------YSLVPSDSFSLCHKRTI 259 >gi|205360554|ref|ZP_02684441.2| modification methylase DdeI [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|205348823|gb|EDZ35454.1| modification methylase DdeI [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] Length = 394 Score = 36.8 bits (85), Expect = 0.93, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 10/59 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 +++ DFGVPQ R+RL+II FP P D L++ + LW+ Sbjct: 156 LESTDFGVPQIRKRLFIIASRKELKN-PFPKPTHNITG-SDGLKK--------TPTLWD 204 >gi|315656923|ref|ZP_07909810.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii subsp. holmesii ATCC 35242] gi|315492878|gb|EFU82482.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii subsp. holmesii ATCC 35242] Length = 503 Score = 36.8 bits (85), Expect = 0.93, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGVPQRR R++++ Sbjct: 176 LDAQFFGVPQRRRRIFLVA 194 >gi|304389869|ref|ZP_07371828.1| possible DNA-cytosine methyltransferase [Mobiluncus curtisii subsp. curtisii ATCC 35241] gi|304327045|gb|EFL94284.1| possible DNA-cytosine methyltransferase [Mobiluncus curtisii subsp. curtisii ATCC 35241] Length = 503 Score = 36.8 bits (85), Expect = 0.93, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGVPQRR R++++ Sbjct: 176 LDAQFFGVPQRRRRIFLVA 194 >gi|86749313|ref|YP_485809.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris HaA2] gi|86572341|gb|ABD06898.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris HaA2] Length = 358 Score = 36.8 bits (85), Expect = 0.94, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Query: 6 FGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 FGVPQ R RL ++ + + + P P+G P Sbjct: 163 FGVPQNRRRLVLLA--SKFGDIRLPEPIGTPPT 193 >gi|20068989|gb|AAM09642.1|AF458983_2 m6 adenine and m5 cytosine DNA methyltransferase [Hafnia alvei] Length = 1061 Score = 36.8 bits (85), Expect = 0.95, Method: Composition-based stats. Identities = 8/36 (22%), Positives = 21/36 (58%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + + +GVPQ R R++++ + +++ P P+ + Sbjct: 974 LCSEQYGVPQMRRRIFVVATTDDTIDLSEPAPIYER 1009 >gi|237704019|ref|ZP_04534500.1| DNA methyltransferase [Escherichia sp. 3_2_53FAA] gi|20068985|gb|AAM09639.1|AF458982_2 m5 cytosine DNA methyltransferase [Escherichia coli] gi|226901931|gb|EEH88190.1| DNA methyltransferase [Escherichia sp. 3_2_53FAA] gi|281181427|dbj|BAI57757.1| methyltransferase [Escherichia coli SE15] gi|315286888|gb|EFU46305.1| C-5 cytosine-specific DNA methylase [Escherichia coli MS 110-3] gi|323955407|gb|EGB51176.1| C-5 cytosine-specific DNA methylase [Escherichia coli H263] Length = 396 Score = 36.8 bits (85), Expect = 0.96, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 26/55 (47%), Gaps = 6/55 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55 + + + +PQRR+R+ ++ +P + P +L + E + K +S+ Sbjct: 303 LNSEHYAIPQRRKRVILVGSNDPLFSIEPPQ------KLTEDKESWVSVKDALSD 351 >gi|238790792|ref|ZP_04634550.1| site-specific DNA methylase [Yersinia frederiksenii ATCC 33641] gi|238721107|gb|EEQ12789.1| site-specific DNA methylase [Yersinia frederiksenii ATCC 33641] Length = 712 Score = 36.8 bits (85), Expect = 0.97, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 +KACD+G P R+RL+++ +P P P D+L Sbjct: 242 LKACDYGTPTIRKRLFVVG-RCDGESVVWPEPSHGAPNSADVL 283 >gi|298491379|ref|YP_003721556.1| DNA-cytosine methyltransferase ['Nostoc azollae' 0708] gi|298233297|gb|ADI64433.1| DNA-cytosine methyltransferase ['Nostoc azollae' 0708] Length = 379 Score = 36.8 bits (85), Expect = 0.97, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 7/37 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-------SVEFKFP 30 + + ++GVPQ R+R+ I F + +F FP Sbjct: 172 INSIEYGVPQDRDRIISIGFNSHFLEEMGIEDDFTFP 208 >gi|2129405|pir||S53867 DNA (cytosine)-methyltransferase (EC 2.1.1.-) Dcm5a - Halobacterium salinarum gi|732794|emb|CAA56444.1| cytosine methylase [Halobacterium phage phiH] Length = 245 Score = 36.8 bits (85), Expect = 0.98, Method: Composition-based stats. Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 1 MKACDFGVPQRRERLYI 17 + A D+G PQ RERL+I Sbjct: 178 LNAADYGDPQSRERLFI 194 >gi|325860528|ref|ZP_08173633.1| modification methylase HaeIII [Prevotella denticola CRIS 18C-A] gi|325481968|gb|EGC84996.1| modification methylase HaeIII [Prevotella denticola CRIS 18C-A] Length = 403 Score = 36.8 bits (85), Expect = 1.00, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 14/27 (51%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKF 29 A D+GVPQ R R+ II F F Sbjct: 175 AKDYGVPQSRYRVLIIGTERNLPTFDF 201 >gi|288929280|ref|ZP_06423125.1| modification methylase HphIA (Cytosine-specific methyltransferase HphIA) [Prevotella sp. oral taxon 317 str. F0108] gi|288329382|gb|EFC67968.1| modification methylase HphIA (Cytosine-specific methyltransferase HphIA) [Prevotella sp. oral taxon 317 str. F0108] Length = 370 Score = 36.8 bits (85), Expect = 1.0, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 +KA +FGVP++RERL++I LN S+E + L L + Sbjct: 159 VKAIEFGVPEKRERLFVIGTLNKSIELEKLEQLTRTQILAE 199 >gi|295103751|emb|CBL01295.1| DNA-methyltransferase (dcm) [Faecalibacterium prausnitzii SL3/3] Length = 412 Score = 36.8 bits (85), Expect = 1.0, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 16/28 (57%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFK 28 + A D+G QRR R ++ F N + F+ Sbjct: 157 INAADYGEAQRRRRTFLFAFRNDTALFR 184 >gi|86750436|ref|YP_486932.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris HaA2] gi|86573464|gb|ABD08021.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris HaA2] Length = 438 Score = 36.8 bits (85), Expect = 1.0, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS 24 + A DFGVPQ R+RL + + S Sbjct: 152 VDAADFGVPQTRKRLLFVGVRSRS 175 >gi|79835453|gb|ABB52085.1| Mod [Arthrospira platensis] gi|291569776|dbj|BAI92048.1| type II DNA modification methyltransferase [Arthrospira platensis NIES-39] Length = 429 Score = 36.8 bits (85), Expect = 1.0, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+G+PQ R+RL+I+ + FP P L H K LWE Sbjct: 192 LNATDYGIPQVRKRLFILA-HRCDLTHPFPQPTHT-TSNQTELFTHNLKK---CPSLWE 245 >gi|15678523|ref|NP_275638.1| modification methyltransferase, cytosine-specific [Methanothermobacter thermautotrophicus str. Delta H] gi|2621566|gb|AAB85001.1| modification methyltransferase, cytosine-specific [Methanothermobacter thermautotrophicus str. Delta H] Length = 413 Score = 36.8 bits (85), Expect = 1.0, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 A +FGVPQRR R+ +I +F + DIL Sbjct: 196 DAYNFGVPQRRRRIIVIGHRMEDKRIQFDEERYAGT-VNDIL 236 >gi|79835456|gb|ABB52087.1| Mod [Arthrospira platensis] Length = 443 Score = 36.8 bits (85), Expect = 1.0, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A DFGVPQ R+R++I+ Sbjct: 155 LDAVDFGVPQFRKRVFILG 173 >gi|60202519|gb|AAX14651.1| BbvCI methyltransferase 2 [Brevibacillus brevis] Length = 396 Score = 36.8 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 ++A D+GVPQ R RL+++ +P FP Sbjct: 154 LQAADYGVPQLRSRLFVVGSRHPIAN-PFPNKTHS 187 >gi|218439218|ref|YP_002377547.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424] gi|218171946|gb|ACK70679.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424] Length = 323 Score = 36.8 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 10/37 (27%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 D+G PQ RER+ II + +++ P Sbjct: 147 NFADYGTPQLRERVLIIGIRQD-ISYQYIKPKPTHTP 182 >gi|292657161|ref|YP_003537057.1| site-specific DNA-methyltransferase (cytosine-specific) [Haloferax volcanii DS2] gi|291373000|gb|ADE05226.1| site-specific DNA-methyltransferase (cytosine-specific) [Haloferax volcanii DS2] Length = 406 Score = 36.8 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 5/60 (8%) Query: 1 MKACDFGVPQRRER---LYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 + A D+GVPQRR R + I + VEF P +P G + E + K + + Sbjct: 184 VNAADYGVPQRRMRTIGICIYGASDSEVEFP-PETHAREPEDG-LKERWVTVKDVLKEEY 241 >gi|325270632|ref|ZP_08137230.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] gi|324987027|gb|EGC19012.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM 16608] Length = 283 Score = 36.8 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 14/27 (51%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKF 29 A D+GVPQ R R+ II F F Sbjct: 55 AKDYGVPQSRYRVLIIGTERNLPTFDF 81 >gi|291007577|ref|ZP_06565550.1| DNA-cytosine methyltransferase [Saccharopolyspora erythraea NRRL 2338] Length = 418 Score = 36.8 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 12/49 (24%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-------SVEFKFPTPLGIKPRLGDI 42 + A D+GVPQ R R I+ V ++P P ++ + + Sbjct: 173 LNAADYGVPQARRRAIILATRRDLISEHPERVGVQYPEPTHVRNAVHTL 221 >gi|284051998|ref|ZP_06382208.1| cytosine-specific methyltransferase [Arthrospira platensis str. Paraca] gi|79835461|gb|ABB52090.1| Mod [Arthrospira platensis] gi|291568828|dbj|BAI91100.1| cytosine-specific methyltransferase [Arthrospira platensis NIES-39] Length = 411 Score = 36.8 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 20/91 (21%), Positives = 32/91 (35%), Gaps = 17/91 (18%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK--PRLGDILEEHIDDKST-----I 53 + A ++G PQ+R+RL +I ++P + I + D T I Sbjct: 158 LDASEYGAPQKRKRLILIGSRFDVKMAEYPATNNSEIVTVYQAISDLEKIDHFTNYDPGI 217 Query: 54 SNKLWEGHQKRKENNKIAGKGFGYGLFFENS 84 S E RK+ Y L +S Sbjct: 218 SPAFLEYEGDRKK----------YSLVPSDS 238 >gi|145593130|ref|YP_001157427.1| DNA-cytosine methyltransferase [Salinispora tropica CNB-440] gi|145302467|gb|ABP53049.1| DNA-cytosine methyltransferase [Salinispora tropica CNB-440] Length = 652 Score = 36.8 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 5/43 (11%) Query: 6 FGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL----GDILE 44 +GVPQ R+RL ++ L V F +P + + + GD+ E Sbjct: 214 YGVPQFRQRLILVA-LRDGVAFDWPPEVPDRVSVWNAIGDLPE 255 >gi|16125285|ref|NP_419849.1| C-5 cytosine-specific DNA methylase [Caulobacter crescentus CB15] gi|221234022|ref|YP_002516458.1| DNA-cytosine methyltransferase [Caulobacter crescentus NA1000] gi|13422327|gb|AAK23017.1| C-5 cytosine-specific DNA methylase [Caulobacter crescentus CB15] gi|220963194|gb|ACL94550.1| DNA-cytosine methyltransferase [Caulobacter crescentus NA1000] Length = 335 Score = 36.8 bits (85), Expect = 1.1, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 1 MKACDFGVPQRRERLYIID 19 + A D G PQ R RL+++ Sbjct: 155 LNAKDHGTPQNRPRLFLLG 173 >gi|331085773|ref|ZP_08334856.1| hypothetical protein HMPREF0987_01159 [Lachnospiraceae bacterium 9_1_43BFAA] gi|330406696|gb|EGG86201.1| hypothetical protein HMPREF0987_01159 [Lachnospiraceae bacterium 9_1_43BFAA] Length = 356 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 16/31 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31 + A D+GVPQ R+RL + KFP Sbjct: 149 LCAADYGVPQIRKRLIFMGIRKDIGAPKFPE 179 >gi|307637157|gb|ADN79607.1| DNA cytosine methyltransferase [Helicobacter pylori 908] Length = 165 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 13/17 (76%) Query: 1 MKACDFGVPQRRERLYI 17 + A D+GVPQ RER+ + Sbjct: 145 LNALDYGVPQVRERVIL 161 >gi|316934943|ref|YP_004109925.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris DX-1] gi|315602657|gb|ADU45192.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris DX-1] Length = 495 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPT 31 + + GVPQ R+R++++ F + +FP Sbjct: 192 LNSAHHGVPQMRDRVFLLAFHKSIEADIRFPK 223 >gi|194335797|ref|YP_002017591.1| DNA-cytosine methyltransferase [Pelodictyon phaeoclathratiforme BU-1] gi|194308274|gb|ACF42974.1| DNA-cytosine methyltransferase [Pelodictyon phaeoclathratiforme BU-1] Length = 434 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 1 MKACDFGVPQRRERLYIID--FLNPSVEF 27 + A D+GVPQ R R +I+ F +P F Sbjct: 178 LCAADYGVPQIRWRAFIVGCKFADPQAVF 206 >gi|284053383|ref|ZP_06383593.1| hypothetical protein AplaP_18124 [Arthrospira platensis str. Paraca] gi|291571237|dbj|BAI93509.1| type II DNA modification methyltransferase [Arthrospira platensis NIES-39] Length = 451 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A DFGVPQ R+R++I+ Sbjct: 155 LDAVDFGVPQFRKRVFILG 173 >gi|254467075|ref|ZP_05080486.1| DNA-cytosine methyltransferase [Rhodobacterales bacterium Y4I] gi|206687983|gb|EDZ48465.1| DNA-cytosine methyltransferase [Rhodobacterales bacterium Y4I] Length = 497 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR 38 ++A D+GVPQ R R+ I+ + K P+ +P+ Sbjct: 228 IRAEDYGVPQARHRVIILGIRKDLATGLKLDGPILGQPK 266 >gi|154482791|ref|ZP_02025239.1| hypothetical protein EUBVEN_00468 [Eubacterium ventriosum ATCC 27560] gi|149736386|gb|EDM52272.1| hypothetical protein EUBVEN_00468 [Eubacterium ventriosum ATCC 27560] Length = 193 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Query: 1 MKACDFGVPQRRERLYIID-F---LNPSVEFKFPTPLGIKPRLGD 41 + A +GVPQRR+R+Y+I F + FK + LG P+ + Sbjct: 123 LDAQYWGVPQRRKRIYLIGDFGGQRAGEILFKSESVLGYTPKSKE 167 >gi|26990694|ref|NP_746119.1| DNA-cytosine methyltransferase [Pseudomonas putida KT2440] gi|24985686|gb|AAN69583.1|AE016592_2 DNA-cytosine methyltransferase [Pseudomonas putida KT2440] Length = 348 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNP--SVEFKFPT 31 + + FGV Q R R +I + F FP Sbjct: 179 INSSGFGVAQHRRRYFIAGISKEIKNKAFTFPD 211 >gi|326772743|ref|ZP_08232027.1| modification methylase XorII [Actinomyces viscosus C505] gi|326637375|gb|EGE38277.1| modification methylase XorII [Actinomyces viscosus C505] Length = 364 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 17/42 (40%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 + A D+G PQ R R +I FP P GD+ Sbjct: 152 LNAADYGAPQARRRAVLIGHRYDMAVPGFPEPTHSPDGGGDL 193 >gi|156033307|ref|XP_001585490.1| hypothetical protein SS1G_13729 [Sclerotinia sclerotiorum 1980] gi|154699132|gb|EDN98870.1| hypothetical protein SS1G_13729 [Sclerotinia sclerotiorum 1980 UF-70] Length = 437 Score = 36.4 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 24/63 (38%), Gaps = 13/63 (20%) Query: 6 FGVPQRRE--R---LYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 F +PQ+ E R ++I F P PL I P+L E TIS + W Sbjct: 165 FFIPQKSEGERMIQIFIAGIERGKPFFTMP-PLDIIPKLA--FEPK-----TISERAWLL 216 Query: 61 HQK 63 Sbjct: 217 LYN 219 >gi|325069024|ref|ZP_08127697.1| modification methylase XorII [Actinomyces oris K20] Length = 201 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 17/42 (40%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 + A D+G PQ R R +I FP P GD+ Sbjct: 152 LNAADYGAPQARRRAVLIGHRYDMAVPGFPEPTHSPDGGGDL 193 >gi|329767774|ref|ZP_08259290.1| hypothetical protein HMPREF0428_00987 [Gemella haemolysans M341] gi|328838875|gb|EGF88469.1| hypothetical protein HMPREF0428_00987 [Gemella haemolysans M341] Length = 336 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 22/102 (21%), Positives = 43/102 (42%), Gaps = 16/102 (15%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL----GIKPRLGDILEEHIDDKS-TISN 55 + A GVPQ+RER++ F+ + P + ++ E+ ++ ++ Sbjct: 174 LNASTMGVPQKRERVF---FICRRKDLNLPELQLNFNEKPIKFKEVREKGKGEEVKGVAG 230 Query: 56 KLWEGHQK-----RKENNKIAGKG--FGYGLFFENSATTNTL 90 +L +K K ++ GKG F LF + + NT+ Sbjct: 231 ELLAYAKKGETNLEKACIRLRGKGSFFNTVLFSDEN-VPNTI 271 >gi|315654951|ref|ZP_07907856.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii ATCC 51333] gi|315490912|gb|EFU80532.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii ATCC 51333] Length = 508 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGVPQRR+R+Y+I Sbjct: 177 LDAQFFGVPQRRKRIYLIC 195 >gi|298346372|ref|YP_003719059.1| DNA-cytosine methyltransferase [Mobiluncus curtisii ATCC 43063] gi|298236433|gb|ADI67565.1| DNA-cytosine methyltransferase [Mobiluncus curtisii ATCC 43063] Length = 508 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGVPQRR+R+Y+I Sbjct: 177 LDAQFFGVPQRRKRIYLIC 195 >gi|325695618|gb|EGD37518.1| modification methylase SinI [Streptococcus sanguinis SK150] Length = 471 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 2 KACDFGVPQRRERLYIID 19 A +FG PQ+RER II Sbjct: 236 NAANFGAPQKRERFVIIA 253 >gi|328947595|ref|YP_004364932.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] gi|328447919|gb|AEB13635.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] Length = 476 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 21/57 (36%), Gaps = 12/57 (21%) Query: 2 KACDFGVPQRRERLYIIDFL------------NPSVEFKFPTPLGIKPRLGDILEEH 46 A ++G PQ+RER+ + F P ++ L D+ E+ Sbjct: 246 NAANYGAPQKRERVVFFCSRDGEKVPYLPPTNDEFGNFGLPKWRTVREVLSDLKEDE 302 >gi|317179735|dbj|BAJ57523.1| Type II DNA modification enzyme [Helicobacter pylori F30] Length = 418 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILE 44 + + +G +RERL I+ N F FP P + + L+ Sbjct: 214 LNSAWYGSATKRERLIIVAIKNDLPFNFTFPKPTHLSDEINTKLD 258 >gi|119485563|ref|ZP_01619838.1| modification methylase [Lyngbya sp. PCC 8106] gi|119456888|gb|EAW38015.1| modification methylase [Lyngbya sp. PCC 8106] Length = 317 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 20/86 (23%), Positives = 34/86 (39%), Gaps = 17/86 (19%) Query: 7 GVPQRRERLYIIDFLNPSVEFK---FPTPLGIKPRLGDILEEHIDDKSTISNKL-WEGHQ 62 GVPQ+R+R + + LN F + L KP + D + +KL E + Sbjct: 148 GVPQKRKRFFWVGELNGKDNRLLSYFESKLSSKPT-------TVRD--YLGDKLGLEYYY 198 Query: 63 KRKENNKIAGKGFGYGLFFENSATTN 88 + + + G + + E S T Sbjct: 199 RHPRSYQRRGI---FSI-DEPSPTVR 220 >gi|325298704|ref|YP_004258621.1| DNA-cytosine methyltransferase [Bacteroides salanitronis DSM 18170] gi|324318257|gb|ADY36148.1| DNA-cytosine methyltransferase [Bacteroides salanitronis DSM 18170] Length = 399 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 23/57 (40%), Gaps = 13/57 (22%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 A D+GVPQ+R R+ ++ F F ++LE + + + S Sbjct: 172 ASDYGVPQKRYRVLMVGIDRELNLGHFDF-----------NLLETIVRENNIPSEHY 217 >gi|284050355|ref|ZP_06380565.1| site-specific DNA-methyltransferase [Arthrospira platensis str. Paraca] Length = 371 Score = 36.4 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 26/59 (44%), Gaps = 5/59 (8%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + A D+G+PQ R+RL+I+ + FP P ++ ++ LWE Sbjct: 151 LNATDYGIPQVRKRLFILA-HRCDLTHPFPQPTHTTSNQTELFTHNLKKC----PSLWE 204 >gi|317011768|gb|ADU85515.1| site-specific DNA-methyltransferase [Helicobacter pylori SouthAfrica7] Length = 236 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILE 44 + + +G +RERL I+ N F FP P + + L+ Sbjct: 32 LNSAWYGSATKRERLIIVAIRNDLPFNFIFPKPTHLSDEINTKLD 76 >gi|115481456|ref|NP_001064321.1| Os10g0209300 [Oryza sativa Japonica Group] gi|19881629|gb|AAM01030.1|AC091735_3 Putative Riboflavin biosynthesis protein ribF [Oryza sativa Japonica Group] gi|110288837|gb|ABG65995.1| Riboflavin kinase/FAD synthetase family protein [Oryza sativa Japonica Group] gi|113638930|dbj|BAF26235.1| Os10g0209300 [Oryza sativa Japonica Group] Length = 329 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 24/65 (36%), Gaps = 8/65 (12%) Query: 14 RLYIIDFLNPSVEF-KFPTPLGIKPRLGDILEEHID----DKSTISNKLWEGHQKRKENN 68 RL I+ ++ P F + + I E+ ++ K T S L KE+N Sbjct: 261 RLVIVGYIRPEANFPSLESLIERIHEDARIAEKALNLPLYAKYTDSPYLRNSL---KEDN 317 Query: 69 KIAGK 73 G Sbjct: 318 SANGN 322 >gi|260591129|ref|ZP_05856587.1| modification methylase AluI [Prevotella veroralis F0319] gi|260536994|gb|EEX19611.1| modification methylase AluI [Prevotella veroralis F0319] Length = 452 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Query: 5 DFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPR 38 FG+P R R+YI+ L FKFP Sbjct: 156 YFGIPHHRNRMYIVGRLKSKGGLQGFKFPDHEERPKC 192 >gi|311977244|gb|ADQ20500.1| M1.BfuAI [Lysinibacillus fusiformis] Length = 357 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 A D+GVPQ+R R+ +I + FP P + Sbjct: 162 AADYGVPQKRYRMLMIG-NRLGQDIIFPEPTHSE 194 >gi|283796860|ref|ZP_06346013.1| DNA (cytosine-5-)-methyltransferase [Clostridium sp. M62/1] gi|291075266|gb|EFE12630.1| DNA (cytosine-5-)-methyltransferase [Clostridium sp. M62/1] Length = 547 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A +GVPQRR+R+Y++ Sbjct: 184 LDAQYWGVPQRRKRIYLVA 202 >gi|312902260|ref|ZP_07761468.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0635] gi|310634319|gb|EFQ17602.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0635] Length = 359 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILE 44 + + +GVPQRR R++++ F +F+ L + LE Sbjct: 174 LDSQYWGVPQRRRRIFLVADFR----DFRAREILFDTQGMQSHLE 214 >gi|119897062|ref|YP_932275.1| C-5 cytosine-specific DNA methylase [Azoarcus sp. BH72] gi|119669475|emb|CAL93388.1| probable C-5 cytosine-specific DNA methylase [Azoarcus sp. BH72] Length = 434 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 + + ++G PQ RER+ I ++E FP P Sbjct: 173 VNSVNYGAPQIRERVIFIG-NRFNMEVDFPNPTH 205 >gi|150396423|ref|YP_001326890.1| DNA-cytosine methyltransferase [Sinorhizobium medicae WSM419] gi|150027938|gb|ABR60055.1| DNA-cytosine methyltransferase [Sinorhizobium medicae WSM419] Length = 632 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 19/94 (20%), Positives = 32/94 (34%), Gaps = 16/94 (17%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62 A D+G+ Q R R+ I F P R +I + +D ++ WEG Sbjct: 425 AKDYGLAQERSRVLFIGIRKDLAR-GFRMPPKFPQRSANIGDVLVD---LMAANGWEGAY 480 Query: 63 KRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 + + A + +T+ R K Sbjct: 481 EWARERREA------------NDVASTVVTRRGK 502 >gi|89243223|gb|ABD64771.1| Met1 [Volvox carteri f. nagariensis] Length = 2262 Score = 36.4 bits (84), Expect = 1.4, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 20/35 (57%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A FGVPQ R+R +I L V ++PTP + Sbjct: 1920 LNAGHFGVPQSRKRTFIWAALPGEVLPEWPTPRHV 1954 >gi|317127844|ref|YP_004094126.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522] gi|315472792|gb|ADU29395.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522] Length = 360 Score = 36.4 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 22/89 (24%), Positives = 35/89 (39%), Gaps = 19/89 (21%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP------RLGDILEEHID-----D 49 + A +FGVPQ+R R + I + F L KP LG++ E Sbjct: 153 LDASEFGVPQKRLRAFFIATRKDIPQITFDK-LKKKPIVLVKDALGELYELEEQMGKNRS 211 Query: 50 KSTISNK----LWEGHQKRK---ENNKIA 71 +S+K + + K EN++I Sbjct: 212 NYFLSSKPDSSYRKYLRNSKNSIENHEIR 240 >gi|242022906|ref|XP_002431878.1| DNA cytosine-5,-methyltransferase, putative [Pediculus humanus corporis] gi|212517219|gb|EEB19140.1| DNA cytosine-5,-methyltransferase, putative [Pediculus humanus corporis] Length = 1330 Score = 36.4 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 28/60 (46%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 ++A ++G+PQ R RL+I+ FP P + L+ +DDK +N W Sbjct: 1032 LQAGNYGIPQTRRRLFILAAAPNLKLPLFPEPTHVFSLRASNLQVTVDDKRFTTNCKWST 1091 >gi|169834680|ref|YP_001693292.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str. Okra] gi|169123228|gb|ACA47063.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str. Okra] Length = 284 Score = 36.4 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 22/93 (23%), Positives = 33/93 (35%), Gaps = 19/93 (20%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID---DKSTISNKLWEGHQKR 64 +PQ+R+RL +I P K+P IK L ++LE+ + K G + Sbjct: 144 LPQKRKRLILIGTKRPFDNLKYPESNPIK--LKNLLEDDPEIDIPNYVY--KRLNGAYRD 199 Query: 65 KENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97 K + T A Y KD Sbjct: 200 KP------------IISTPEGVAPTCVAHYSKD 220 >gi|113461565|ref|YP_719634.1| DNA-cytosine methyltransferase [Haemophilus somnus 129PT] gi|112823608|gb|ABI25697.1| DNA-cytosine methyltransferase [Haemophilus somnus 129PT] Length = 365 Score = 36.4 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGV QRR+R++++ Sbjct: 173 LNAQYFGVAQRRKRVFLVA 191 >gi|170719036|ref|YP_001784193.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336] gi|168827165|gb|ACA32536.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336] Length = 365 Score = 36.4 bits (84), Expect = 1.5, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGV QRR+R++++ Sbjct: 173 LNAQYFGVAQRRKRVFLVA 191 >gi|289669548|ref|ZP_06490623.1| DNA-cytosine methyltransferase [Xanthomonas campestris pv. musacearum NCPPB4381] Length = 330 Score = 36.0 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV 25 + A D+GVPQ RER ++ Sbjct: 145 INAADYGVPQIRERCIVMGIKGRDP 169 >gi|109900394|ref|YP_663649.1| DNA-cytosine methyltransferase [Pseudoalteromonas atlantica T6c] gi|109702675|gb|ABG42595.1| DNA-cytosine methyltransferase [Pseudoalteromonas atlantica T6c] Length = 535 Score = 36.0 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 17/77 (22%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF----KFPTPLGIKPRLGDILEEHIDDKSTIS-- 54 +K DFG+PQRR R+ ++ + +P + D+L + +S +S Sbjct: 249 IKTEDFGIPQRRHRVILLGLREDIADKWDNSLILSPTATQTSTQDVLNDLPKLRSGLSKG 308 Query: 55 ---NKLW-EGHQKRKEN 67 ++ W E + K Sbjct: 309 INNDESWVETLKNSKAK 325 >gi|302836690|ref|XP_002949905.1| maintenance DNA methyltransferase [Volvox carteri f. nagariensis] gi|300264814|gb|EFJ49008.1| maintenance DNA methyltransferase [Volvox carteri f. nagariensis] Length = 2277 Score = 36.0 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 20/35 (57%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + A FGVPQ R+R +I L V ++PTP + Sbjct: 1935 LNAGHFGVPQSRKRTFIWAALPGEVLPEWPTPRHV 1969 >gi|325971313|ref|YP_004247504.1| DNA-cytosine methyltransferase [Spirochaeta sp. Buddy] gi|324026551|gb|ADY13310.1| DNA-cytosine methyltransferase [Spirochaeta sp. Buddy] Length = 516 Score = 36.0 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 2 KACDFGVPQRRERLYIIDFLNP 23 +FGVPQ RER +I L Sbjct: 293 NTVNFGVPQLRERFVMIGVLKQ 314 >gi|41584550|gb|AAS09913.1| BsmBI M1-M2 methyltransferase fusion protein [Geobacillus stearothermophilus] Length = 1068 Score = 36.0 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 + A +GVPQ R+R++I+ + P P Sbjct: 947 LSAEQYGVPQMRKRVFIVA---AKKGLELPKPP 976 >gi|312959258|ref|ZP_07773776.1| DNA (cytosine-5-)-methyltransferase [Pseudomonas fluorescens WH6] gi|311286518|gb|EFQ65081.1| DNA (cytosine-5-)-methyltransferase [Pseudomonas fluorescens WH6] Length = 741 Score = 36.0 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 +KACDFG RERL++I ++P P K Sbjct: 370 LKACDFGAATTRERLFLIA-RRDGKPLRWPEPTHFK 404 >gi|312200730|ref|YP_004020791.1| DNA-cytosine methyltransferase [Frankia sp. EuI1c] gi|311232066|gb|ADP84921.1| DNA-cytosine methyltransferase [Frankia sp. EuI1c] Length = 464 Score = 36.0 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A +FGVPQ RERL + Sbjct: 179 VDAANFGVPQTRERLLFLGVRRR 201 >gi|257867242|ref|ZP_05646895.1| DNA-cytosine methyltransferase [Enterococcus casseliflavus EC30] gi|257873577|ref|ZP_05653230.1| DNA-cytosine methyltransferase [Enterococcus casseliflavus EC10] gi|257801298|gb|EEV30228.1| DNA-cytosine methyltransferase [Enterococcus casseliflavus EC30] gi|257807741|gb|EEV36563.1| DNA-cytosine methyltransferase [Enterococcus casseliflavus EC10] Length = 373 Score = 36.0 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILE 44 + + +GVPQRR R++++ F +F+ L + LE Sbjct: 188 LDSQYWGVPQRRRRIFLVADFR----DFRAREILFDTQGMQSHLE 228 >gi|167761084|ref|ZP_02433211.1| hypothetical protein CLOSCI_03482 [Clostridium scindens ATCC 35704] gi|167661318|gb|EDS05448.1| hypothetical protein CLOSCI_03482 [Clostridium scindens ATCC 35704] Length = 405 Score = 36.0 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 17/64 (26%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH------------IDDKST 52 FGVPQ RER+ I+ P+ + PL I D++++ +D K Sbjct: 170 HFGVPQLRERVVILGKYEPN---RVDEPLDI--VFHDLIKKEQNSIYDVVKDHPVDKKYA 224 Query: 53 ISNK 56 IS Sbjct: 225 ISEH 228 >gi|20068992|gb|AAM09644.1|AF458984_2 m6 adenine and m5 cytosine DNA methyltransferase [Acinetobacter lwoffii] Length = 952 Score = 36.0 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLN-----PSVEFKFPTPLGI 35 + +GVPQ+R+R+ I+ +E FPTP + Sbjct: 873 LNTVHYGVPQKRKRVIILGVHKNLIGSHKIEEFFPTPTTL 912 >gi|91773503|ref|YP_566195.1| DNA-cytosine methyltransferase [Methanococcoides burtonii DSM 6242] gi|91712518|gb|ABE52445.1| DNA-cytosine methyltransferase [Methanococcoides burtonii DSM 6242] Length = 569 Score = 36.0 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 23/114 (20%), Positives = 40/114 (35%), Gaps = 34/114 (29%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG----------DILEEHID--- 48 A D+G+PQRR+RL I ++ P P + DI + + Sbjct: 183 NAADYGIPQRRKRLVI-------GDYPRPDPTHKDKWISLSEVINAFDYDITDPNFGFSI 235 Query: 49 DKSTISNKLWEG-------HQKRKENNKIAGKGFGYG-LFFEN--SATTNTLSA 92 D +++ ++ Q R + YG + F S + T+ A Sbjct: 236 DTEELTDHFYDTSIHEYDWLQARDRKQQAR----YYGRMAFPEETSVPSRTVMA 285 >gi|328463177|gb|EGF34918.1| cytosine-specific methyltransferase [Lactobacillus rhamnosus MTCC 5462] Length = 240 Score = 36.0 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKF 29 +FGVPQ R+R+ + N +F F Sbjct: 29 EFGVPQERKRIILYGQRNDLPKFSF 53 >gi|161789274|ref|YP_001595753.1| methyl transferase [Vibrio sp. 09022] gi|161761495|gb|ABX77139.1| methyl transferase [Vibrio sp. 09022] Length = 421 Score = 36.0 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + +FG PQ RER+ II + K P + G Sbjct: 173 NSANFGTPQVRERVVIIASRDGK---KLPYLVPTHSETGS 209 >gi|319782483|ref|YP_004141959.1| DNA-cytosine methyltransferase [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317168371|gb|ADV11909.1| DNA-cytosine methyltransferase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 368 Score = 36.0 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 8/24 (33%), Positives = 15/24 (62%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS 24 + A D+G+ QRR+R++I+ Sbjct: 157 LDARDYGIAQRRKRVFILGLRRGE 180 >gi|313905794|ref|ZP_07839153.1| DNA-cytosine methyltransferase [Eubacterium cellulosolvens 6] gi|313469400|gb|EFR64743.1| DNA-cytosine methyltransferase [Eubacterium cellulosolvens 6] Length = 427 Score = 36.0 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 A FGV Q R R+ I+ + + + +P Sbjct: 207 NARTFGVLQNRRRMIIVGWKKGT-NYSYPEFQDKT 240 >gi|260664324|ref|ZP_05865177.1| DNA-cytosine methyltransferase [Lactobacillus jensenii SJ-7A-US] gi|260562210|gb|EEX28179.1| DNA-cytosine methyltransferase [Lactobacillus jensenii SJ-7A-US] Length = 298 Score = 36.0 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 9/12 (75%), Positives = 10/12 (83%) Query: 8 VPQRRERLYIID 19 VPQ RER+YII Sbjct: 156 VPQNRERIYIIG 167 >gi|312794286|ref|YP_004027209.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii 177R1B] gi|312181426|gb|ADQ41596.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii 177R1B] Length = 419 Score = 36.0 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40 + + DF V Q R+R+ ++ + S FK+P I+ Sbjct: 202 LNSADFLVLQNRKRVILMGWKKGS-NFKYPEFKKIEHNYK 240 >gi|125531419|gb|EAY77984.1| hypothetical protein OsI_33028 [Oryza sativa Indica Group] Length = 301 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 24/65 (36%), Gaps = 8/65 (12%) Query: 14 RLYIIDFLNPSVEF-KFPTPLGIKPRLGDILEEHID----DKSTISNKLWEGHQKRKENN 68 RL I+ ++ P F + + I E+ ++ K T S L KE+N Sbjct: 233 RLVIVGYIRPEANFPSLESLIERIHEDARIAEKALNLPLYAKYTDSPYLRNSL---KEDN 289 Query: 69 KIAGK 73 G Sbjct: 290 SANGN 294 >gi|309799879|ref|ZP_07694084.1| DNA-cytosine methyltransferase [Streptococcus infantis SK1302] gi|308116469|gb|EFO53940.1| DNA-cytosine methyltransferase [Streptococcus infantis SK1302] Length = 412 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP--RLGDILEE 45 + FGV Q R R+ II +L + +P L + + D+L + Sbjct: 208 NSKHFGVLQNRRRMIIIGWLK-NSGMAYPDFLKKESSFTVNDLLAD 252 >gi|254228592|ref|ZP_04922017.1| Site-specific DNA methylase [Vibrio sp. Ex25] gi|262392607|ref|YP_003284461.1| DNA-cytosine methyltransferase [Vibrio sp. Ex25] gi|151938974|gb|EDN57807.1| Site-specific DNA methylase [Vibrio sp. Ex25] gi|262336201|gb|ACY49996.1| DNA-cytosine methyltransferase [Vibrio sp. Ex25] Length = 427 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFK--FPTPLGIKPR 38 + + FG PQ R R++I F NP F + T +G KP+ Sbjct: 152 VNSRFFGAPQSRPRVFICAFRGNPLKAFSTLYETGVGTKPK 192 >gi|313667095|gb|ADR72992.1| M2.BspMI [Bacillus sp. M(2010)] Length = 353 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 A DFGVPQ+R R+++I FP+P Sbjct: 161 AADFGVPQQRYRMFMIG-NRVGKPVNFPSPSH 191 >gi|332706962|ref|ZP_08427022.1| DNA-methyltransferase [Lyngbya majuscula 3L] gi|332354227|gb|EGJ33707.1| DNA-methyltransferase [Lyngbya majuscula 3L] Length = 450 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32 + ++G+PQRR+R+ II +F+ P P Sbjct: 179 SQEYGIPQRRKRVLIIG-NRLGHDFRIPAP 207 >gi|150024829|ref|YP_001295655.1| modification methyltransferase Sau3AI [Flavobacterium psychrophilum JIP02/86] gi|149771370|emb|CAL42839.1| Probable modification methyltransferase Sau3AI [Flavobacterium psychrophilum JIP02/86] Length = 431 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 19/25 (76%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV 25 + A ++G+PQRR+R++I+ +L S Sbjct: 175 VNAAEYGMPQRRKRIFILAYLQDST 199 >gi|311896967|dbj|BAJ29375.1| putative DNA methyltransferase [Kitasatospora setae KM-6054] Length = 676 Score = 36.0 bits (83), Expect = 1.8, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Query: 6 FGVPQRRERLYIIDFLNPSVEFKFP---TPLGIKPRLGDI 42 +GVPQ R+RL ++ N +F + P+ ++ + D+ Sbjct: 219 YGVPQHRKRLILLA-RNDVEQFDWEPDQEPVTLREAIADL 257 >gi|323650700|gb|ADX97434.1| M2.BspACI [Bacillus psychrodurans] Length = 444 Score = 36.0 bits (83), Expect = 1.9, Method: Composition-based stats. Identities = 15/82 (18%), Positives = 32/82 (39%), Gaps = 28/82 (34%) Query: 1 MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGI------------------------ 35 + + + GVPQ R+R YI+ ++ PS +F + Sbjct: 229 INSSEAGVPQSRDRTYIVAIMDYPSEDFYYDYRSKKIDILKSELNIFGFKGFNFFSDLVF 288 Query: 36 ---KPRLGDILEEHIDDKSTIS 54 K + D++E+ +++K + Sbjct: 289 DCVKTVIEDVIEDDVEEKYFFN 310 >gi|229552043|ref|ZP_04440768.1| DNA-cytosine methyltransferase [Lactobacillus rhamnosus LMS2-1] gi|258539457|ref|YP_003173956.1| cytosine-specific methyltransferase [Lactobacillus rhamnosus Lc 705] gi|229314620|gb|EEN80593.1| DNA-cytosine methyltransferase [Lactobacillus rhamnosus LMS2-1] gi|257151133|emb|CAR90105.1| Cytosine-specific methyltransferase [Lactobacillus rhamnosus Lc 705] Length = 415 Score = 36.0 bits (83), Expect = 1.9, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 5 DFGVPQRRERLYIIDFLNPSVEFKF 29 +FGVPQ R+R+ + N +F F Sbjct: 204 EFGVPQERKRIILYGQRNDLPKFSF 228 >gi|283466067|emb|CBG92842.1| hypothetical protein [Enterococcus casseliflavus] Length = 359 Score = 36.0 bits (83), Expect = 1.9, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILE 44 + + GVPQRR R++++ F +F+ L + LE Sbjct: 174 LDSQYLGVPQRRRRIFLVADFR----DFRAREILFDTQGMQSHLE 214 >gi|312901967|ref|ZP_07761229.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0470] gi|311290903|gb|EFQ69459.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0470] Length = 412 Score = 36.0 bits (83), Expect = 1.9, Method: Composition-based stats. Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + + ++ VPQ+RERL+I Sbjct: 194 INSAEYEVPQKRERLFIFGIRKD 216 >gi|315650298|ref|ZP_07903370.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986] gi|315487409|gb|EFU77719.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986] Length = 644 Score = 35.7 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A +GVPQRR+R+Y++ Sbjct: 195 LDAQYWGVPQRRKRIYLVA 213 >gi|119173265|ref|XP_001239116.1| hypothetical protein CIMG_10138 [Coccidioides immitis RS] Length = 626 Score = 35.7 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 12/60 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP------------RLGDILEEHID 48 + D+GVPQ+R+RL +I FP P P +GDI E D Sbjct: 472 LSCEDYGVPQQRKRLVMIGAGPGEPLPPFPKPTHGPPGSNLLPHRTILDAIGDIPENAPD 531 >gi|167771959|ref|ZP_02444012.1| hypothetical protein ANACOL_03332 [Anaerotruncus colihominis DSM 17241] gi|167665757|gb|EDS09887.1| hypothetical protein ANACOL_03332 [Anaerotruncus colihominis DSM 17241] Length = 520 Score = 35.7 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Query: 1 MKACDFGVPQRRERLYIID-FLNP---SVEFKFPTPLGIKPRLG 40 + A +GVPQRR R+Y++ F + + F+ P + P G Sbjct: 177 LDAQFWGVPQRRRRIYLVADFRDDCAAKILFE-PARVFWHPTAG 219 >gi|302531731|ref|ZP_07284073.1| conserved hypothetical protein [Streptomyces sp. AA4] gi|302440626|gb|EFL12442.1| conserved hypothetical protein [Streptomyces sp. AA4] Length = 357 Score = 35.7 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 1 MKACDFGVPQRRERLYIIDFLN 22 + A DFGV Q R+RL++ L Sbjct: 164 LNAADFGVAQSRQRLFVTGVLK 185 >gi|166366114|ref|YP_001658387.1| cytosine-specific modification DNA methylase [Microcystis aeruginosa NIES-843] gi|166088487|dbj|BAG03195.1| cytosine-specific modification DNA methylase [Microcystis aeruginosa NIES-843] Length = 431 Score = 35.7 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLN 22 + A D+G+PQ RER+ I Sbjct: 208 LFAPDYGIPQTRERIIFIGLNK 229 >gi|308069782|ref|YP_003871387.1| Site-specific DNA methylase [Paenibacillus polymyxa E681] gi|305859061|gb|ADM70849.1| Site-specific DNA methylase [Paenibacillus polymyxa E681] Length = 204 Score = 35.7 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31 + + GVPQ+RER++ F+ + FP Sbjct: 113 LNSATMGVPQKRERVF---FIAAREDLPFPP 140 >gi|296535365|ref|ZP_06897565.1| site-specific DNA methylase [Roseomonas cervicalis ATCC 49957] gi|296264307|gb|EFH10732.1| site-specific DNA methylase [Roseomonas cervicalis ATCC 49957] Length = 337 Score = 35.7 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 1 MKACDFGVPQRRERLYI 17 + A DFGVPQ R R++I Sbjct: 148 LDASDFGVPQSRRRVFI 164 >gi|282849501|ref|ZP_06258885.1| C-5 cytosine-specific DNA methylase [Veillonella parvula ATCC 17745] gi|282580438|gb|EFB85837.1| C-5 cytosine-specific DNA methylase [Veillonella parvula ATCC 17745] Length = 294 Score = 35.7 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPL 33 + + +G +RERL I+ N + F++P P Sbjct: 92 LNSAWYGAATKRERLIIVAIRNDVEDIFEYPQPQ 125 >gi|166366204|ref|YP_001658477.1| DNA cytosine methylase [Microcystis aeruginosa NIES-843] gi|166088577|dbj|BAG03285.1| DNA cytosine methylase [Microcystis aeruginosa NIES-843] Length = 346 Score = 35.7 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTI 53 + + F +PQ R R +++ F F+FP + + I+ + +I Sbjct: 159 IDSKYFQIPQSRPRFFLLAFRKDLGIKNFQFPQHCHAEVGIEKII---VPGDYSI 210 >gi|220903552|ref|YP_002478864.1| DNA-cytosine methyltransferase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] gi|219867851|gb|ACL48186.1| DNA-cytosine methyltransferase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] Length = 310 Score = 35.7 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 20/86 (23%), Positives = 31/86 (36%), Gaps = 24/86 (27%) Query: 2 KACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPR-------------LGDILEE 45 DFGVPQ R R+ I ++++P + L +I E Sbjct: 143 NVADFGVPQSRFRVIIAGTRKDIPKRLDYEYPAATHAQAPSQGKLPWVTIGEALKEIPEP 202 Query: 46 --------HIDDKSTISNKLWEGHQK 63 H K I+N+ + GH+K Sbjct: 203 GDGVALLNHDYSKYKITNRNFTGHRK 228 >gi|296425866|ref|XP_002842459.1| hypothetical protein [Tuber melanosporum Mel28] gi|295638727|emb|CAZ86650.1| unnamed protein product [Tuber melanosporum] Length = 857 Score = 35.7 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 22/42 (52%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 + ++GVPQ R+RL+++ +FP P P+ +I Sbjct: 666 LHGVEYGVPQTRKRLFLLAASPGEELPEFPKPTHAHPKTANI 707 >gi|262038316|ref|ZP_06011702.1| modification methylase spri [Leptotrichia goodfellowii F0264] gi|261747667|gb|EEY35120.1| modification methylase spri [Leptotrichia goodfellowii F0264] Length = 318 Score = 35.7 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + + D+GV Q RERLYI+ Sbjct: 144 LDSLDYGVSQMRERLYIVGIKKE 166 >gi|291535263|emb|CBL08375.1| DNA-methyltransferase (dcm) [Roseburia intestinalis M50/1] Length = 350 Score = 35.7 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 5 DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 ++G+PQ R R+ I+ N +V ++ P+P + Sbjct: 159 EYGIPQARHRIIIVGIRNNINVTYRVPSPEPYR 191 >gi|255020360|ref|ZP_05292428.1| DNA-cytosine methyltransferase [Acidithiobacillus caldus ATCC 51756] gi|254970280|gb|EET27774.1| DNA-cytosine methyltransferase [Acidithiobacillus caldus ATCC 51756] Length = 449 Score = 35.7 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLN 22 + A FGVPQ R R+ I+ + Sbjct: 180 LDASLFGVPQSRRRVVIVGIQD 201 >gi|225026529|ref|ZP_03715721.1| hypothetical protein EUBHAL_00778 [Eubacterium hallii DSM 3353] gi|224956143|gb|EEG37352.1| hypothetical protein EUBHAL_00778 [Eubacterium hallii DSM 3353] Length = 461 Score = 35.7 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH 46 + A ++G QRR R++I + N + K+ + R D LEE Sbjct: 173 INAAEYGYQQRRRRIFIFAYKNDT---KYAERILKTIRYTDELEED 215 >gi|66768381|ref|YP_243143.1| DNA methyltransferase [Xanthomonas campestris pv. campestris str. 8004] gi|66573713|gb|AAY49123.1| DNA methyltransferase [Xanthomonas campestris pv. campestris str. 8004] Length = 512 Score = 35.7 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Query: 1 MKACDFGVPQRRERLYII-----DFLNPSVEFK 28 + A FGV QRR+R++++ F V F+ Sbjct: 182 LDAQYFGVAQRRKRVFLVASGGDGFDPAEVLFE 214 >gi|323650463|gb|ADX97312.1| M.FspI [Fischerella muscicola SAG 1427-1] Length = 385 Score = 35.7 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 6/42 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 + A +G+PQ R R + I L+ + F P P GDI Sbjct: 155 LNAAHYGIPQTRSRAFFIASLDHYLHF--PKPTH----FGDI 190 >gi|116750223|ref|YP_846910.1| DNA-cytosine methyltransferase [Syntrophobacter fumaroxidans MPOB] gi|116699287|gb|ABK18475.1| DNA-cytosine methyltransferase [Syntrophobacter fumaroxidans MPOB] Length = 399 Score = 35.7 bits (82), Expect = 2.3, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 6/53 (11%) Query: 1 MKACDFGVPQRRERLYIID--FLNPSVEFKFPTPLGIKPRLGD---ILEEHID 48 + A D+GVPQ R R +II F +P F P L + E+ + Sbjct: 163 LCAADYGVPQIRWRAFIIGCLFTDPKKVFP-PKRTNYPTDLNNRRIFAEKEVP 214 >gi|319787207|ref|YP_004146682.1| DNA-cytosine methyltransferase [Pseudoxanthomonas suwonensis 11-1] gi|317465719|gb|ADV27451.1| DNA-cytosine methyltransferase [Pseudoxanthomonas suwonensis 11-1] Length = 443 Score = 35.7 bits (82), Expect = 2.3, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A ++GVPQ R+RL+++ Sbjct: 155 LNAYEYGVPQDRQRLFLLG 173 >gi|78047842|ref|YP_364017.1| cytosine-specific DNA methyltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|78036272|emb|CAJ23963.1| cytosine-specific DNA methyltransferase [Xanthomonas campestris pv. vesicatoria str. 85-10] Length = 512 Score = 35.7 bits (82), Expect = 2.3, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Query: 1 MKACDFGVPQRRERLYII-----DFLNPSVEFK 28 + A FGV QRR+R++++ F V F+ Sbjct: 182 LDAQYFGVAQRRKRVFLVASGGDGFDPVKVLFE 214 >gi|300867442|ref|ZP_07112096.1| Modification methylase MthTI [Oscillatoria sp. PCC 6506] gi|300334557|emb|CBN57264.1| Modification methylase MthTI [Oscillatoria sp. PCC 6506] Length = 350 Score = 35.7 bits (82), Expect = 2.3, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 26/63 (41%), Gaps = 10/63 (15%) Query: 1 MKACDFGVPQRRERLYIIDF---LNPSVEFKF----PTPLGIKPRLGDILEEHIDDKSTI 53 + A + VPQ R+R+ + + L F + L +K +GD+ E I + Sbjct: 149 LNAMYYNVPQDRKRVIFVGYHLSLKRRFNFDWVGKSRRILTLKDAIGDLQESVIPA---L 205 Query: 54 SNK 56 S Sbjct: 206 SPN 208 >gi|126658774|ref|ZP_01729918.1| site-specific DNA-methyltransferase [Cyanothece sp. CCY0110] gi|126619872|gb|EAZ90597.1| site-specific DNA-methyltransferase [Cyanothece sp. CCY0110] Length = 461 Score = 35.7 bits (82), Expect = 2.3, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Query: 2 KACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGI 35 + +FG PQ RER+ II N F PT Sbjct: 243 NSANFGTPQIRERVIIICSRNGEKPPFLVPTHSEK 277 >gi|291514217|emb|CBK63427.1| DNA-methyltransferase (dcm) [Alistipes shahii WAL 8301] Length = 296 Score = 35.7 bits (82), Expect = 2.4, Method: Composition-based stats. Identities = 6/12 (50%), Positives = 10/12 (83%) Query: 8 VPQRRERLYIID 19 +PQ RER+Y++ Sbjct: 151 LPQNRERIYLVG 162 >gi|221369948|ref|YP_002521044.1| Modification methylase [Rhodobacter sphaeroides KD131] gi|221163000|gb|ACM03971.1| Modification methylase [Rhodobacter sphaeroides KD131] Length = 540 Score = 35.7 bits (82), Expect = 2.4, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 ++A ++GVPQRR R+ I+ + + Sbjct: 237 VRAEEWGVPQRRHRVIIVGIRSDLAD 262 >gi|221065716|ref|ZP_03541821.1| C-5 cytosine-specific DNA methylase [Comamonas testosteroni KF-1] gi|220710739|gb|EED66107.1| C-5 cytosine-specific DNA methylase [Comamonas testosteroni KF-1] Length = 202 Score = 35.7 bits (82), Expect = 2.4, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + A D GVPQ R R++II Sbjct: 13 VDAADHGVPQHRVRMFIIA 31 >gi|42779446|ref|NP_976693.1| DNA-cytosine methyltransferase family protein [Bacillus cereus ATCC 10987] gi|42735362|gb|AAS39301.1| DNA-cytosine methyltransferase family protein [Bacillus cereus ATCC 10987] Length = 350 Score = 35.7 bits (82), Expect = 2.4, Method: Composition-based stats. Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query: 5 DFGVPQRRERLYIIDFLNP-SVEFKFPT 31 ++GVPQ R RL I+ + VEFK P+ Sbjct: 159 EYGVPQARHRLIIVGIRDDIDVEFKVPS 186 >gi|303245411|ref|ZP_07331695.1| DNA-cytosine methyltransferase [Desulfovibrio fructosovorans JJ] gi|302493260|gb|EFL53122.1| DNA-cytosine methyltransferase [Desulfovibrio fructosovorans JJ] Length = 490 Score = 35.7 bits (82), Expect = 2.4, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF-KFPTPLGIK 36 + + +GVP+ RER ++I + E +FP P Sbjct: 188 LNSVHYGVPEMRERAFLIGYAAGIAERIRFPEPTRRH 224 >gi|21225136|ref|NP_630915.1| DNA methylase [Streptomyces coelicolor A3(2)] gi|6900913|emb|CAB71857.1| putative DNA methylase [Streptomyces coelicolor A3(2)] Length = 423 Score = 35.7 bits (82), Expect = 2.4, Method: Composition-based stats. Identities = 9/14 (64%), Positives = 11/14 (78%) Query: 1 MKACDFGVPQRRER 14 + A DFGVPQ R+R Sbjct: 166 LNAADFGVPQTRKR 179 >gi|284928852|ref|YP_003421374.1| DNA-methyltransferase Dcm [cyanobacterium UCYN-A] gi|284809311|gb|ADB95016.1| DNA-methyltransferase Dcm [cyanobacterium UCYN-A] Length = 422 Score = 35.7 bits (82), Expect = 2.4, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 1 MKACDFGVPQRRERLYIID 19 + A ++GVPQ R+RL+I+ Sbjct: 157 LNAANYGVPQIRKRLFIMG 175 >gi|197124333|ref|YP_002136284.1| DNA-cytosine methyltransferase [Anaeromyxobacter sp. K] gi|196174182|gb|ACG75155.1| DNA-cytosine methyltransferase [Anaeromyxobacter sp. K] Length = 657 Score = 35.7 bits (82), Expect = 2.4, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGVPQ R R +++ Sbjct: 425 LNATTFGVPQDRTRCFLVA 443 >gi|283782595|ref|YP_003373349.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis 409-05] gi|283441341|gb|ADB13807.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis 409-05] Length = 424 Score = 35.7 bits (82), Expect = 2.5, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 + A D+G+PQRR R+YI K+P L Sbjct: 180 INAADYGMPQRRRRVYIFA---EHDSKKWPNKL 209 >gi|256375192|ref|YP_003098852.1| DNA-cytosine methyltransferase [Actinosynnema mirum DSM 43827] gi|255919495|gb|ACU35006.1| DNA-cytosine methyltransferase [Actinosynnema mirum DSM 43827] Length = 361 Score = 35.7 bits (82), Expect = 2.5, Method: Composition-based stats. Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK---PRLGDIL 43 + A DFGVPQRR R +I + + + P P + + D+L Sbjct: 135 LLAADFGVPQRRRRAIVIG--SRVGKVELPAPTHARESWHAVRDVL 178 >gi|325995748|gb|ADZ51153.1| DNA-cytosine methyltransferase [Helicobacter pylori 2018] Length = 160 Score = 35.7 bits (82), Expect = 2.5, Method: Composition-based stats. Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 1 MKACDFGVPQRRERLY 16 + A D+GVPQ RER+ Sbjct: 145 LNALDYGVPQVRERVI 160 >gi|332881189|ref|ZP_08448845.1| DNA (cytosine-5-)-methyltransferase [Capnocytophaga sp. oral taxon 329 str. F0087] gi|332680863|gb|EGJ53804.1| DNA (cytosine-5-)-methyltransferase [Capnocytophaga sp. oral taxon 329 str. F0087] Length = 367 Score = 35.7 bits (82), Expect = 2.5, Method: Composition-based stats. Identities = 6/12 (50%), Positives = 10/12 (83%) Query: 8 VPQRRERLYIID 19 +PQ RER+Y++ Sbjct: 151 LPQNRERIYLVG 162 >gi|291007578|ref|ZP_06565551.1| DNA modification methylase M.NGOI [Saccharopolyspora erythraea NRRL 2338] Length = 308 Score = 35.3 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIK-PRLGDILEEHIDDK 50 + A FGVPQRR I+ F +P P +GD+L + + + Sbjct: 134 LDAQRFGVPQRRPHGLIVGMAPEHLARFSWPVGNDHGAPTVGDVLRKSMASR 185 >gi|134098143|ref|YP_001103804.1| DNA modification methylase M.NGOI [Saccharopolyspora erythraea NRRL 2338] gi|133910766|emb|CAM00879.1| DNA modification methylase M.NGOI [Saccharopolyspora erythraea NRRL 2338] Length = 234 Score = 35.3 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIK-PRLGDILEEHIDDK 50 + A FGVPQRR I+ F +P P +GD+L + + + Sbjct: 60 LDAQRFGVPQRRPHGLIVGMAPEHLARFSWPVGNDHGAPTVGDVLRKSMASR 111 >gi|256847840|ref|ZP_05553285.1| DNA-cytosine methyltransferase [Lactobacillus coleohominis 101-4-CHN] gi|256715529|gb|EEU30505.1| DNA-cytosine methyltransferase [Lactobacillus coleohominis 101-4-CHN] Length = 349 Score = 35.3 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 5 DFGVPQRRERLYIIDFLNP 23 D+GVPQ R R+ ++ N Sbjct: 158 DYGVPQARHRIIVVGIRND 176 >gi|86142380|ref|ZP_01060890.1| putative 5-methylcytosine methyltransferase [Leeuwenhoekiella blandensis MED217] gi|85831132|gb|EAQ49589.1| putative 5-methylcytosine methyltransferase [Leeuwenhoekiella blandensis MED217] Length = 332 Score = 35.3 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 13/51 (25%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-LGIKPRLGDILEEHIDDK 50 + + D+GVPQ R+R+ I N FP + + + L + K Sbjct: 155 LNSADYGVPQVRKRVIFIGTKNSQKIL-FPKKEVDKYVTVKEALSSYPKLK 204 >gi|303324183|ref|XP_003072079.1| C-5 cytosine methyltransferase DmtA, putative [Coccidioides posadasii C735 delta SOWgp] gi|240111789|gb|EER29934.1| C-5 cytosine methyltransferase DmtA, putative [Coccidioides posadasii C735 delta SOWgp] Length = 535 Score = 35.3 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 12/60 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP------------RLGDILEEHID 48 + D+GVPQ+R+RL +I FP P P +GDI E D Sbjct: 415 LSCEDYGVPQQRKRLVMIGAGPGEPLPPFPKPTHGPPGSNLLPHRTILDAIGDIPENAPD 474 >gi|261381417|ref|ZP_05985990.1| DNA (cytosine-5-)-methyltransferase [Neisseria subflava NJ9703] gi|284795594|gb|EFC50941.1| DNA (cytosine-5-)-methyltransferase [Neisseria subflava NJ9703] Length = 420 Score = 35.3 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL 39 + A D+G Q R+R+ ++ F +P KP + Sbjct: 197 LNANDYGALQARKRIILVGRRGHQTGF-YPQLEIDKPNV 234 >gi|332879681|ref|ZP_08447373.1| DNA (cytosine-5-)-methyltransferase [Capnocytophaga sp. oral taxon 329 str. F0087] gi|332682372|gb|EGJ55277.1| DNA (cytosine-5-)-methyltransferase [Capnocytophaga sp. oral taxon 329 str. F0087] Length = 299 Score = 35.3 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 6/12 (50%), Positives = 10/12 (83%) Query: 8 VPQRRERLYIID 19 +PQ RER+Y++ Sbjct: 151 LPQNRERIYLVG 162 >gi|119488852|ref|ZP_01621814.1| NgoIM [Lyngbya sp. PCC 8106] gi|119455013|gb|EAW36155.1| NgoIM [Lyngbya sp. PCC 8106] Length = 385 Score = 35.3 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + FG+PQ R+R++I+ Sbjct: 144 INPLHFGIPQNRDRVFILG 162 >gi|29566860|ref|NP_818425.1| gp127 [Mycobacterium phage Omega] gi|29425585|gb|AAN12767.1| gp127 [Mycobacterium phage Omega] Length = 247 Score = 35.3 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + A GVPQRR R++I+ Sbjct: 150 LDAQFTGVPQRRRRIFIVG 168 >gi|186686332|ref|YP_001869528.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102] gi|186468784|gb|ACC84585.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102] Length = 331 Score = 35.3 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 19/84 (22%), Positives = 34/84 (40%), Gaps = 13/84 (15%) Query: 7 GVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD-KSTISNKL-WEGHQKR 64 GVPQ+R+R + L E G++P L L + + + NKL + + + Sbjct: 161 GVPQKRKRFFCFGELQGKDE-------GLEPYLKKRLADKPMTIRDYLGNKLEIQYYYRH 213 Query: 65 KENNKIAGKGFGYGLFFENSATTN 88 + + G + + E S T Sbjct: 214 PRSYQRRGI---FSI-DEPSPTVR 233 >gi|86131659|ref|ZP_01050257.1| DNA (cytosine-5-)-methyltransferase [Dokdonia donghaensis MED134] gi|85818104|gb|EAQ39272.1| DNA (cytosine-5-)-methyltransferase [Dokdonia donghaensis MED134] Length = 409 Score = 35.3 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 13/52 (25%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53 K+ FGV Q+R R+ +I + S FK+P E +D+K TI Sbjct: 196 KSEHFGVLQKRRRIILIGWQKGS-GFKYPE------------FEELDEKFTI 234 >gi|50365124|ref|YP_053549.1| modification methylase Sau3AI (GATC cytosine-specific methyltransferase) [Mesoplasma florum L1] gi|50363680|gb|AAT75665.1| modification methylase Sau3AI (GATC cytosine-specific methyltransferase) [Mesoplasma florum L1] Length = 404 Score = 35.3 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 11/48 (22%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Query: 30 PTPLGIKPRLGDILEEHIDDKSTISNKLWEG---HQKRKENNKIAGKG 74 P G + +L DILE+ +DD ++ + + + K+ + G Sbjct: 252 PLFKGKQKKLKDILEDKVDDSYFLTEEQIQKISILKDSKKIPRTKPNG 299 >gi|320037073|gb|EFW19011.1| hypothetical protein CPSG_04557 [Coccidioides posadasii str. Silveira] Length = 607 Score = 35.3 bits (81), Expect = 2.8, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 12/60 (20%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP------------RLGDILEEHID 48 + D+GVPQ+R+RL +I FP P P +GDI E D Sbjct: 415 LSCEDYGVPQQRKRLVMIGAGPGEPLPPFPKPTHGPPGSNLLPHRTILDAIGDIPENAPD 474 >gi|54026007|ref|YP_120249.1| hypothetical protein nfa40370 [Nocardia farcinica IFM 10152] gi|54017515|dbj|BAD58885.1| hypothetical protein [Nocardia farcinica IFM 10152] Length = 592 Score = 35.3 bits (81), Expect = 2.8, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL 39 + + FGVPQ R+RLYI+ F + + P P L Sbjct: 199 LNSMFFGVPQSRDRLYIV-FWDR----RMPAPDLEHRPL 232 >gi|292670760|ref|ZP_06604186.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541] gi|292647381|gb|EFF65353.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541] Length = 476 Score = 35.3 bits (81), Expect = 2.9, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A +GVPQRR R++++ Sbjct: 168 LDAQYWGVPQRRRRIFLVA 186 >gi|209546991|ref|YP_002278909.1| DNA-cytosine methyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209538235|gb|ACI58169.1| DNA-cytosine methyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 355 Score = 35.3 bits (81), Expect = 2.9, Method: Composition-based stats. Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Query: 1 MKACDFGVPQRRERLYII 18 + A DFG PQRR R YI+ Sbjct: 147 LNAADFGCPQRRSR-YIV 163 >gi|34014717|dbj|BAC81824.1| methylase [Acidocella facilis] Length = 443 Score = 35.3 bits (81), Expect = 2.9, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33 + A +FG PQ+R+RL + V +P P Sbjct: 154 LDASNFGTPQKRQRLILFGAKKGLVLPDYPAPT 186 >gi|332158207|ref|YP_004423486.1| modification methylase [Pyrococcus sp. NA2] gi|331033670|gb|AEC51482.1| modification methylase [Pyrococcus sp. NA2] Length = 310 Score = 35.3 bits (81), Expect = 3.0, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 8/59 (13%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 + + D+GVPQ R R++I ++E K P + R+ D+L++ D +N+LW Sbjct: 155 LNSLDYGVPQIRRRVFI-----SNIELK-PRKVRGPNRVWDVLKDVPPD--APNNELWN 205 >gi|291439417|ref|ZP_06578807.1| DNA modification methylase M.NGOI [Streptomyces ghanaensis ATCC 14672] gi|291342312|gb|EFE69268.1| DNA modification methylase M.NGOI [Streptomyces ghanaensis ATCC 14672] Length = 338 Score = 35.3 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Query: 1 MKACDFGVPQRRERL--YIIDFLNPSVE-FKFPTPL 33 + A DFGVPQ ERL ++ P F PTP Sbjct: 143 LNAADFGVPQ--ERLQGVLVALKKPWGRTFTPPTPT 176 >gi|239931046|ref|ZP_04687999.1| putative 5-methylcytosine methyltransferase [Streptomyces ghanaensis ATCC 14672] Length = 345 Score = 35.3 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Query: 1 MKACDFGVPQRRERL--YIIDFLNPSVE-FKFPTPL 33 + A DFGVPQ ERL ++ P F PTP Sbjct: 150 LNAADFGVPQ--ERLQGVLVALKKPWGRTFTPPTPT 183 >gi|182438468|ref|YP_001826187.1| putative 5-methylcytosine methyltransferase [Streptomyces griseus subsp. griseus NBRC 13350] gi|178466984|dbj|BAG21504.1| putative 5-methylcytosine methyltransferase [Streptomyces griseus subsp. griseus NBRC 13350] Length = 448 Score = 35.3 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILE 44 + DFGVPQ R R +I F +V K P R E Sbjct: 199 LHTEDFGVPQTRRRAVLIAQFDPENVHRKVRFPEATHQRYRKGAE 243 >gi|167725800|ref|ZP_02409036.1| putative cytosine-specific modification methylase [Burkholderia pseudomallei DM98] Length = 661 Score = 35.3 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 ++ACD+G P R+RL+++ + +PTP P+ Sbjct: 208 LRACDYGTPTIRKRLFVVG-RRDHLPIVWPTPTHGDPK 244 >gi|163716644|gb|ABY40554.1| putative site-specific DNA methylase [Burkholderia phage Bups phi1] Length = 334 Score = 35.3 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 ++ACD+G P R+RL+++ + +PTP P+ Sbjct: 208 LRACDYGTPTIRKRLFVVG-RRDHLPIVWPTPTHGDPK 244 >gi|254191931|ref|ZP_04898431.1| DNA cytosine methyltransferase [Burkholderia pseudomallei Pasteur 52237] gi|157987753|gb|EDO95518.1| DNA cytosine methyltransferase [Burkholderia pseudomallei Pasteur 52237] Length = 661 Score = 35.3 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 ++ACD+G P R+RL+++ + +PTP P+ Sbjct: 208 LRACDYGTPTIRKRLFVVG-RRDHLPIVWPTPTHGDPK 244 >gi|91203606|emb|CAJ71259.1| similar to HhaI Dna (cytosine-C5-)-methyltransferase [Candidatus Kuenenia stuttgartiensis] Length = 416 Score = 35.3 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKF 29 A +FGV Q R+R+ II + + F F Sbjct: 193 AKEFGVLQNRKRVIIIGWKKD-LNFSF 218 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] gi|170762087|ref|YP_001752613.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] gi|171920252|ref|ZP_02931618.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 1 str. ATCC 27813] gi|186701746|ref|ZP_02971433.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 6 str. ATCC 27818] gi|11356834|pir||D82880 cytosine-specific methyltransferase UU528 [imported] - Ureaplasma urealyticum gi|6899531|gb|AAF30941.1|AE002151_7 cytosine-specific methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 700970] gi|168827664|gb|ACA32926.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 3 str. ATCC 27815] gi|171902654|gb|EDT48943.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 1 str. ATCC 27813] gi|186701017|gb|EDU19299.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 6 str. ATCC 27818] Length = 299 Score = 35.3 bits (81), Expect = 3.1, Method: Composition-based stats. Identities = 24/112 (21%), Positives = 41/112 (36%), Gaps = 31/112 (27%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---------EFKFPTPLGIKPRLGDILEEHID-DK 50 + A D+G QRR+R+Y I LN + + P G + +L D+L+ + +K Sbjct: 107 LNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYKIEK 166 Query: 51 STISNKL---------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93 L + + Y L N T+T++ R Sbjct: 167 YYQEAYLAQPNRTFSRIKYVIPK------------YDLLNPNCYCTSTITTR 206 >gi|295395774|ref|ZP_06805962.1| short-chain fatty acid transporter [Brevibacterium mcbrellneri ATCC 49030] gi|294971309|gb|EFG47196.1| short-chain fatty acid transporter [Brevibacterium mcbrellneri ATCC 49030] Length = 289 Score = 35.3 bits (81), Expect = 3.2, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Query: 17 IIDFLNPSVEFKF--PTPLGIKPRLGDILEEHIDDK 50 I+ FL F F P P I P GDI E D K Sbjct: 41 IVGFLGIYAGFAFMAPKPNEIIPLNGDIAEPPADPK 76 >gi|16331413|ref|NP_442141.1| cytosine-specific methyltransferase [Synechocystis sp. PCC 6803] gi|1001584|dbj|BAA10211.1| cytosine-specific methyltransferase [Synechocystis sp. PCC 6803] Length = 424 Score = 35.3 bits (81), Expect = 3.2, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52 + A +G PQ+R+RL I+ +P PL + ++ + + +KS Sbjct: 157 LDASLYGAPQKRKRLIILGSRKDVKPVTYPLPLYF--DVAELKQSNCSEKSV 206 >gi|306829494|ref|ZP_07462684.1| DNA (cytosine-5-)-methyltransferase [Streptococcus mitis ATCC 6249] gi|304428580|gb|EFM31670.1| DNA (cytosine-5-)-methyltransferase [Streptococcus mitis ATCC 6249] Length = 389 Score = 35.3 bits (81), Expect = 3.2, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 7/57 (12%) Query: 1 MKACDFGVPQRRER-LYIIDFLNPSVEFKFPTPLGIKPRLGDI------LEEHIDDK 50 + D+G+PQ R+R +Y++ + V+++FP L D L+ I +K Sbjct: 164 VNTMDYGIPQSRQRYIYLMTLKSEGVKWEFPPKEEKIITLQDAIGSLPSLDPQIREK 220 >gi|270307689|ref|YP_003329747.1| DNA-cytosine methyltransferase [Dehalococcoides sp. VS] gi|270153581|gb|ACZ61419.1| DNA-cytosine methyltransferase [Dehalococcoides sp. VS] Length = 365 Score = 35.3 bits (81), Expect = 3.2, Method: Composition-based stats. Identities = 11/18 (61%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Query: 1 MKACDFGVPQRRER-LYI 17 + A ++GVPQRRER +YI Sbjct: 167 LDAGNYGVPQRRERLIYI 184 >gi|269123998|ref|YP_003306575.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM 12112] gi|268315324|gb|ACZ01698.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM 12112] Length = 438 Score = 35.3 bits (81), Expect = 3.3, Method: Composition-based stats. Identities = 10/46 (21%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH 46 + + +FG+ Q R+R+YI+ + + + DI E++ Sbjct: 164 LDSIEFGLAQSRKRIYIVGTKDKLISLE--NFDKKYSSFRDIQEKN 207 >gi|57505223|ref|ZP_00371152.1| cytosine specific DNA methyltransferase (BSP6IM) [Campylobacter upsaliensis RM3195] gi|57016359|gb|EAL53144.1| cytosine specific DNA methyltransferase (BSP6IM) [Campylobacter upsaliensis RM3195] Length = 326 Score = 35.3 bits (81), Expect = 3.3, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEH 46 + + DF + Q RER+Y I F F + L D L Sbjct: 145 LNSLDFELAQSRERVYFIGIKEDKKCYFNF-SKNASHKDLKDFLNPD 190 >gi|289608986|emb|CBI60514.1| unnamed protein product [Sordaria macrospora] Length = 249 Score = 34.9 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 ++A D+GVPQ R R+ I FP P K Sbjct: 41 LRAEDYGVPQERRRVVFIA-NRVGAPILFPEPTHGK 75 >gi|317506240|ref|ZP_07964059.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC BAA-974] gi|316255486|gb|EFV14737.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC BAA-974] Length = 347 Score = 34.9 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 16/30 (53%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFP 30 + A FGVPQ R+R +I VE +P Sbjct: 149 LDASYFGVPQSRKRAVLIASRLGKVELPWP 178 >gi|145604116|ref|XP_360423.2| hypothetical protein [Magnaporthe oryzae 70-15] gi|145012186|gb|EDJ96842.1| predicted protein [Magnaporthe oryzae 70-15] Length = 326 Score = 34.9 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 20/99 (20%), Positives = 33/99 (33%), Gaps = 16/99 (16%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62 A FG+PQRRE + ++ + P P +P E D + + L + Sbjct: 81 AGSFGLPQRREHIIVLAVRKDLI----PGPFSPRPA-----ERDPDQTLELKDFLLSY-E 130 Query: 63 KRKENNKIA--GKGFGYGLFFE----NSATTNTLSARYY 95 + NK G + N + +R Y Sbjct: 131 EYLRLNKDRYWPNGMVPQMVDGVLCLNEDEVRPIGSRIY 169 >gi|329122250|ref|ZP_08250838.1| DNA (cytosine-5-)-methyltransferase [Haemophilus aegyptius ATCC 11116] gi|327473811|gb|EGF19228.1| DNA (cytosine-5-)-methyltransferase [Haemophilus aegyptius ATCC 11116] Length = 387 Score = 34.9 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FG+ QRR+R++++ Sbjct: 173 LNAQYFGLAQRRKRVFLVA 191 >gi|319428134|gb|ADV56208.1| DNA-cytosine methyltransferase [Shewanella putrefaciens 200] Length = 305 Score = 34.9 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS-VEFKFPT 31 + A VPQ RERL+I+ + + +E K PT Sbjct: 144 INAKTLQVPQSRERLFIVATRSQNPIELKLPT 175 >gi|325997344|gb|ADZ49552.1| Type II DNA modification enzyme [Helicobacter pylori 2017] Length = 159 Score = 34.9 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 9/15 (60%), Positives = 12/15 (80%) Query: 1 MKACDFGVPQRRERL 15 + A D+GVPQ RER+ Sbjct: 145 LNALDYGVPQVRERV 159 >gi|257882475|ref|ZP_05662128.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium 1,231,502] gi|294620467|ref|ZP_06699776.1| methyl transferase [Enterococcus faecium E1679] gi|294623872|ref|ZP_06702700.1| methyl transferase [Enterococcus faecium U0317] gi|257818133|gb|EEV45461.1| C-5 cytosine-specific DNA methylase [Enterococcus faecium 1,231,502] gi|291593380|gb|EFF24945.1| methyl transferase [Enterococcus faecium E1679] gi|291596826|gb|EFF28049.1| methyl transferase [Enterococcus faecium U0317] Length = 380 Score = 34.9 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Query: 1 MKACDFGVPQRRERLYIID 19 + + + VPQ RER+++I Sbjct: 147 LNSKAY-VPQSRERIFLIG 164 >gi|320109274|ref|YP_004184864.1| DNA-cytosine methyltransferase [Terriglobus saanensis SP1PR4] gi|319927795|gb|ADV84870.1| DNA-cytosine methyltransferase [Terriglobus saanensis SP1PR4] Length = 409 Score = 34.9 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Query: 2 KACDFGVPQRRER-LYI 17 +FGVPQ RER ++I Sbjct: 179 NTANFGVPQSRERLIFI 195 >gi|290999391|ref|XP_002682263.1| cytosine-5 DNA methyltransferase [Naegleria gruberi] gi|284095890|gb|EFC49519.1| cytosine-5 DNA methyltransferase [Naegleria gruberi] Length = 1527 Score = 34.9 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF--KFPTPLGIKPRLGDILEEHIDDK 50 + A FG+PQ R R+ FP ++ +L+ K Sbjct: 1115 VNAQHFGLPQTRTRVIFFGARKDENLKVPDFPKNTHASHKVSAVLDNASQVK 1166 >gi|115525257|ref|YP_782168.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris BisA53] gi|115519204|gb|ABJ07188.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris BisA53] Length = 589 Score = 34.9 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 +KA ++GVPQ R R++I+ Sbjct: 309 VKAEEYGVPQARHRMFIVGIRED 331 >gi|22256926|sp|O33481|MTP1_PSYTA RecName: Full=Modification methylase PspPI; Short=M.PspPI; AltName: Full=Cytosine-specific methyltransferase PspPI gi|2558610|emb|CAA68841.1| type II DNA m5C-methyltransferase [Psychrobacter sp.] Length = 416 Score = 34.9 bits (80), Expect = 3.6, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDIL 43 KA + VPQ+RERL II + ++ P+P + D L Sbjct: 222 KAIFYKVPQKRERLIIIGVRTDLYDKLAYEKPSPYYKVLTVADAL 266 >gi|123965753|ref|YP_001010834.1| putative carboxypeptidase [Prochlorococcus marinus str. MIT 9515] gi|123200119|gb|ABM71727.1| Putative carboxypeptidase [Prochlorococcus marinus str. MIT 9515] Length = 290 Score = 34.9 bits (80), Expect = 3.6, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 7/60 (11%) Query: 17 IIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFG 76 I+ FL + F P G DI E D I +++ + K+ N+IAG GFG Sbjct: 171 IVSFLIGTNHF--PELKGKIIIFEDINE----DIYKI-DRMLTYLRMTKKLNEIAGIGFG 223 >gi|301165798|emb|CBW25370.1| conserved hypothetical exported protein [Bacteriovorax marinus SJ] Length = 940 Score = 34.9 bits (80), Expect = 3.7, Method: Composition-based stats. Identities = 24/73 (32%), Positives = 27/73 (36%), Gaps = 19/73 (26%) Query: 30 PTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNT 89 PT K GD+ DK I W AG GFG L +N T Sbjct: 593 PTKHYEKHEYGDL------DKGVIVPHSWSFF---------AGNGFGLSLTTDN--YLRT 635 Query: 90 LS--ARYYKDGSE 100 L A+ KDGSE Sbjct: 636 LGIFAQVGKDGSE 648 >gi|294155594|ref|YP_003559978.1| cytosine-specific DNA modification methyltransferase [Mycoplasma crocodyli MP145] gi|291600134|gb|ADE19630.1| cytosine-specific DNA modification methyltransferase [Mycoplasma crocodyli MP145] Length = 388 Score = 34.9 bits (80), Expect = 3.7, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 10/63 (15%) Query: 8 VPQRRERLYIID-FLNPSVEFKFP-----TPLGIKPRLGDILEEH-IDDKSTIS---NKL 57 +PQ RER++II + +++ + DI++++ ++DK IS +KL Sbjct: 155 IPQLRERVFIIGKYDLDNIDKDLIINNSTYSKKNDNSIYDIIDKNKVEDKYYISKAEDKL 214 Query: 58 WEG 60 E Sbjct: 215 LET 217 >gi|78778049|ref|YP_394364.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM 1251] gi|78498589|gb|ABB45129.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM 1251] Length = 435 Score = 34.9 bits (80), Expect = 3.7, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 18/24 (75%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS 24 + A D+G+PQRR R++I+ + N + Sbjct: 187 INASDYGMPQRRRRVFIMAYKNGT 210 >gi|302187943|ref|ZP_07264616.1| C-5 cytosine-specific DNA methylase family protein [Pseudomonas syringae pv. syringae 642] Length = 307 Score = 34.9 bits (80), Expect = 3.8, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 4 CDFGVPQRRERLYIID 19 D GVPQ R RL+++ Sbjct: 147 ADLGVPQHRVRLFLVC 162 >gi|28869583|ref|NP_792202.1| C-5 cytosine-specific DNA methylase family protein [Pseudomonas syringae pv. tomato str. DC3000] gi|28852825|gb|AAO55897.1| C-5 cytosine-specific DNA methylase family protein [Pseudomonas syringae pv. tomato str. DC3000] Length = 295 Score = 34.9 bits (80), Expect = 3.8, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 4 CDFGVPQRRERLYIID 19 D GVPQ R RL+++ Sbjct: 147 ADLGVPQHRVRLFLVC 162 >gi|186476672|ref|YP_001858142.1| C-5 cytosine-specific DNA methylase [Burkholderia phymatum STM815] gi|184193131|gb|ACC71096.1| C-5 cytosine-specific DNA methylase [Burkholderia phymatum STM815] Length = 535 Score = 34.9 bits (80), Expect = 3.8, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 ++ACDFG P R+RL+++ + +PTP P+ Sbjct: 173 LRACDFGAPTIRKRLFLVA-RRDHLPIVWPTPTHGDPK 209 >gi|329937997|ref|ZP_08287479.1| putative 5-methylcytosine methyltransferase [Streptomyces griseoaurantiacus M045] gi|329302954|gb|EGG46843.1| putative 5-methylcytosine methyltransferase [Streptomyces griseoaurantiacus M045] Length = 312 Score = 34.9 bits (80), Expect = 4.0, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Query: 1 MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP-RLGDILEEHIDDK 50 + A FGVPQ R++ ++ + + ++ P P +P +G LE + + Sbjct: 130 VNAVAFGVPQNRKQGVLVAVERSCAGAYRPPAPTVTRPQTVGAALEASMAAR 181 >gi|167841732|ref|ZP_02468416.1| putative cytosine-specific modification methylase [Burkholderia thailandensis MSMB43] Length = 587 Score = 34.9 bits (80), Expect = 4.0, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 ++ACD+G P R+RL+++ + +P P P+ Sbjct: 208 LRACDYGAPTIRKRLFVVG-RRDHLPIVWPAPTHGDPK 244 >gi|331085772|ref|ZP_08334855.1| hypothetical protein HMPREF0987_01158 [Lachnospiraceae bacterium 9_1_43BFAA] gi|330406695|gb|EGG86200.1| hypothetical protein HMPREF0987_01158 [Lachnospiraceae bacterium 9_1_43BFAA] Length = 411 Score = 34.9 bits (80), Expect = 4.0, Method: Composition-based stats. Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 5 DFGVPQRRERLYIIDFLN 22 +FGVPQ R+R+ I Sbjct: 192 EFGVPQNRKRIIIFGVSK 209 >gi|261363795|ref|ZP_05976678.1| C-5 cytosine-specific DNA methylase family protein [Neisseria mucosa ATCC 25996] gi|288568375|gb|EFC89935.1| C-5 cytosine-specific DNA methylase family protein [Neisseria mucosa ATCC 25996] Length = 530 Score = 34.9 bits (80), Expect = 4.0, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36 + A D+G P RERL+++ + +P P + Sbjct: 200 LCAADYGAPTTRERLFMVA-RRDGLPIVWPEPTHFR 234 >gi|17228429|ref|NP_484977.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120] gi|17130280|dbj|BAB72891.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120] Length = 477 Score = 34.9 bits (80), Expect = 4.0, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 ++GVPQ RER+ +I K P +GD Sbjct: 244 NTANYGVPQIRERVVMICHRGKD---KVPYLCPTHSEMGDF 281 >gi|318057151|ref|ZP_07975874.1| DNA-cytosine methyltransferase [Streptomyces sp. SA3_actG] gi|318076183|ref|ZP_07983515.1| DNA-cytosine methyltransferase [Streptomyces sp. SA3_actF] Length = 386 Score = 34.9 bits (80), Expect = 4.1, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRER-LYIIDFLNPSVEFKFPTPLGIK 36 + A D+GVPQ R R + I + + P P + Sbjct: 155 LNAADYGVPQARRRAIVIATRRDLGEPLRHPIPTHRR 191 >gi|119509253|ref|ZP_01628403.1| DNA-cytosine methyltransferase family protein [Nodularia spumigena CCY9414] gi|119466095|gb|EAW46982.1| DNA-cytosine methyltransferase family protein [Nodularia spumigena CCY9414] Length = 418 Score = 34.9 bits (80), Expect = 4.1, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31 M A + +PQ R RL++ + +F FP Sbjct: 238 MNAASYSIPQNRNRLFVFG-HRTANQFVFPE 267 >gi|297194175|ref|ZP_06911573.1| DNA-cytosine methyltransferase [Streptomyces pristinaespiralis ATCC 25486] gi|297152146|gb|EFH31551.1| DNA-cytosine methyltransferase [Streptomyces pristinaespiralis ATCC 25486] Length = 328 Score = 34.9 bits (80), Expect = 4.1, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL 33 + A DFGVPQ R++ ++ F P P Sbjct: 150 LNAADFGVPQDRKQGILVALKKEWFHAFTPPVPT 183 >gi|228918462|ref|ZP_04081908.1| Modification methylase Sau3AI [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|228949261|ref|ZP_04111525.1| Modification methylase Sau3AI [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228810387|gb|EEM56744.1| Modification methylase Sau3AI [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228841185|gb|EEM86381.1| Modification methylase Sau3AI [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] Length = 413 Score = 34.9 bits (80), Expect = 4.1, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 25/70 (35%), Gaps = 10/70 (14%) Query: 31 TPLGIKPRLGDILEEHIDDKSTISNKLW---EGHQKRKENNKIAGKGFGY-----GLFFE 82 L ILE+++DDK +S E + K+ + A G Y G+ F Sbjct: 257 AIEESPIPLRSILEKNVDDKYYLSEMAIEKFEYLKGPKKIERTAASGHKYIFSEGGMAFP 316 Query: 83 N--SATTNTL 90 T+ Sbjct: 317 ELLDKPGRTI 326 >gi|189233760|ref|XP_001814230.1| PREDICTED: similar to DNA (cytosine-5-)-methyltransferase [Tribolium castaneum] Length = 1187 Score = 34.9 bits (80), Expect = 4.1, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 28/70 (40%), Gaps = 8/70 (11%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL---GDILEEHIDD-KSTISNKLW 58 A +FGVPQ R R +I + ++ P + G L+ ++D K T + W Sbjct: 891 AGEFGVPQARRRFILIA---SAPGYQLPRIPEPQHVFLQRGSRLDIYVDGVKYT-NGNFW 946 Query: 59 EGHQKRKENN 68 + + Sbjct: 947 TQSAPYRMLH 956 >gi|299769738|ref|YP_003731764.1| C-5 cytosine-specific DNA methylase [Acinetobacter sp. DR1] gi|298699826|gb|ADI90391.1| C-5 cytosine-specific DNA methylase [Acinetobacter sp. DR1] Length = 492 Score = 34.9 bits (80), Expect = 4.2, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 MKACD+G P R R +++ ++ ++P P P+ Sbjct: 171 MKACDYGSPTIRRRFFMVA-RRDNLAIEWPKPTHADPK 207 >gi|270015149|gb|EFA11597.1| DNA methyltransferase 1 [Tribolium castaneum] Length = 1882 Score = 34.5 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 28/70 (40%), Gaps = 8/70 (11%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL---GDILEEHIDD-KSTISNKLW 58 A +FGVPQ R R +I + ++ P + G L+ ++D K T + W Sbjct: 909 AGEFGVPQARRRFILIA---SAPGYQLPRIPEPQHVFLQRGSRLDIYVDGVKYT-NGNFW 964 Query: 59 EGHQKRKENN 68 + + Sbjct: 965 TQSAPYRMLH 974 >gi|227431295|ref|ZP_03913348.1| DNA (cytosine-5-)-methyltransferase [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] gi|227352888|gb|EEJ43061.1| DNA (cytosine-5-)-methyltransferase [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] Length = 353 Score = 34.5 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 18/81 (22%), Positives = 34/81 (41%), Gaps = 13/81 (16%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP---LGIKPRLGDILEEHIDDKSTISNKL 57 + A D+GV Q R R II ++++ +P + ++ +GD+ +KS+I Sbjct: 163 LNAKDYGVGQSRPR-AIIKLYKKNIKWPWPKQEKEISLQESIGDLPSLQPGEKSSIK--- 218 Query: 58 WEGHQK------RKENNKIAG 72 W +K + G Sbjct: 219 WHYAKKCRPQIEEALKHTATG 239 >gi|119513855|ref|ZP_01632813.1| DNA methylase, C-5 cytosine-specific family protein [Nodularia spumigena CCY9414] gi|119461493|gb|EAW42572.1| DNA methylase, C-5 cytosine-specific family protein [Nodularia spumigena CCY9414] Length = 318 Score = 34.5 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 6/42 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 + A +G+PQ R R + + L+ S+ F P P GDI Sbjct: 155 LNAAHYGIPQTRSRAFFLASLDNSLHF--PEPTN----FGDI 190 >gi|168070728|ref|XP_001786917.1| predicted protein [Physcomitrella patens subsp. patens] gi|162660176|gb|EDQ48269.1| predicted protein [Physcomitrella patens subsp. patens] Length = 290 Score = 34.5 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 1 MKACDFGVPQRRER 14 + A DFGVPQ R R Sbjct: 277 INAMDFGVPQNRNR 290 >gi|333024773|ref|ZP_08452837.1| putative DNA-cytosine methyltransferase [Streptomyces sp. Tu6071] gi|332744625|gb|EGJ75066.1| putative DNA-cytosine methyltransferase [Streptomyces sp. Tu6071] Length = 386 Score = 34.5 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRER-LYIIDFLNPSVEFKFPTPLGIK 36 + A D+GVPQ R R + I + + P P + Sbjct: 155 LNAADYGVPQARRRAIVIATRRDLGEPLRHPIPSHRR 191 >gi|332878260|ref|ZP_08445986.1| DNA (cytosine-5-)-methyltransferase [Capnocytophaga sp. oral taxon 329 str. F0087] gi|332683711|gb|EGJ56582.1| DNA (cytosine-5-)-methyltransferase [Capnocytophaga sp. oral taxon 329 str. F0087] Length = 424 Score = 34.5 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 25/57 (43%), Gaps = 12/57 (21%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 A ++GV Q R+R+ I+ + S +K+P L + ++ + + + Sbjct: 201 ASEYGVLQNRQRVIIVGWKKGSP-YKYPY-----------LTKEVNKYEVLKDLFID 245 >gi|331082114|ref|ZP_08331242.1| hypothetical protein HMPREF0992_00166 [Lachnospiraceae bacterium 6_1_63FAA] gi|330405709|gb|EGG85239.1| hypothetical protein HMPREF0992_00166 [Lachnospiraceae bacterium 6_1_63FAA] Length = 523 Score = 34.5 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35 + + F VPQ RER+Y I L K G Sbjct: 174 INSKWF-VPQNRERIYTIGHLRRYGSRKILPVTGT 207 >gi|313142342|ref|ZP_07804535.1| LOW QUALITY PROTEIN: cytosine specific DNA methyltransferase [Helicobacter canadensis MIT 98-5491] gi|313131373|gb|EFR48990.1| LOW QUALITY PROTEIN: cytosine specific DNA methyltransferase [Helicobacter canadensis MIT 98-5491] Length = 232 Score = 34.5 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLN---PSVEFKF 29 + DFG+ RER+Y + N + +F F Sbjct: 56 LNTIDFGLAHSRERVYFVGIHNIMDKNFDFMF 87 >gi|213692399|ref|YP_002322985.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp. infantis ATCC 15697] gi|213523860|gb|ACJ52607.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp. infantis ATCC 15697] gi|320458540|dbj|BAJ69161.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 401 Score = 34.5 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 1 MKACDFGVPQRRERLYII 18 + A FGV QRRER++++ Sbjct: 148 LDAQFFGVAQRRERVFLV 165 >gi|154486240|ref|ZP_02027647.1| hypothetical protein BIFADO_00043 [Bifidobacterium adolescentis L2-32] gi|154084103|gb|EDN83148.1| hypothetical protein BIFADO_00043 [Bifidobacterium adolescentis L2-32] Length = 220 Score = 34.5 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 1 MKACDFGVPQRRERLYII 18 + A FGV QRRER++++ Sbjct: 2 LDAQFFGVAQRRERVFLV 19 >gi|328947445|ref|YP_004364782.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] gi|328447769|gb|AEB13485.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489] Length = 445 Score = 34.5 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Query: 1 MKACDFGVPQRRERLYIID----FLNPSVEFK 28 + A FG+PQ+R RLY++ F ++ F+ Sbjct: 175 LDAKYFGLPQQRRRLYVVAGGKDFSPENILFE 206 >gi|329940565|ref|ZP_08289846.1| restriction/modification system DNA methylase [Streptomyces griseoaurantiacus M045] gi|329300626|gb|EGG44523.1| restriction/modification system DNA methylase [Streptomyces griseoaurantiacus M045] Length = 350 Score = 34.5 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 1 MKACDFGVPQRRER 14 + A DFGVPQ R R Sbjct: 93 LNAADFGVPQTRRR 106 >gi|290957787|ref|YP_003488969.1| restriction/modification system DNA methylase [Streptomyces scabiei 87.22] gi|260647313|emb|CBG70418.1| putative restriction/modification system DNA methylase [Streptomyces scabiei 87.22] Length = 424 Score = 34.5 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 1 MKACDFGVPQRRER 14 + A DFGVPQ R R Sbjct: 167 LNAADFGVPQTRRR 180 >gi|53728781|ref|ZP_00135132.2| COG0270: Site-specific DNA methylase [Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length = 354 Score = 34.5 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGV QRR+R++++ Sbjct: 173 INAQYFGVAQRRKRVFLVA 191 >gi|217966224|ref|YP_002351902.1| hypothetical protein LMHCC_2957 [Listeria monocytogenes HCC23] gi|217335494|gb|ACK41288.1| hypothetical protein LMHCC_2957 [Listeria monocytogenes HCC23] Length = 192 Score = 34.5 bits (79), Expect = 4.9, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 15/25 (60%) Query: 39 LGDILEEHIDDKSTISNKLWEGHQK 63 L DILEE +D+K +S K E K Sbjct: 138 LSDILEEQVDEKYFLSQKHLERLMK 162 >gi|89055380|ref|YP_510831.1| DNA-cytosine methyltransferase [Jannaschia sp. CCS1] gi|88864929|gb|ABD55806.1| DNA-cytosine methyltransferase [Jannaschia sp. CCS1] Length = 373 Score = 34.5 bits (79), Expect = 4.9, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 ++A D+GVPQ R R+ I Sbjct: 153 LRAEDYGVPQERRRVVFIG 171 >gi|212633712|ref|YP_002310237.1| site-specific DNA-methyltransferase [Shewanella piezotolerans WP3] gi|212555196|gb|ACJ27650.1| Site-specific DNA-methyltransferase [Shewanella piezotolerans WP3] Length = 475 Score = 34.5 bits (79), Expect = 4.9, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41 + +FG PQ RER+ II + K P + G Sbjct: 245 NSANFGTPQIRERVIIICSRD---GVKPPYLVPTHSEFGS 281 >gi|169544173|ref|YP_001692948.1| methylase [Yersinia enterocolitica] gi|168218357|emb|CAP20100.1| methylase [Yersinia enterocolitica] Length = 481 Score = 34.5 bits (79), Expect = 4.9, Method: Composition-based stats. Identities = 22/109 (20%), Positives = 40/109 (36%), Gaps = 21/109 (19%) Query: 1 MKACDFGVPQRRERLYIID----------FLNPSVEFKFPTPLGIKPRLGDILEEHIDDK 50 + + D+G + R+R+ +I + + + F L DI E DD Sbjct: 298 IDSRDYGSIEERKRMLVIGVSVGLTNVVSYFDDEIAF---YKKECIQTLNDIFEPIADDH 354 Query: 51 STISNKLWE---GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 W+ ++ + AGKGF L ++ T+ Y+K Sbjct: 355 -----TAWKEYSYLADKEIRDLKAGKGFKRQLLTGDNNKCGTIGRGYHK 398 >gi|218905512|ref|YP_002453346.1| modification methylase ScrFIB [Bacillus cereus AH820] gi|218536933|gb|ACK89331.1| modification methylase ScrFIB [Bacillus cereus AH820] Length = 324 Score = 34.5 bits (79), Expect = 4.9, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLWE 59 + A FGVP RER++ I L F F R + + +E DDK S L Sbjct: 146 LDARKFGVPHARERVFCISLLGGKA-FDFNKLRFKPMRDIKEFMEYGPDDK-IPSQYLIN 203 >gi|83950654|ref|ZP_00959387.1| modification methylase (Cytosine-specific methyltransferase [Roseovarius nubinhibens ISM] gi|83838553|gb|EAP77849.1| modification methylase (Cytosine-specific methyltransferase [Roseovarius nubinhibens ISM] Length = 504 Score = 34.5 bits (79), Expect = 5.0, Method: Composition-based stats. Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 ++A D GVPQ R R+ ++ E Sbjct: 229 LRAEDHGVPQARHRVIVVGVRKDVAE 254 >gi|224437470|ref|ZP_03658432.1| site-specific DNA-methyltransferase [Helicobacter cinaedi CCUG 18818] Length = 418 Score = 34.5 bits (79), Expect = 5.0, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILE 44 + A +G +RERL I+ + +F +P P +G L+ Sbjct: 215 LNAAWYGAATKRERLIIVATRADLKGDFSYPLPRFYDESIGTKLD 259 >gi|304407248|ref|ZP_07388901.1| DNA-cytosine methyltransferase [Paenibacillus curdlanolyticus YK9] gi|304343689|gb|EFM09530.1| DNA-cytosine methyltransferase [Paenibacillus curdlanolyticus YK9] Length = 401 Score = 34.5 bits (79), Expect = 5.1, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 +KA +FGVPQ RER+ + Sbjct: 165 VKAVEFGVPQSRERVIFLGVRKD 187 >gi|293369629|ref|ZP_06616207.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f] gi|292635333|gb|EFF53847.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f] Length = 296 Score = 34.5 bits (79), Expect = 5.1, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Query: 8 VPQRRERLYIID--FLNPSVE-FKFPTPLGIKPRLGD 41 +PQ RER+Y++ + + F FP P G+ ++G Sbjct: 151 LPQNRERMYLVGRAAKKCTADIFPFPAPGGMYGKVGS 187 >gi|2894386|emb|CAA74996.1| Bpu10I (5m)cytosine-specific DNA modification methyltransferase (C1) [Bacillus pumilus] Length = 398 Score = 34.5 bits (79), Expect = 5.1, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF 27 + A DFG+PQ R R +++ L P + Sbjct: 157 INAADFGIPQERIRFFMVASLGPVPDL 183 >gi|304390603|ref|ZP_07372556.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii subsp. curtisii ATCC 35241] gi|304326359|gb|EFL93604.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii subsp. curtisii ATCC 35241] Length = 309 Score = 34.5 bits (79), Expect = 5.1, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 8/51 (15%) Query: 1 MKACDFGVPQRRERLYII-------DFLNPSVEFKF-PTPLGIKPRLGDIL 43 + A GVPQ R+R++++ FL+ +E P P+ I LGD L Sbjct: 148 LDAAYCGVPQSRKRMFVVGGQKEDDGFLDAELERALSPEPMSIFNYLGDSL 198 >gi|75812889|ref|YP_320506.1| C-5 cytosine-specific DNA methylase [Anabaena variabilis ATCC 29413] gi|75705645|gb|ABA25317.1| C-5 cytosine-specific DNA methylase [Anabaena variabilis ATCC 29413] Length = 415 Score = 34.5 bits (79), Expect = 5.1, Method: Composition-based stats. Identities = 10/45 (22%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 + A D+GVPQ R+R++ + P + + D + + Sbjct: 161 LTASDYGVPQARKRVFFVA---SKFGEIIPPEHQPQHTVRDAIAD 202 >gi|313143922|ref|ZP_07806115.1| cytosine specific DNA methyltransferase [Helicobacter cinaedi CCUG 18818] gi|313128953|gb|EFR46570.1| cytosine specific DNA methyltransferase [Helicobacter cinaedi CCUG 18818] Length = 294 Score = 34.5 bits (79), Expect = 5.2, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILE 44 + A +G +RERL I+ + +F +P P +G L+ Sbjct: 91 LNAAWYGAATKRERLIIVATRADLKGDFSYPLPRFYDESIGTKLD 135 >gi|57242036|ref|ZP_00369976.1| cytosine specific DNA methyltransferase (DDEM) [Campylobacter upsaliensis RM3195] gi|57017228|gb|EAL54009.1| cytosine specific DNA methyltransferase (DDEM) [Campylobacter upsaliensis RM3195] Length = 294 Score = 34.5 bits (79), Expect = 5.2, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILE 44 + A +G +RERL I+ + +F +P P +G L+ Sbjct: 91 LNAAWYGAATKRERLIIVATRADLKGDFSYPLPRFYDESIGTKLD 135 >gi|308275289|emb|CBX31885.1| hypothetical protein N47_O13040 [uncultured Desulfobacterium sp.] Length = 423 Score = 34.5 bits (79), Expect = 5.3, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP--RLGDILEE 45 + A D+GV Q+R+R+ + F FP P KP + +IL++ Sbjct: 202 ISANDYGVLQKRKRVILFGNREGKTGF-FPMPEEWKPGINVEEILKD 247 >gi|240142441|ref|YP_002966951.1| Site-specific DNA-methyltransferase [Methylobacterium extorquens AM1] gi|240012385|gb|ACS43610.1| Site-specific DNA-methyltransferase [Methylobacterium extorquens AM1] Length = 463 Score = 34.5 bits (79), Expect = 5.3, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 M A +GVPQ R+R +++ + VE FP P Sbjct: 168 MNAVHYGVPQMRDRAFLLAYRQDLGVEPVFPEPTRAH 204 >gi|325962428|ref|YP_004240334.1| DNA-methyltransferase Dcm [Arthrobacter phenanthrenivorans Sphe3] gi|323468515|gb|ADX72200.1| DNA-methyltransferase Dcm [Arthrobacter phenanthrenivorans Sphe3] Length = 454 Score = 34.5 bits (79), Expect = 5.3, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 11/23 (47%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A +G PQ R RL II Sbjct: 175 VNAVHYGAPQHRPRLLIIALRRD 197 >gi|239918514|ref|YP_002958072.1| DNA-methyltransferase Dcm [Micrococcus luteus NCTC 2665] gi|281415284|ref|ZP_06247026.1| DNA-methyltransferase Dcm [Micrococcus luteus NCTC 2665] gi|239839721|gb|ACS31518.1| DNA-methyltransferase Dcm [Micrococcus luteus NCTC 2665] Length = 315 Score = 34.5 bits (79), Expect = 5.4, Method: Composition-based stats. Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 1 MKACDFGVPQRRERLYIIDF 20 + + FGVPQ R R++I Sbjct: 157 LDSRHFGVPQSRTRVFICGV 176 >gi|238786362|ref|ZP_04630295.1| Methylase [Yersinia bercovieri ATCC 43970] gi|238712733|gb|EEQ04812.1| Methylase [Yersinia bercovieri ATCC 43970] Length = 466 Score = 34.5 bits (79), Expect = 5.5, Method: Composition-based stats. Identities = 22/109 (20%), Positives = 40/109 (36%), Gaps = 21/109 (19%) Query: 1 MKACDFGVPQRRERLYIID----------FLNPSVEFKFPTPLGIKPRLGDILEEHIDDK 50 + + D+G + R+R+ +I + + + F L DI E DD Sbjct: 283 IDSRDYGSIEERKRMLVIGVSVGLTNVVSYFDDEIAF---YKKECIQTLNDIFEPIADDH 339 Query: 51 STISNKLWE---GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96 W+ ++ + AGKGF L ++ T+ Y+K Sbjct: 340 -----TAWKEYSYLADKEIRDLKAGKGFKRQLLTGDNNKCGTIGRGYHK 383 >gi|121712592|ref|XP_001273907.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] gi|119402060|gb|EAW12481.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 398 Score = 34.5 bits (79), Expect = 5.5, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 7/52 (13%) Query: 6 FGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57 FG +R+R+ ++ +F F L ++ R DIL D K T+ +K Sbjct: 45 FG---KRDRILLVG----EGDFSFARSLAVQYRCRDILATCYDSKETLWDKY 89 >gi|327356617|gb|EGE85474.1| C-5 cytosine methyltransferase DmtA [Ajellomyces dermatitidis ATCC 18188] Length = 661 Score = 34.5 bits (79), Expect = 5.5, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 18/37 (48%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 ++ D+GVPQ R+RL I+ FP P P Sbjct: 468 LRCQDYGVPQSRQRLVILASGPGEPLPPFPKPTHGPP 504 >gi|239614647|gb|EEQ91634.1| C-5 cytosine methyltransferase DmtA [Ajellomyces dermatitidis ER-3] Length = 661 Score = 34.5 bits (79), Expect = 5.5, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 18/37 (48%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 ++ D+GVPQ R+RL I+ FP P P Sbjct: 468 LRCQDYGVPQSRQRLVILASGPGEPLPPFPKPTHGPP 504 >gi|261196301|ref|XP_002624554.1| C-5 cytosine methyltransferase DmtA [Ajellomyces dermatitidis SLH14081] gi|239587687|gb|EEQ70330.1| C-5 cytosine methyltransferase DmtA [Ajellomyces dermatitidis SLH14081] Length = 661 Score = 34.5 bits (79), Expect = 5.5, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 18/37 (48%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 ++ D+GVPQ R+RL I+ FP P P Sbjct: 468 LRCQDYGVPQSRQRLVILASGPGEPLPPFPKPTHGPP 504 >gi|167763801|ref|ZP_02435928.1| hypothetical protein BACSTE_02181 [Bacteroides stercoris ATCC 43183] gi|167697917|gb|EDS14496.1| hypothetical protein BACSTE_02181 [Bacteroides stercoris ATCC 43183] Length = 357 Score = 34.5 bits (79), Expect = 5.6, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A GVPQ+RER++ I + Sbjct: 181 LDASKMGVPQKRERVFFICIRHD 203 >gi|330830237|ref|YP_004393189.1| Modification methylase [Aeromonas veronii B565] gi|328805373|gb|AEB50572.1| Modification methylase [Aeromonas veronii B565] Length = 433 Score = 34.5 bits (79), Expect = 5.6, Method: Composition-based stats. Identities = 8/37 (21%), Positives = 20/37 (54%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 +K+ ++G+PQ R R+ ++ + + + P +P Sbjct: 151 IKSEEYGIPQARHRVILLGIRDDRILTELPKLSQEEP 187 >gi|296814510|ref|XP_002847592.1| site-specific DNA-methyltransferase HphI [Arthroderma otae CBS 113480] gi|238840617|gb|EEQ30279.1| site-specific DNA-methyltransferase HphI [Arthroderma otae CBS 113480] Length = 586 Score = 34.5 bits (79), Expect = 5.6, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + D+GVPQ R+RL II Sbjct: 425 VNCKDYGVPQSRKRLVIIA 443 >gi|330997448|ref|ZP_08321299.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT 11841] gi|329570822|gb|EGG52538.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT 11841] Length = 417 Score = 34.1 bits (78), Expect = 5.8, Method: Composition-based stats. Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 4 CDFGVPQRRERLYIID 19 D+G+PQ R+R+ I+ Sbjct: 190 ADYGIPQHRKRVIILG 205 >gi|237720893|ref|ZP_04551374.1| DNA-cytosine methyltransferase [Bacteroides sp. 2_2_4] gi|229449728|gb|EEO55519.1| DNA-cytosine methyltransferase [Bacteroides sp. 2_2_4] Length = 370 Score = 34.1 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A GVPQ+RER++ I + Sbjct: 194 LDASKMGVPQKRERVFFICIRHD 216 >gi|317051620|ref|YP_004112736.1| DNA-cytosine methyltransferase [Desulfurispirillum indicum S5] gi|316946704|gb|ADU66180.1| DNA-cytosine methyltransferase [Desulfurispirillum indicum S5] Length = 306 Score = 34.1 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Query: 4 CDFGVPQRRERLYIIDFLNPSV-EFKFPTP 32 D GVPQ R RL+++ + KFP+ Sbjct: 146 ADLGVPQNRIRLFLVCTRSRVPLHLKFPSK 175 >gi|242217704|ref|XP_002474649.1| predicted protein [Postia placenta Mad-698-R] gi|220726179|gb|EED80137.1| predicted protein [Postia placenta Mad-698-R] Length = 1157 Score = 34.1 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK 50 ++A +G PQ R R ++I + FP P P L D L+ +K Sbjct: 867 LQAAHYGTPQSRIRFFLIAARSGHPLPAFPQPTHDFP-LKDSLKLEFTNK 915 >gi|331090172|ref|ZP_08339060.1| hypothetical protein HMPREF1025_02643 [Lachnospiraceae bacterium 3_1_46FAA] gi|330402118|gb|EGG81690.1| hypothetical protein HMPREF1025_02643 [Lachnospiraceae bacterium 3_1_46FAA] Length = 681 Score = 34.1 bits (78), Expect = 6.1, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 14/18 (77%) Query: 2 KACDFGVPQRRERLYIID 19 A +GVPQRR+R+Y++ Sbjct: 177 DAQYWGVPQRRKRIYLVA 194 >gi|284046510|ref|YP_003396850.1| DNA-cytosine methyltransferase [Conexibacter woesei DSM 14684] gi|283950731|gb|ADB53475.1| DNA-cytosine methyltransferase [Conexibacter woesei DSM 14684] Length = 424 Score = 34.1 bits (78), Expect = 6.2, Method: Composition-based stats. Identities = 11/23 (47%), Positives = 12/23 (52%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A DFG PQRR RL I Sbjct: 158 LDAGDFGTPQRRPRLVFIGVRTD 180 >gi|294637303|ref|ZP_06715601.1| DNA (cytosine-5-)-methyltransferase [Edwardsiella tarda ATCC 23685] gi|291089511|gb|EFE22072.1| DNA (cytosine-5-)-methyltransferase [Edwardsiella tarda ATCC 23685] Length = 722 Score = 34.1 bits (78), Expect = 6.3, Method: Composition-based stats. Identities = 12/46 (26%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Query: 1 MKACDFGVPQRRERLYII-----DFLNPSVEFKFPTPLGIKPRLGD 41 + A FGV QRR+R++++ F +V F+ + P + Sbjct: 174 LDAQFFGVAQRRKRVFVVASARKGFDPTAVLFELESVRRDTPPSRE 219 >gi|238760580|ref|ZP_04621711.1| C-5 cytosine-specific DNA methylase [Yersinia aldovae ATCC 35236] gi|238701199|gb|EEP93785.1| C-5 cytosine-specific DNA methylase [Yersinia aldovae ATCC 35236] Length = 304 Score = 34.1 bits (78), Expect = 6.3, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Query: 4 CDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIK 36 D GVPQ R R++II + P + Sbjct: 146 ADLGVPQNRVRMFIICTRSKKPLHLTLPKFSHVP 179 >gi|307824939|ref|ZP_07655161.1| multi-sensor hybrid histidine kinase [Methylobacter tundripaludum SV96] gi|307733986|gb|EFO04841.1| multi-sensor hybrid histidine kinase [Methylobacter tundripaludum SV96] Length = 2035 Score = 34.1 bits (78), Expect = 6.4, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 7/54 (12%) Query: 14 RLYIIDFLNPSVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKE 66 R+ + + EF F + P L DI+ DD+ +++ + H +R Sbjct: 1166 RIIHVGNRKLAYEFGFTDEDIDTHPALADIIHP--DDR----DRIIDYHVRRMA 1213 >gi|218847945|ref|YP_002454784.1| type II DNA-methyltransferase, putative [Bacillus cereus G9842] gi|218546076|gb|ACK98469.1| type II DNA-methyltransferase, putative [Bacillus cereus G9842] Length = 463 Score = 34.1 bits (78), Expect = 6.5, Method: Composition-based stats. Identities = 22/104 (21%), Positives = 40/104 (38%), Gaps = 22/104 (21%) Query: 3 ACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLG--IKPRLGDILEEHIDDKSTISNKLW 58 A D+G RR R Y + F +F+FP+P +P+L L+ ++ W Sbjct: 263 AYDYGSIARRNRTYALAFRTKEAFLDFQFPSPPRTIKRPKLKVFLDGKD------TDHEW 316 Query: 59 EGHQKRKE--------NNKIAGKGFGYGLFFENSATTNTLSARY 94 + + K+ N+ K F ++ + +RY Sbjct: 317 KDFKAWKKSFESRDAFKNRSLEKSF----VTPDAKEIQCILSRY 356 >gi|254413040|ref|ZP_05026812.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] gi|196180204|gb|EDX75196.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus chthonoplastes PCC 7420] Length = 355 Score = 34.1 bits (78), Expect = 6.7, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 1 MKACDFGVPQRRERLYIIDFL-NPSVEFKF 29 + A + VPQ R+R+ I + + + FKF Sbjct: 151 LNARHYNVPQDRKRVIFIGYHIDLNKCFKF 180 >gi|157112484|ref|XP_001657555.1| DNA (cytosine-5)-methyltransferase [Aedes aegypti] gi|108878059|gb|EAT42284.1| DNA (cytosine-5)-methyltransferase [Aedes aegypti] Length = 344 Score = 34.1 bits (78), Expect = 6.7, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 9/63 (14%) Query: 5 DFGVPQRRERLYIID----FLNPSVE-FKFP--TPLGIKPRLGDILEEHIDD--KSTISN 55 DFGVP R R Y + F NPS E P +G R+ D++E + + + + Sbjct: 163 DFGVPNTRHRYYCVAKRTEFRNPSDEIVSKPTLQHVGTAKRICDLVEPESEKLNRYLLKD 222 Query: 56 KLW 58 L Sbjct: 223 DLL 225 >gi|251788110|ref|YP_003002831.1| DNA-cytosine methyltransferase [Dickeya zeae Ech1591] gi|247536731|gb|ACT05352.1| DNA-cytosine methyltransferase [Dickeya zeae Ech1591] Length = 490 Score = 34.1 bits (78), Expect = 6.8, Method: Composition-based stats. Identities = 8/26 (30%), Positives = 16/26 (61%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVE 26 + A FGV QRR+R++++ ++ Sbjct: 183 LDAQYFGVAQRRKRVFLVASGRDDID 208 >gi|237710586|ref|ZP_04541067.1| DNA-cytosine methyltransferase [Bacteroides sp. 9_1_42FAA] gi|229455308|gb|EEO61029.1| DNA-cytosine methyltransferase [Bacteroides sp. 9_1_42FAA] Length = 366 Score = 34.1 bits (78), Expect = 6.8, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A GVPQ+RER++ I + Sbjct: 192 LDASKMGVPQKRERVFFICIRHD 214 >gi|282880843|ref|ZP_06289537.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS 5C-B1] gi|281305284|gb|EFA97350.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS 5C-B1] Length = 374 Score = 34.1 bits (78), Expect = 6.9, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI-KPRLGDILEEHIDDKSTISN 55 KA ++GVPQ+R R+ I+ +F L + + L L+ + + TI + Sbjct: 177 KAEEYGVPQQRRRVIILG---TKFDFDLDRELKLMRESLPTELQSVFNRRETIRD 228 >gi|18976421|ref|NP_577778.1| cytosine-specific DNA-methyltransferase [Pyrococcus furiosus DSM 3638] gi|18891953|gb|AAL80173.1| site-specific DNA-methyltransferase (cytosine-specific) [Pyrococcus furiosus DSM 3638] Length = 301 Score = 34.1 bits (78), Expect = 6.9, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 13/17 (76%) Query: 1 MKACDFGVPQRRERLYI 17 + A D+GVPQ R R++I Sbjct: 146 LNALDYGVPQIRRRVFI 162 >gi|319654791|ref|ZP_08008867.1| hypothetical protein HMPREF1013_05489 [Bacillus sp. 2_A_57_CT2] gi|317393509|gb|EFV74271.1| hypothetical protein HMPREF1013_05489 [Bacillus sp. 2_A_57_CT2] Length = 325 Score = 34.1 bits (78), Expect = 6.9, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Query: 1 MKACDFGVPQRRERLYIIDFLNPS--VEFKFP-TPLGIKPRLGDILE 44 ++A DFG R+R Y + F + + F FP P + +L D L+ Sbjct: 126 LEAWDFGSLATRKRTYAVAFKDEKRFLSFDFPAAPKLRRKKLKDFLD 172 >gi|300775991|ref|ZP_07085850.1| possible DNA (cytosine-5-)-methyltransferase [Chryseobacterium gleum ATCC 35910] gi|300505124|gb|EFK36263.1| possible DNA (cytosine-5-)-methyltransferase [Chryseobacterium gleum ATCC 35910] Length = 415 Score = 34.1 bits (78), Expect = 6.9, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 5 DFGVPQRRERLYIIDFLNPSVE 26 D+GVPQ+R R +I N V Sbjct: 173 DYGVPQKRTRFILIGVRNDIVN 194 >gi|167630968|ref|YP_001681467.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1] gi|167593708|gb|ABZ85456.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1] Length = 667 Score = 34.1 bits (78), Expect = 7.0, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FGV QRR+R+Y++ Sbjct: 177 VDAQYFGVAQRRKRIYLVA 195 >gi|294155572|ref|YP_003559956.1| cytosine-specific DNA modification methyltransferase [Mycoplasma crocodyli MP145] gi|291599876|gb|ADE19372.1| cytosine-specific DNA modification methyltransferase [Mycoplasma crocodyli MP145] Length = 415 Score = 34.1 bits (78), Expect = 7.0, Method: Composition-based stats. Identities = 7/23 (30%), Positives = 15/23 (65%) Query: 1 MKACDFGVPQRRERLYIIDFLNP 23 + A D+ +PQ+R+R++I + Sbjct: 169 LNAGDYSMPQKRKRVFIFAYRKD 191 >gi|293570787|ref|ZP_06681836.1| cytosine-specific methyltransferase NlaX [Enterococcus faecium E980] gi|291609140|gb|EFF38413.1| cytosine-specific methyltransferase NlaX [Enterococcus faecium E980] Length = 310 Score = 34.1 bits (78), Expect = 7.2, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Query: 2 KACDFGVPQRRERLYIIDFLNPSVEFK-FP 30 + +F V Q RER++II L + K FP Sbjct: 99 NSKEF-VAQNRERVFIIGHLRGAGTKKIFP 127 >gi|295666203|ref|XP_002793652.1| C-5 cytosine methyltransferase DmtA [Paracoccidioides brasiliensis Pb01] gi|226277946|gb|EEH33512.1| C-5 cytosine methyltransferase DmtA [Paracoccidioides brasiliensis Pb01] Length = 653 Score = 34.1 bits (78), Expect = 7.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34 +K D+GVPQ R+RL I+ FP P Sbjct: 471 LKCQDYGVPQPRQRLVILGSGPGEPLPLFPKPTH 504 >gi|294664030|ref|ZP_06729438.1| DNA cytosine-5 -methyltransferase PliMCI [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] gi|292606199|gb|EFF49442.1| DNA cytosine-5 -methyltransferase PliMCI [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] Length = 349 Score = 34.1 bits (78), Expect = 7.3, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40 + D+GVPQ RER ++ P P K G Sbjct: 164 INGADYGVPQIRERCIVMGIKGRDP--SPPLPTHSKSPDG 201 >gi|229148238|ref|ZP_04276541.1| Phage-related DNA methylase [Bacillus cereus BDRD-ST24] gi|228635250|gb|EEK91777.1| Phage-related DNA methylase [Bacillus cereus BDRD-ST24] Length = 180 Score = 33.7 bits (77), Expect = 7.4, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 14/19 (73%) Query: 7 GVPQRRERLYIIDFLNPSV 25 GVPQRR+R++I +L S Sbjct: 156 GVPQRRKRIFIAGYLRGSG 174 >gi|291521423|emb|CBK79716.1| DNA-methyltransferase (dcm) [Coprococcus catus GD/7] Length = 521 Score = 33.7 bits (77), Expect = 7.6, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 26/57 (45%), Gaps = 8/57 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIK-----PRLGDILEEHIDD 49 + + FGVPQ R R +I + + E + P G + +GD+ + +D+ Sbjct: 310 INSLWFGVPQERRRFIMIGVRSDIIQEKEIEMPEGNGAEIVTVGQAIGDLRDYEVDE 366 >gi|309378924|emb|CBX22511.1| putative DNA cytosine methyltransferase [Neisseria lactamica Y92-1009] Length = 330 Score = 33.7 bits (77), Expect = 7.7, Method: Composition-based stats. Identities = 23/90 (25%), Positives = 33/90 (36%), Gaps = 13/90 (14%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD-KSTISNKL-W 58 + A GVPQ R R ++I L F + P L D L E + + N L Sbjct: 142 LDASYCGVPQARTRFFLIGKLGEEHNF-------LTPTLTDRLAEKPMTVRDYLGNSLNL 194 Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSATTN 88 E + + N G + + E S T Sbjct: 195 EHYYRHPRNYNRRGI---FSI-DEPSPTIR 220 >gi|294673411|ref|YP_003574027.1| C-5 cytosine-specific family DNA methylase [Prevotella ruminicola 23] gi|294473101|gb|ADE82490.1| DNA methylase, C-5 cytosine-specific family [Prevotella ruminicola 23] Length = 448 Score = 33.7 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 20/94 (21%), Positives = 33/94 (35%), Gaps = 21/94 (22%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKS-TISNKL-- 57 + A G PQRR+R +I L F + +ILE DK T+++ Sbjct: 142 LNASRCGAPQRRKRFIMIGHLGEEDGF-----------MSNILELRQSDKEMTVADYFGS 190 Query: 58 ---WEGHQKRKENNKIAGKGFGYGLFFENSATTN 88 + + + + G + E S T Sbjct: 191 QLDIQYYYRHPRSYARRGI---FS-VNEPSPTIR 220 >gi|299756527|ref|XP_001829400.2| hypothetical protein CC1G_00579 [Coprinopsis cinerea okayama7#130] gi|298411717|gb|EAU92360.2| hypothetical protein CC1G_00579 [Coprinopsis cinerea okayama7#130] Length = 1235 Score = 33.7 bits (77), Expect = 7.9, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 18/37 (48%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37 ++A +G PQ RER ++ L + + P P P Sbjct: 943 LQAGHYGTPQGRERFILVAALPGTQLPELPQPTHAFP 979 >gi|71361889|gb|AAZ30053.1| C5-cytosine methyltransferase [Halorubrum saccharovorum] Length = 408 Score = 33.7 bits (77), Expect = 7.9, Method: Composition-based stats. Identities = 9/37 (24%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 1 MKACDFGVPQRRER-LYIIDFLNPSVEFKFPTPLGIK 36 + A ++GVPQ+R R + + + + + P P + Sbjct: 194 VNAANYGVPQKRNRTIGMFVYGAEDSDIELPEPTHAE 230 >gi|325270514|ref|ZP_08137114.1| modification methylase HindV [Prevotella multiformis DSM 16608] gi|324987090|gb|EGC19073.1| modification methylase HindV [Prevotella multiformis DSM 16608] Length = 320 Score = 33.7 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF 27 + A GVPQRR+R +++ L + F Sbjct: 142 LNAALCGVPQRRKRFFMVGRLGAADGF 168 >gi|254252470|ref|ZP_04945788.1| Site-specific DNA methylase [Burkholderia dolosa AUO158] gi|124895079|gb|EAY68959.1| Site-specific DNA methylase [Burkholderia dolosa AUO158] Length = 669 Score = 33.7 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43 ++ACD+G P R+RL+II + +PTP P+ +L Sbjct: 208 LRACDYGAPTIRKRLFIIA-RRDGLPIVWPTPTHGDPKSAAVL 249 >gi|224539035|ref|ZP_03679574.1| hypothetical protein BACCELL_03935 [Bacteroides cellulosilyticus DSM 14838] gi|224519363|gb|EEF88468.1| hypothetical protein BACCELL_03935 [Bacteroides cellulosilyticus DSM 14838] Length = 345 Score = 33.7 bits (77), Expect = 8.5, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 1 MKACDFGVPQRRERLYIID 19 + ++GVPQ R+RL ++ Sbjct: 151 VNVKEYGVPQSRKRLVLVG 169 >gi|332711623|ref|ZP_08431554.1| DNA-methyltransferase [Lyngbya majuscula 3L] gi|332349601|gb|EGJ29210.1| DNA-methyltransferase [Lyngbya majuscula 3L] Length = 427 Score = 33.7 bits (77), Expect = 8.5, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL---EEHIDDKS 51 ++A V Q+RER+ II + FP L ++L + I K Sbjct: 224 LRAQFLDVAQKRERVIIIAVRKDLDLNAIFPKEKDYTISLREVLKDCPKSIGAKY 278 >gi|210630924|ref|ZP_03296669.1| hypothetical protein COLSTE_00554 [Collinsella stercoris DSM 13279] gi|210160239|gb|EEA91210.1| hypothetical protein COLSTE_00554 [Collinsella stercoris DSM 13279] Length = 931 Score = 33.7 bits (77), Expect = 8.7, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 13/17 (76%) Query: 1 MKACDFGVPQRRERLYI 17 + A D+G PQ+R R+YI Sbjct: 687 VNAADYGFPQKRRRVYI 703 >gi|222151724|ref|YP_002560880.1| type II modification methyltransferase [Macrococcus caseolyticus JCSC5402] gi|222120849|dbj|BAH18184.1| type II modification methyltransferase [Macrococcus caseolyticus JCSC5402] Length = 413 Score = 33.7 bits (77), Expect = 8.7, Method: Composition-based stats. Identities = 8/25 (32%), Positives = 14/25 (56%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV 25 + A D+G QRR R++I + + Sbjct: 162 INAADYGNAQRRRRVFIFGYRRETN 186 >gi|239625135|ref|ZP_04668166.1| EaeI methyltransferase alpha subunit [Clostridiales bacterium 1_7_47_FAA] gi|239519365|gb|EEQ59231.1| EaeI methyltransferase alpha subunit [Clostridiales bacterium 1_7_47FAA] Length = 301 Score = 33.7 bits (77), Expect = 8.8, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 1 MKACDFGVPQRRERLYIID 19 + A FG PQRR R YI+ Sbjct: 144 LDAKFFGTPQRRRRTYIVA 162 >gi|325857409|ref|ZP_08172464.1| DNA (cytosine-5-)-methyltransferase [Prevotella denticola CRIS 18C-A] gi|325483119|gb|EGC86099.1| DNA (cytosine-5-)-methyltransferase [Prevotella denticola CRIS 18C-A] Length = 320 Score = 33.7 bits (77), Expect = 9.0, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF 27 + A GVPQRR+R +++ L + F Sbjct: 142 LNAALCGVPQRRKRFFMVGRLGAADGF 168 >gi|300723947|ref|YP_003713260.1| hypothetical protein XNC1_3088 [Xenorhabdus nematophila ATCC 19061] gi|297630477|emb|CBJ91142.1| Dmt (fragment) [Xenorhabdus nematophila ATCC 19061] Length = 389 Score = 33.7 bits (77), Expect = 9.1, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Query: 1 MKACDFGVPQRRERLYIID-----FLNPSVEFKFPTPLGIKPR 38 + A FGV QRR R++++ F +V F+ P + P Sbjct: 189 LDAQYFGVAQRRRRVFVVASARKNFCPATVLFE-PDSVHRHPE 230 >gi|332664528|ref|YP_004447316.1| DNA-cytosine methyltransferase [Haliscomenobacter hydrossis DSM 1100] gi|332333342|gb|AEE50443.1| DNA-cytosine methyltransferase [Haliscomenobacter hydrossis DSM 1100] Length = 420 Score = 33.7 bits (77), Expect = 9.2, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR----LGDIL 43 A +FGV Q R+R+ I+ + S + P IK + + D+L Sbjct: 195 AINFGVLQNRKRIIILGW-QESAKLNIPDLEDIKIKGNYLVADLL 238 >gi|330818898|ref|YP_004351115.1| C-5 cytosine-specific DNA methylase [Burkholderia gladioli BSR3] gi|327374440|gb|AEA65792.1| C-5 cytosine-specific DNA methylase [Burkholderia gladioli BSR3] Length = 828 Score = 33.7 bits (77), Expect = 9.4, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38 ++ACD G P R+RL+I+ + +FP P Sbjct: 217 LRACDNGAPTIRKRLFIVG-RRDGLPVRFPEQEYGDPT 253 >gi|207111635|ref|ZP_03245797.1| cytosine specific DNA methyltransferase [Helicobacter pylori HPKX_438_CA4C1] Length = 42 Score = 33.7 bits (77), Expect = 9.4, Method: Composition-based stats. Identities = 7/12 (58%), Positives = 9/12 (75%) Query: 1 MKACDFGVPQRR 12 + A D+GVPQ R Sbjct: 31 LNAKDYGVPQNR 42 >gi|126433434|ref|YP_001069125.1| DNA-cytosine methyltransferase [Mycobacterium sp. JLS] gi|126233234|gb|ABN96634.1| DNA-cytosine methyltransferase [Mycobacterium sp. JLS] Length = 349 Score = 33.7 bits (77), Expect = 9.4, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42 + A D+GV QRR R +I + P P K D+ Sbjct: 130 LLAADYGVAQRRPRTIVIG--SRVGRVDLPPPTHSKTPTVDL 169 >gi|153932387|ref|YP_001385110.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. ATCC 19397] gi|153937602|ref|YP_001388579.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. Hall] gi|152928431|gb|ABS33931.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. ATCC 19397] gi|152933516|gb|ABS39015.1| DNA-cytosine methyltransferase family protein [Clostridium botulinum A str. Hall] Length = 350 Score = 33.3 bits (76), Expect = 9.7, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 6 FGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36 +G+PQ R R+ II EFK P+P K Sbjct: 160 YGIPQARHRVIIIGIRKDLPFEFKVPSPEPYK 191 >gi|53712640|ref|YP_098632.1| site-specific DNA-methyltransferase (cytosine-specific) [Bacteroides fragilis YCH46] gi|52215505|dbj|BAD48098.1| site-specific DNA-methyltransferase (cytosine-specific) [Bacteroides fragilis YCH46] Length = 296 Score = 33.3 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Query: 8 VPQRRERLYIID--FLNPSVE-FKFPTPLGIKPRLG 40 +PQ RER+Y++ + + F FP P G+ ++G Sbjct: 151 LPQNRERMYLVGRAAKKCTADIFPFPAPGGMYGKVG 186 >gi|119026251|ref|YP_910096.1| modification methylase Sau3AI [Bifidobacterium adolescentis ATCC 15703] gi|118765835|dbj|BAF40014.1| modification methylase Sau3AI [Bifidobacterium adolescentis ATCC 15703] Length = 424 Score = 33.3 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 10/17 (58%), Positives = 14/17 (82%) Query: 1 MKACDFGVPQRRERLYI 17 + A D+G+PQRR R+YI Sbjct: 180 VNAADYGMPQRRRRVYI 196 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.314 0.194 0.757 Lambda K H 0.267 0.0593 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,800,664,526 Number of Sequences: 14124377 Number of extensions: 136078889 Number of successful extensions: 266717 Number of sequences better than 10.0: 1920 Number of HSP's better than 10.0 without gapping: 1893 Number of HSP's successfully gapped in prelim test: 583 Number of HSP's that attempted gapping in prelim test: 263427 Number of HSP's gapped (non-prelim): 2574 length of query: 101 length of database: 4,842,793,630 effective HSP length: 70 effective length of query: 31 effective length of database: 3,854,087,240 effective search space: 119476704440 effective search space used: 119476704440 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (20.9 bits) S2: 77 (33.7 bits)