BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI
[Candidatus Liberibacter asiaticus str. psy62]
         (101 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254547855|gb|ACT56990.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 101

 Score =  211 bits (537), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG
Sbjct: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI
Sbjct: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101


>gi|319407456|emb|CBI81106.1| Cytosine-specific methyltransferase NlaX [Bartonella sp. 1-1C]
          Length = 307

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFGVPQ RER+YI+ FL+ S  FKFP+P+ IK R+GDIL+  +D+K TISN LW G
Sbjct: 147 LKARDFGVPQNRERIYIVGFLDHSTNFKFPSPMNIKTRVGDILDNDVDEKYTISNTLWHG 206

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  NK+ GKGFGYGLF   S  TNTLSARYYKDGSEI
Sbjct: 207 HQRRKAQNKLNGKGFGYGLFNMESPYTNTLSARYYKDGSEI 247


>gi|313667524|ref|YP_004047808.1| cytosine-specific methyltransferase [Neisseria lactamica ST-640]
 gi|309378245|emb|CBX23130.1| DNA cytosine methyltransferase M.NlaX [Neisseria lactamica
           Y92-1009]
 gi|313004986|emb|CBN86414.1| cytosine-specific methyltransferase [Neisseria lactamica 020-06]
          Length = 313

 Score =  144 bits (363), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFG+PQ RER+Y++ FLN  V+F+FP P+G    +GDILE + D+K TIS+KLW+G
Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  N+ AGKGFGYGLF   SA TNT+SARYYKDGSEI
Sbjct: 205 HQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245


>gi|127471|sp|P24581|MTNX_NEILA RecName: Full=Cytosine-specific methyltransferase NlaX;
           Short=M.NlaX
 gi|45004|emb|CAA38357.1| cytosine-specific methyltransferase of NlaIII [Neisseria lactamica]
          Length = 313

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFG+PQ RER+Y++ FLN  V+F+FP P+G    +GDILE + D+K TIS+KLW+G
Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +Q+RK  N+ AGKGFGYGLF   SA TNT+SARYYKDGSEI
Sbjct: 205 YQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245


>gi|261400948|ref|ZP_05987073.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
 gi|269209191|gb|EEZ75646.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
          Length = 313

 Score =  142 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFG+PQ RER+Y++ FLN  V+F+FP P+G    +GDILE + D+K TIS+KLW+G
Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +Q+RK  N+ AGKGFGYGLF   SA TNT+SARYYKDGSEI
Sbjct: 205 YQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245


>gi|315637499|ref|ZP_07892709.1| modification methylase EcoRII [Arcobacter butzleri JV22]
 gi|315478217|gb|EFU68940.1| modification methylase EcoRII [Arcobacter butzleri JV22]
          Length = 326

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ RER+YII FL+ S++FK+P PL  K RLGDIL++++DDK TIS+KLW G
Sbjct: 163 LNAKDFGVPQNRERIYIIAFLDHSIDFKYPKPLNKKNRLGDILDDNVDDKYTISDKLWAG 222

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK+ +K  G GFGY LF  NS  T+T+SARYYKDGSEI
Sbjct: 223 HQRRKKEHKEKGNGFGYSLFTHNSEYTSTISARYYKDGSEI 263


>gi|150026187|ref|YP_001297013.1| type II modification methyltransferase [Flavobacterium
           psychrophilum JIP02/86]
 gi|149772728|emb|CAL44211.1| Probable type II modification methyltransferase [Flavobacterium
           psychrophilum JIP02/86]
          Length = 335

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 83/101 (82%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA +FG+PQ RER+YI+ FL+ S++FKFPTP  +  ++GDILE+ +D+K TIS++LWEG
Sbjct: 152 LKAKEFGLPQNRERIYIVGFLDNSIKFKFPTPTKLPTKVGDILEQKVDEKYTISDRLWEG 211

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  NK  GKGFG+G+  ENS  TNT+SARYYKDGSEI
Sbjct: 212 HQRRKIANKEKGKGFGFGIVNENSEYTNTISARYYKDGSEI 252


>gi|119026301|ref|YP_910146.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC
           15703]
 gi|118765885|dbj|BAF40064.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC
           15703]
          Length = 383

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 66/105 (62%), Positives = 79/105 (75%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A DFGVPQ RER+YI+ F    V    +FK+P P  I  RLGDILE+++DDK TIS+ 
Sbjct: 214 LAAKDFGVPQNRERIYIVGFDKEQVPNWADFKYPEPPCIPTRLGDILEKNVDDKYTISDA 273

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW GHQ+RK+ NK AGKGFGYGLF E+S   NT+SARYYKDGSEI
Sbjct: 274 LWAGHQRRKQENKKAGKGFGYGLFDEDSPYANTISARYYKDGSEI 318


>gi|1657420|gb|AAC45971.1| DNA cytosine methyltransferase M.SenPI [Salmonella enterica subsp.
           enterica serovar Enteritidis]
          Length = 379

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317


>gi|32470131|ref|NP_863573.1| DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae]
 gi|462656|sp|P34879|MTS2_SHISO RecName: Full=Modification methylase SsoII; Short=M.SsoII; AltName:
           Full=Cytosine-specific methyltransferase SsoII
 gi|11559818|gb|AAG38101.1|AF300473_2 DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae]
 gi|294244|gb|AAA98279.1| C5-cytosine methylase [Plasmid P4]
          Length = 379

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317


>gi|1871451|dbj|BAA11167.1| C5-cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|3421011|emb|CAA76526.1| M.Ecl18kI (DNA-methyltransferase) [Enterobacter cloacae]
          Length = 379

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317


>gi|323968851|gb|EGB64187.1| DNA-cytosine methyltransferase [Escherichia coli TA007]
          Length = 282

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 118 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 177

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 178 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 220


>gi|157737722|ref|YP_001490405.1| DNA (cytosine-5-)-methyltransferase [Arcobacter butzleri RM4018]
 gi|157699576|gb|ABV67736.1| DNA (Cytosine-5-)-methyltransferase [Arcobacter butzleri RM4018]
          Length = 326

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 78/101 (77%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FGVPQ RER+YII FL+ S++FK+P  L  K RLGDIL+ ++DDK TIS+KLW G
Sbjct: 163 LNARNFGVPQNRERIYIIAFLDHSIDFKYPKSLNKKNRLGDILDNNVDDKYTISDKLWAG 222

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK+ +K  G GFGY LF   S  T+T+SARYYKDGSEI
Sbjct: 223 HQRRKKEHKEKGNGFGYSLFTHESEYTSTISARYYKDGSEI 263


>gi|462657|sp|P34877|MTSA_LACLC RecName: Full=Modification methylase ScrFIA; Short=M.ScrFI-A;
           Short=M.ScrFIA; AltName: Full=Cytosine-specific
           methyltransferase ScrFIA
 gi|149493|gb|AAA25220.1| SCRFI methylase [Lactococcus lactis]
 gi|2327034|gb|AAB66696.1| 5-methyl-cytosine methyltransferase [Lactococcus lactis subsp.
           cremoris]
          Length = 389

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 79/104 (75%), Gaps = 4/104 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           KA DFG+PQ RER+YI+ F   S+    +F+ PTPL  K R+G+ILE  +DDK TIS+KL
Sbjct: 221 KARDFGLPQNRERIYIVGFDRKSISNYSDFQMPTPLQEKTRVGNILESVVDDKYTISDKL 280

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           W+GHQ+RK  NK  GKGFGY LF ++S  TNTLSARYYKDGSEI
Sbjct: 281 WDGHQRRKTENKKNGKGFGYTLFNQDSEYTNTLSARYYKDGSEI 324


>gi|78777762|ref|YP_394077.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM
           1251]
 gi|78498302|gb|ABB44842.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM
           1251]
          Length = 328

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ RER+YI+ FL+  VEF+FP P+    ++GDILE+ +D+K TIS+KLW G
Sbjct: 163 LNAKDYGVPQNRERIYIVGFLDNEVEFEFPKPIEKYVKVGDILEDKVDEKYTISDKLWAG 222

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  +K  G GFGY +F ENS  T+T+SARYYKDGSEI
Sbjct: 223 HQRRKIEHKAKGNGFGYSMFNENSIYTSTISARYYKDGSEI 263


>gi|50914506|ref|YP_060478.1| Type II restriction-modification system methylation subunit
           [Streptococcus pyogenes MGAS10394]
 gi|40218542|gb|AAR83196.1| type II modification methylase [Streptococcus pyogenes]
 gi|50261587|gb|AAT72355.1| methylase [Streptococcus pyogenes]
 gi|50903580|gb|AAT87295.1| Type II restriction-modification system methylation subunit
           [Streptococcus pyogenes MGAS10394]
 gi|114386439|gb|ABI74454.1| DNA methyltransferase [Streptococcus pyogenes]
          Length = 408

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 77/105 (73%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
            KA DFGVPQ RER+YI+ F    +N   EF+FP P  ++ +LG+IL+  +D+K TIS+K
Sbjct: 242 FKARDFGVPQNRERIYIVGFDKTCVNNFSEFRFPEPFHLETKLGNILQTDVDEKYTISDK 301

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LWEGHQ+RK  +K  G GFGY LF  +S  TNTLSARYYKDGSEI
Sbjct: 302 LWEGHQRRKAEHKTKGNGFGYSLFNADSPYTNTLSARYYKDGSEI 346


>gi|152998369|ref|YP_001343204.1| DNA-cytosine methyltransferase [Marinomonas sp. MWYL1]
 gi|150839293|gb|ABR73269.1| DNA-cytosine methyltransferase [Marinomonas sp. MWYL1]
          Length = 417

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 57/102 (55%), Positives = 79/102 (77%), Gaps = 1/102 (0%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +K+ DFGVPQ R+R+YI+ + +  ++ F +P  +G+  R+GDILE + + K TIS++LWE
Sbjct: 255 LKSVDFGVPQNRQRIYIVLWKDGEIDKFDYPESMGLDTRVGDILEANPNPKLTISDRLWE 314

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           GHQ+RK  NKI GKGFGYG+  E+S  TNT+SARYYKDGSE+
Sbjct: 315 GHQRRKMQNKINGKGFGYGIVTEDSPYTNTISARYYKDGSEV 356


>gi|224418923|ref|ZP_03656929.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|253827874|ref|ZP_04870759.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|313142438|ref|ZP_07804631.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|253511280|gb|EES89939.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|313131469|gb|EFR49086.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
          Length = 328

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 73/101 (72%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ RER+ I+ F + +V F FP P     +LGDILE+  D+K TISN+LWE 
Sbjct: 164 LNARDYGVPQNRERIIIVGFKDHNVHFDFPKPYNYSVKLGDILEKTPDEKYTISNRLWES 223

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RKE  K  G GFGY LF ENS  T+T+SARYYKDGSEI
Sbjct: 224 HQQRKELQKAKGNGFGYRLFDENSPYTSTISARYYKDGSEI 264


>gi|283471715|emb|CAQ50926.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 397

 Score =  120 bits (301), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           ++A DFG PQ RER+YI+ F    ++    F FP PL I+  LG ILE +++DK TIS++
Sbjct: 227 LRARDFGCPQNRERIYIVGFDKQQIKNAENFSFPEPLPIETSLGSILESNVNDKYTISDR 286

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW GHQ+RK  +K  G GFGY +F E S  TNTLSARYYKDGSEI
Sbjct: 287 LWYGHQRRKREHKAKGNGFGYSIFNETSPYTNTLSARYYKDGSEI 331


>gi|325989685|ref|YP_004249384.1| cytosine-specific methyltransferase [Mycoplasma suis KI3806]
 gi|323574770|emb|CBZ40430.1| Cytosine-specific methyltransferase [Mycoplasma suis]
          Length = 326

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +K+ DFG+PQ RER+YI+ F    VE    F  P+P      +GDILE+ +++K TIS+ 
Sbjct: 160 LKSRDFGIPQNRERIYIVGFNKDLVESYENFSMPSPTLKATCVGDILEKEVNNKYTISDL 219

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LWEGH++RKE +K+ G+GFG+ LF ENS+ TNT+SARYYKDGSEI
Sbjct: 220 LWEGHKRRKEEHKLKGRGFGFSLFSENSSYTNTISARYYKDGSEI 264


>gi|321310755|ref|YP_004193084.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
 gi|319802599|emb|CBY93245.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
          Length = 362

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 72/105 (68%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           ++A DFGVPQ RER+YI+ F   +V+    FKFP        LGDILE  +DDK TISN 
Sbjct: 196 LRARDFGVPQNRERIYIVGFDKDAVQGYRNFKFPEATHKNTCLGDILESEVDDKYTISNT 255

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LWEGH++RK  NK  GKGFGY LF   S   NTLSARYYKDGSE+
Sbjct: 256 LWEGHKRRKVENKKKGKGFGYSLFNFESPYANTLSARYYKDGSEV 300


>gi|325973250|ref|YP_004250314.1| cytosine-specific DNA modification methylase, HpaII-like protein
           [Mycoplasma suis str. Illinois]
 gi|323651852|gb|ADX97934.1| cytosine-specific DNA modification methylase, HpaII-like protein
           [Mycoplasma suis str. Illinois]
          Length = 326

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +K+ DFG+PQ RER+YI+ F    VE    F  P+P      +GDILE+ +++K TIS+ 
Sbjct: 160 LKSRDFGIPQNRERIYIVGFNKDLVESYENFSMPSPTLKATCVGDILEKEVNNKYTISDL 219

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LWEGH++RKE +K+ G+GFG+ LF ENS+ TNT+SARYYKDGSEI
Sbjct: 220 LWEGHKRRKEEHKLKGRGFGFSLFSENSSYTNTISARYYKDGSEI 264


>gi|299536257|ref|ZP_07049570.1| DNA-methyltransferase MKpn2kI [Lysinibacillus fusiformis ZC1]
 gi|298728243|gb|EFI68805.1| DNA-methyltransferase MKpn2kI [Lysinibacillus fusiformis ZC1]
          Length = 403

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLN----PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           ++A DFGVPQ RER++++ F        V FKFP PL     LGDIL + +D+K TIS+K
Sbjct: 212 LRAADFGVPQNRERVFMVGFNKRIGGELVPFKFPKPLSTPTNLGDILFKKVDEKYTISDK 271

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           L+EGH +RKE +K  G GFG+ LF ENS+ TNTLSARYYKDGSEI
Sbjct: 272 LYEGHLRRKEMHKQKGNGFGFSLFDENSSYTNTLSARYYKDGSEI 316


>gi|315931535|gb|EFV10502.1| DNA (cytosine-5) methyltransferase [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 284

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 75/106 (70%), Gaps = 5/106 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFL-----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FG+PQ RER+YI+ FL     N S  F     + IK +LGDILE+++D+K TIS+
Sbjct: 151 LNARNFGIPQNRERIYIVAFLKNKFKNISFNFNELKNIEIKSKLGDILEKNVDEKYTISD 210

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW GHQ+RK  +K  G GFGY LF  NS  T+T+SARYYKDGSEI
Sbjct: 211 KLWAGHQRRKLEHKKKGNGFGYSLFNHNSDYTSTISARYYKDGSEI 256


>gi|157414453|ref|YP_001481709.1| hypothetical protein C8J_0133 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|283955585|ref|ZP_06373079.1| hypothetical protein C1336_000030018 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|157385417|gb|ABV51732.1| hypothetical protein C8J_0133 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|283792928|gb|EFC31703.1| hypothetical protein C1336_000030018 [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 321

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 75/106 (70%), Gaps = 5/106 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFL-----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FG+PQ RER+YI+ FL     N S  F     + IK +LGDILE+++D+K TIS+
Sbjct: 151 LNARNFGIPQNRERIYIVAFLKNKFKNISFNFNELKNIEIKSKLGDILEKNVDEKYTISD 210

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW GHQ+RK  +K  G GFGY LF  NS  T+T+SARYYKDGSEI
Sbjct: 211 KLWAGHQRRKLEHKKKGNGFGYSLFNHNSDYTSTISARYYKDGSEI 256


>gi|255066464|ref|ZP_05318319.1| modification methylase EcoRII [Neisseria sicca ATCC 29256]
 gi|298369378|ref|ZP_06980696.1| modification methylase EcoRII [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|255049344|gb|EET44808.1| modification methylase EcoRII [Neisseria sicca ATCC 29256]
 gi|298283381|gb|EFI24868.1| modification methylase EcoRII [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 357

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           M A DF +PQ RER+YI+ F +   + +F+FP PL    ++GDILE   D K TIS++LW
Sbjct: 190 MAAKDFNLPQNRERIYIVGFRSAKDAAQFEFPHPLPKTVKVGDILESFPDAKYTISDRLW 249

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +GH +RK  +K  G GFGYGLF   S  TNT+SARYYKDGSEI
Sbjct: 250 QGHLRRKAEHKQKGNGFGYGLFNAQSEYTNTISARYYKDGSEI 292


>gi|170729237|ref|YP_001763263.1| DNA-cytosine methyltransferase [Shewanella woodyi ATCC 51908]
 gi|169814584|gb|ACA89168.1| DNA-cytosine methyltransferase [Shewanella woodyi ATCC 51908]
          Length = 416

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 57/102 (55%), Positives = 73/102 (71%), Gaps = 1/102 (0%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M++ DFGVPQ R+R+YII + +  +E F++P P G   ++ DILE    +K TIS+KLW 
Sbjct: 255 MRSVDFGVPQNRQRIYIILWKDGLIEQFQYPKPSGKDTKVADILESEPCEKLTISDKLWA 314

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           GH++RK  NK  GKGFGYGL    S  TNT+SARYYKDGSEI
Sbjct: 315 GHKRRKIENKAKGKGFGYGLVSPESEYTNTISARYYKDGSEI 356


>gi|256760956|ref|ZP_05501536.1| type II restriction-modification system methylation subunit
           [Enterococcus faecalis T3]
 gi|256682207|gb|EEU21902.1| type II restriction-modification system methylation subunit
           [Enterococcus faecalis T3]
          Length = 405

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 74/104 (71%), Gaps = 4/104 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           KA DFG PQ RER+YI+ F   S++    F+FPT    K  +GDILE+ +D+K TIS+ L
Sbjct: 237 KARDFGAPQNRERIYIVGFDKLSLKNIDLFEFPTAPKPKTCVGDILEDSVDEKYTISDTL 296

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           WEGH++RK  +K  G GFG+ LF  +S  TNT+SARYYKDGSEI
Sbjct: 297 WEGHKRRKLEHKEKGNGFGFSLFNSSSPYTNTISARYYKDGSEI 340


>gi|1709152|sp|P50185|MTD5_DACSA RecName: Full=Modification methylase DsaV; Short=M.DsaV; AltName:
           Full=Cytosine-specific methyltransferase DsaV
 gi|505694|gb|AAA86046.1| DsaV methyltransferase [Dactylococcopsis salina]
          Length = 351

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 76/104 (73%), Gaps = 3/104 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DF +PQ+RER++I+ F    N ++ F FP P+ +  ++GD+LE+ +D+K TI++++
Sbjct: 146 ISATDFNLPQKRERIFIVGFQDKNNKNLIFDFPKPIELTAKVGDLLEKEVDEKYTITDRM 205

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           WEGHQ RK+ ++  G GFG+ L   NS+ T T+SARYYKDGSE+
Sbjct: 206 WEGHQNRKKAHRKRGNGFGFSLVNRNSSYTRTISARYYKDGSEV 249


>gi|262402975|ref|ZP_06079535.1| DNA-methyltransferase MKpn2kI [Vibrio sp. RC586]
 gi|262350474|gb|EEY99607.1| DNA-methyltransferase MKpn2kI [Vibrio sp. RC586]
          Length = 410

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 17/118 (14%)

Query: 1   MKACDFGVPQRRERLYIIDF-------LNPSVEFKFPTPLGIKPRLGDILE-EHI----- 47
           ++A DFGVPQ RER++I+ F       +N    F +P       R+GDILE +H+     
Sbjct: 216 LRAADFGVPQNRERIFIVGFDKNYFRGVNFDSLFSWPEAPKTPTRVGDILEPQHVLDEEK 275

Query: 48  ----DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                D+ TIS+KLW+GH+KRKE +KI G GFGY LF  +S  TNT+SARYYKDGSEI
Sbjct: 276 QALGKDRYTISDKLWDGHKKRKEEHKIKGNGFGYSLFNADSEYTNTISARYYKDGSEI 333


>gi|319893523|ref|YP_004150398.1| DNA-cytosine methyltransferase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317163219|gb|ADV06762.1| DNA-cytosine methyltransferase [Staphylococcus pseudintermedius
           HKU10-03]
          Length = 394

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 73/105 (69%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +KA DFGVPQ RER+YI+ F    +    ++  P P   +  LG ILE+++D+K TIS+K
Sbjct: 227 LKAKDFGVPQNRERIYIVGFDKRRIKKWRDYIPPKPPKSQTLLGKILEKNVDEKYTISDK 286

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW GH++RK  +K+ G GFG+ L+   S  TNTLSARYYKDGSEI
Sbjct: 287 LWSGHKRRKAEHKLKGNGFGFTLYNGESPYTNTLSARYYKDGSEI 331


>gi|260554958|ref|ZP_05827179.1| DNA-methyltransferase MKpn2kI [Acinetobacter baumannii ATCC 19606]
 gi|260411500|gb|EEX04797.1| DNA-methyltransferase MKpn2kI [Acinetobacter baumannii ATCC 19606]
          Length = 413

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 74/114 (64%), Gaps = 13/114 (11%)

Query: 1   MKACDFGVPQRRERLYIIDF--------LNPSVEFKFPTPLGIKPRLGDILEE-----HI 47
           ++A DFGVPQ RER++++ F         N    F +P P   + RLGDILE+       
Sbjct: 222 LRAADFGVPQNRERIFLVGFDKNYFGEECNFDQLFSWPVPPKKQTRLGDILEDVSKLKKS 281

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +D  TIS++LW+GHQ+RKE + I G GFGY L+  +S  TNTLSARYYKDGSEI
Sbjct: 282 EDVYTISDRLWQGHQRRKEEHGIKGNGFGYTLYTGDSPYTNTLSARYYKDGSEI 335


>gi|124024750|ref|YP_001013866.1| site-specific DNA methylase [Prochlorococcus marinus str. NATL1A]
 gi|123959818|gb|ABM74601.1| Site-specific DNA methylase [Prochlorococcus marinus str. NATL1A]
          Length = 305

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 50/101 (49%), Positives = 76/101 (75%), Gaps = 1/101 (0%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ RER++I  +++  + F+FP P  ++ ++GDIL++++ DK T+S+K+W  
Sbjct: 146 LNAKDFGVPQNRERIFIFGYID-FIFFEFPEPSKVQTKVGDILDDNVPDKFTLSDKMWTN 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             +RKENN+  G GFG+ LF ++S  T+T+SARYYKDGSEI
Sbjct: 205 AIRRKENNRKRGYGFGFSLFDKDSEYTSTISARYYKDGSEI 245


>gi|229530048|ref|ZP_04419438.1| type II restriction-modification system methylation subunit [Vibrio
           cholerae 12129(1)]
 gi|229333822|gb|EEN99308.1| type II restriction-modification system methylation subunit [Vibrio
           cholerae 12129(1)]
          Length = 270

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 73/118 (61%), Gaps = 17/118 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEF----KFPTPLGIKPRLGDILEE-------- 45
           ++A DFG PQ RER++II F     P+++F     +P       R+GDIL+         
Sbjct: 76  LRAADFGSPQNRERIFIIGFNKDEFPNIDFDKLFSWPKAPKTPTRVGDILQTQQELELDK 135

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             H  D+ TIS+KLWEGHQKRK  +K  G GFGY LF  +S  TNT+SARYYKDGSEI
Sbjct: 136 KLHGKDRFTISDKLWEGHQKRKAEHKTKGNGFGYSLFNADSEYTNTISARYYKDGSEI 193


>gi|323495143|ref|ZP_08100228.1| DNA-methyltransferase MKpn2kI [Vibrio brasiliensis LMG 20546]
 gi|323310583|gb|EGA63762.1| DNA-methyltransferase MKpn2kI [Vibrio brasiliensis LMG 20546]
          Length = 443

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 72/118 (61%), Gaps = 17/118 (14%)

Query: 1   MKACDFGVPQRRERLYIIDF-------LNPSVEFKFPTPLGIKPRLGDILEEHID----- 48
           ++A DFGVPQ RER++II F       ++    F +P P     ++GDIL+   +     
Sbjct: 248 LRAADFGVPQNRERIFIIGFDKDYYTGVDFDQVFNWPEPPKTPTKVGDILQSDQELEAEA 307

Query: 49  -----DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                D  TIS++LWEGHQKRKE +K  G GFGY L+   S  TNT+SARYYKDGSEI
Sbjct: 308 KVIGKDCYTISDRLWEGHQKRKEGHKTKGNGFGYTLYNAESEYTNTISARYYKDGSEI 365


>gi|294788070|ref|ZP_06753314.1| modification methylase EcoRII [Simonsiella muelleri ATCC 29453]
 gi|294484363|gb|EFG32046.1| modification methylase EcoRII [Simonsiella muelleri ATCC 29453]
          Length = 355

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 5/106 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKP--RLGDILEEHIDDKSTISN 55
           + A +FGVPQ RER+YI+      NP+    F      K   ++GDIL+  +D+K TIS+
Sbjct: 184 LNAKNFGVPQNRERIYIVAIRNDFNPTFNLDFDKLKNTKVNCQVGDILQNQVDEKYTISD 243

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW GHQ+RK  +   G GFGY LF   S  T+T+SARYYKDGSEI
Sbjct: 244 KLWAGHQRRKAEHIEKGNGFGYSLFNAQSPYTSTISARYYKDGSEI 289


>gi|66391578|ref|YP_239103.1| hypothetical protein RB43ORF127c [Enterobacteria phage RB43]
 gi|62288666|gb|AAX78649.1| hypothetical protein RB43ORF127c [Enterobacteria phage RB43]
          Length = 302

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (69%), Gaps = 2/96 (2%)

Query: 5   DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKR 64
           DFG+PQRRER++I+ FL+  V F FP P     R+GDILE+ +DD  T+S+  W+G ++R
Sbjct: 148 DFGLPQRRERVFIVCFLD-DVFFSFPVPPRTPTRVGDILED-VDDSYTLSDNAWKGFRER 205

Query: 65  KENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           KE NK  GKGFGY     +S  T T++A+YYKDG +
Sbjct: 206 KERNKANGKGFGYQAVTADSTHTGTITAQYYKDGVQ 241


>gi|294661528|ref|YP_003579981.1| hypothetical protein KP-KP15_gp115 [Klebsiella phage KP15]
 gi|292660689|gb|ADE34937.1| hypothetical protein [Klebsiella phage KP15]
          Length = 308

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 68/100 (68%), Gaps = 2/100 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           M   DFG+PQRRER++I+ F +P V F FP P     R+GDILE   +D+ TIS++ W+G
Sbjct: 144 MNTKDFGLPQRRERVFIVCFRDP-VFFSFPVPPRTPTRVGDILEPD-NDQYTISDRAWKG 201

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
            ++RKE NK  GKGFGY     +S  T T++A+YYKDG +
Sbjct: 202 FRERKELNKANGKGFGYQAVTVDSVCTGTITAQYYKDGVQ 241


>gi|237725529|ref|ZP_04556010.1| DNA (cytosine-5-)-methyltransferase [Bacteroides sp. D4]
 gi|229436216|gb|EEO46293.1| DNA (cytosine-5-)-methyltransferase [Bacteroides dorei 5_1_36/D4]
          Length = 374

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 22/123 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLG-----------------IKPRLG 40
           + A  FGVPQ RERL+I+ +    V+   FKFP  +                  IK ++ 
Sbjct: 166 LNAKYFGVPQNRERLFIVAWYKDIVKATTFKFPYGIAPDGSTIYEKSKDLGDKVIKTKVS 225

Query: 41  DILE--EHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
           DI E  + ID   TIS++LW GHQ+RK+ NK  GKGFGY LF ENS  ++T+SARY+KDG
Sbjct: 226 DIFEPEDSIDSYYTISDRLWIGHQERKKRNKANGKGFGYSLFNENSVYSSTISARYWKDG 285

Query: 99  SEI 101
           SEI
Sbjct: 286 SEI 288


>gi|304373674|ref|YP_003858419.1| putative DNA-methyltransferase, type II restriction-modification
           system [Enterobacteria phage RB16]
 gi|299829630|gb|ADJ55423.1| putative DNA-methyltransferase, type II restriction-modification
           system [Enterobacteria phage RB16]
          Length = 302

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (68%), Gaps = 2/96 (2%)

Query: 5   DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKR 64
           DFG+PQRRER++I+ FL+  V F FP P     R+GDILE+  DD  T+S+  W+G ++R
Sbjct: 148 DFGLPQRRERVFIVCFLD-DVFFSFPVPPRTPTRVGDILEDA-DDSYTLSDNAWKGFRER 205

Query: 65  KENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           KE NK  GKGFGY     +S  T T++A+YYKDG +
Sbjct: 206 KERNKANGKGFGYQAVTADSTHTGTITAQYYKDGVQ 241


>gi|317497297|ref|ZP_07955620.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316895366|gb|EFV17525.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 385

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 71/106 (66%), Gaps = 6/106 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-----EFKFPT-PLGIKPRLGDILEEHIDDKSTIS 54
           + A  FG+PQ RER+ I+ F    +     +FK+P   +  K  +GDILE+ + ++ TIS
Sbjct: 213 LNAYHFGIPQNRERIIIVGFNKDYLPKKFKDFKYPVGKIDKKVCVGDILEKEVGERFTIS 272

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           +KLWEGHQ RK  +K  G GFG+ LF ++S  T+T+SARYYKDGSE
Sbjct: 273 DKLWEGHQARKRMHKKKGNGFGFCLFNKDSKYTSTISARYYKDGSE 318


>gi|308126237|ref|ZP_05908633.2| DNA (cytosine-5-)-methyltransferase [Vibrio parahaemolyticus
           AQ4037]
 gi|308107574|gb|EFO45114.1| DNA (cytosine-5-)-methyltransferase [Vibrio parahaemolyticus
           AQ4037]
          Length = 426

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 8/108 (7%)

Query: 1   MKACDFGVPQRRERLYIIDF-------LNPSVEFKFPTPLGIKPRLGDILE-EHIDDKST 52
           ++A DFG PQ RER+Y++ F       L+ +  F+FP P     ++GDILE     D  T
Sbjct: 248 LRAADFGAPQNRERIYLVGFDKDYFGDLDFNSIFQFPEPTMKPTKVGDILETSDYVDSFT 307

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           IS+K+W  HQKRK  +K  G GFG+ L    +  TNT+SARYYKDGSE
Sbjct: 308 ISDKIWASHQKRKAGHKNKGNGFGFTLVNSETKYTNTISARYYKDGSE 355


>gi|17863973|gb|AAL46998.1|AF448250_2 putative C-5 cytosine-specific DNA methylase [Bacteroides coprosuis
           DSM 18011]
          Length = 401

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 67/110 (60%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--------FKFPTPLGIKPRLGDILEE--HIDDK 50
           + A DFG PQ RER+YI+ F              F+FP P   K  + D+LE+    D  
Sbjct: 237 LNAKDFGSPQNRERIYIVGFNKNHFTKIDDFNEIFQFPEPSKEKVSVKDVLEKIPANDTI 296

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
            TIS ++W+GHQKRK  ++  G GFG+ LF ENS  TNT+SARYYKDGSE
Sbjct: 297 YTISERIWQGHQKRKLKHQNKGNGFGFSLFNENSEYTNTISARYYKDGSE 346


>gi|260909972|ref|ZP_05916659.1| modification methylase EcoRII [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260635922|gb|EEX53925.1| modification methylase EcoRII [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 370

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 73/121 (60%), Gaps = 20/121 (16%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIK----------------PRLGD 41
           + A  FGVPQ RERL+II +    V+   FKFP  + I                  ++ +
Sbjct: 166 LNAKYFGVPQNRERLFIIAWNRELVDVDCFKFPYGIAIDGTSIYEKRKLKGRTIPTKVSE 225

Query: 42  ILE-EHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           I E +++    TI++++WEGH+ RKE NK+ GKGFGY LF  NS  T+T+SARY+KDGSE
Sbjct: 226 IFEPDNVTTPFTITDRMWEGHKTRKERNKMNGKGFGYSLFNANSEYTSTISARYWKDGSE 285

Query: 101 I 101
           I
Sbjct: 286 I 286


>gi|228469904|ref|ZP_04054843.1| cytosine-specific methyltransferase NlaX [Porphyromonas uenonis
           60-3]
 gi|228308539|gb|EEK17327.1| cytosine-specific methyltransferase NlaX [Porphyromonas uenonis
           60-3]
          Length = 395

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 72/122 (59%), Gaps = 21/122 (17%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPL----------------GIKPRLGD 41
           + A  FGVPQ RERL+I+ +   L  +  F FP  +                 I+ ++ D
Sbjct: 188 LNAKYFGVPQNRERLFIVAWSKDLISADRFLFPYGIDAEGNTIYDKQMAKRCAIRTKVSD 247

Query: 42  ILE-EHID-DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99
           I E + I+ D  TIS+++W GHQ RK+ N++ GKGFGY  F  NS  T+T+SARY+KDGS
Sbjct: 248 IFEPQSIERDGFTISDRMWLGHQTRKKRNRLNGKGFGYSKFTGNSVYTSTISARYWKDGS 307

Query: 100 EI 101
           EI
Sbjct: 308 EI 309


>gi|304387412|ref|ZP_07369603.1| modification methylase EcoRII [Neisseria meningitidis ATCC 13091]
 gi|304338505|gb|EFM04624.1| modification methylase EcoRII [Neisseria meningitidis ATCC 13091]
          Length = 336

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 61/98 (62%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER++I+ F     N  + F FP+P   +P+L  ILE+ +D+  T+S+ LW   Q 
Sbjct: 177 VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDNLWLYLQN 236

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             + +K  G GFG+GL  +    + TLSARYYKDGSEI
Sbjct: 237 YAKKHKAKGNGFGFGL-VDLDGISRTLSARYYKDGSEI 273


>gi|166368844|ref|YP_001661117.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
 gi|166091217|dbj|BAG05925.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
          Length = 338

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 59/94 (62%), Gaps = 2/94 (2%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67
           VPQ R+R++I+ F  PS  F FP    I P++ DILE  +D K T+++ LW+  QK  + 
Sbjct: 158 VPQNRKRIFIVGFEKPS-RFMFPEIPDIHPKIKDILEGEVDSKYTLTDHLWDYLQKYADK 216

Query: 68  NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +K  G GFGYGL         TLSARYYKDGSEI
Sbjct: 217 HKEKGNGFGYGL-VNLEGIARTLSARYYKDGSEI 249


>gi|325130344|gb|EGC53110.1| modification methylase EcoRII [Neisseria meningitidis OX99.30304]
          Length = 337

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 61/98 (62%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER++I+ F     N  + F FP+P   +P+L  ILE+ +D+  T+S+ LW   Q 
Sbjct: 177 VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDNLWLYLQN 236

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             + +K  G GFG+GL  +    + TLSARYYKDGSEI
Sbjct: 237 YAKKHKAKGNGFGFGL-VDLDGISRTLSARYYKDGSEI 273


>gi|255262721|ref|ZP_05342063.1| cytosine-specific methyltransferase NlaX [Thalassiobium sp. R2A62]
 gi|255105056|gb|EET47730.1| cytosine-specific methyltransferase NlaX [Thalassiobium sp. R2A62]
          Length = 421

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 70/114 (61%), Gaps = 13/114 (11%)

Query: 1   MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPL--GIK-----PRLGDILEEH--I 47
           + A +FGVPQ RER+YI+ F    ++ +     P  +  G+K      RLGD+LE +  +
Sbjct: 243 LAAKNFGVPQNRERVYIVGFDRDQVSEAEARDLPREILDGLKERKSETRLGDVLETNASV 302

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           D K TIS++L  GH++R   ++  G GFG+ LF   S   NT+SARYYKDGSE+
Sbjct: 303 DPKFTISDRLLAGHERRLRAHRAKGNGFGFSLFNAESPYCNTISARYYKDGSEV 356


>gi|15677157|ref|NP_274310.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis MC58]
 gi|161870164|ref|YP_001599334.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis 053442]
 gi|218768314|ref|YP_002342826.1| putative modification methylase [Neisseria meningitidis Z2491]
 gi|7226530|gb|AAF41666.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis MC58]
 gi|121052322|emb|CAM08652.1| putative modification methylase [Neisseria meningitidis Z2491]
 gi|161595717|gb|ABX73377.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis 053442]
 gi|254670478|emb|CBA06174.1| putative DNA modification methylase [Neisseria meningitidis
           alpha153]
 gi|308389411|gb|ADO31731.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis
           alpha710]
 gi|316984080|gb|EFV63058.1| modification methylase SsoII [Neisseria meningitidis H44/76]
 gi|319410559|emb|CBY90927.1| putative type II restriction-modification system enzyme Mod
           [Neisseria meningitidis WUE 2594]
 gi|325134466|gb|EGC57111.1| modification methylase EcoRII [Neisseria meningitidis M13399]
 gi|325136204|gb|EGC58812.1| modification methylase EcoRII [Neisseria meningitidis M0579]
 gi|325140483|gb|EGC63004.1| modification methylase EcoRII [Neisseria meningitidis CU385]
 gi|325144567|gb|EGC66866.1| modification methylase EcoRII [Neisseria meningitidis M01-240013]
 gi|325200082|gb|ADY95537.1| modification methylase EcoRII [Neisseria meningitidis H44/76]
 gi|325201996|gb|ADY97450.1| modification methylase EcoRII [Neisseria meningitidis M01-240149]
 gi|325205934|gb|ADZ01387.1| modification methylase EcoRII [Neisseria meningitidis M04-240196]
 gi|325208252|gb|ADZ03704.1| modification methylase EcoRII [Neisseria meningitidis NZ-05/33]
          Length = 337

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 61/98 (62%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER++I+ F     N  + F FP+P   +P+L  ILE+ +D+  T+S+ LW   Q 
Sbjct: 177 VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDNLWLYLQN 236

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             + +K  G GFG+GL  +    + TLSARYYKDGSEI
Sbjct: 237 YAKKHKAKGNGFGFGL-VDLDGISRTLSARYYKDGSEI 273


>gi|118576810|ref|YP_876553.1| C-5 cytosine-specific DNA methylase [Cenarchaeum symbiosum A]
 gi|118195331|gb|ABK78249.1| C-5 cytosine-specific DNA methylase [Cenarchaeum symbiosum A]
          Length = 325

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 57/94 (60%), Gaps = 2/94 (2%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67
           VPQ RERL+I+ F +  VEF+FP     KPRL DILE     +  ++  +W   ++ KE 
Sbjct: 159 VPQHRERLFIVGF-DREVEFEFPKMKNAKPRLRDILEPDPGSEYVLTPGVWAALKRHKEA 217

Query: 68  NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  G GFGYG+  +    T TLS RYYKDGSEI
Sbjct: 218 CRARGAGFGYGI-ADPDGVTRTLSRRYYKDGSEI 250


>gi|238922589|ref|YP_002936102.1| modification methylase [Eubacterium rectale ATCC 33656]
 gi|238874261|gb|ACR73968.1| modification methylase [Eubacterium rectale ATCC 33656]
          Length = 392

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (60%), Gaps = 6/99 (6%)

Query: 8   VPQRRERLYIIDF----LNPSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62
           VPQ RER+ I+ F        +EF F  TP+  KP + DILE+ +DDK T+S+ LW   Q
Sbjct: 220 VPQHRERIIIVGFDMERYGDDIEFDFDITPVNPKPVMRDILEKKVDDKYTLSDNLWTYLQ 279

Query: 63  KRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                ++ AG GFGYG+       + T+SARY+KDGSEI
Sbjct: 280 NYAAKHRAAGNGFGYGI-APLDGVSRTISARYHKDGSEI 317


>gi|312898460|ref|ZP_07757850.1| DNA (cytosine-5-)-methyltransferase [Megasphaera micronuciformis
           F0359]
 gi|310620379|gb|EFQ03949.1| DNA (cytosine-5-)-methyltransferase [Megasphaera micronuciformis
           F0359]
          Length = 400

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 59/99 (59%), Gaps = 6/99 (6%)

Query: 8   VPQRRERLYIIDF----LNPSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62
           VPQ RER+ I+ F        + F+F   P+  KP +  ILE  +DDK T+++KLW   Q
Sbjct: 208 VPQHRERILIVGFDRKRYGRDIGFRFSIAPVNPKPAIKAILETKVDDKYTLTDKLWTYLQ 267

Query: 63  KRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                ++ AG GFGYG+   N   + TLSARYYKDGSEI
Sbjct: 268 NYAAKHRAAGNGFGYGIADPN-GVSRTLSARYYKDGSEI 305


>gi|323486195|ref|ZP_08091524.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14163]
 gi|323400521|gb|EGA92890.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14163]
          Length = 382

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (60%), Gaps = 6/99 (6%)

Query: 8   VPQRRERLYIIDF----LNPSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62
           VPQ RER+ I+ F        ++F F  TP   KP + DIL++ +D+K T+S+KLW   Q
Sbjct: 210 VPQHRERIIIVGFDRERYGQDIKFDFEITPAIPKPVMKDILDKKVDEKYTLSDKLWIYLQ 269

Query: 63  KRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                +K AG GFGYG+       + T+SARYYKDGSEI
Sbjct: 270 SYAAKHKAAGNGFGYGI-APLDGVSRTISARYYKDGSEI 307


>gi|237713924|ref|ZP_04544405.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. D1]
 gi|262409168|ref|ZP_06085712.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. 2_1_22]
 gi|229446080|gb|EEO51871.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. D1]
 gi|262352915|gb|EEZ02011.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. 2_1_22]
          Length = 361

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 57/98 (58%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+ I+ F     +   +F FP        + +ILE  IDDK T+S+KLW   Q 
Sbjct: 186 VPQHRERIMIVGFNREIFHGEEQFCFPEQKQSTRGIREILESDIDDKYTLSDKLWSYLQN 245

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             E ++  G GFG+G+   N   + TLSARYYKDGSEI
Sbjct: 246 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 282


>gi|294646710|ref|ZP_06724334.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a]
 gi|294807186|ref|ZP_06766001.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD
           CC 1b]
 gi|292637950|gb|EFF56344.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a]
 gi|294445609|gb|EFG14261.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD
           CC 1b]
          Length = 445

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 57/98 (58%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+ I+ F     +   +F FP        + +ILE  IDDK T+S+KLW   Q 
Sbjct: 270 VPQHRERIMIVGFNREIFHGEEQFCFPEQKQSTRGIREILESDIDDKYTLSDKLWSYLQN 329

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             E ++  G GFG+G+   N   + TLSARYYKDGSEI
Sbjct: 330 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 366


>gi|313158099|gb|EFR57504.1| putative DNA (cytosine-5-)-methyltransferase [Alistipes sp. HGB5]
          Length = 431

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 60/98 (61%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDFLN---PSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+ I+ F N     VE FKFP    +  ++ +ILE  +D K T+++KLW   Q 
Sbjct: 267 VPQHRERIMIVGFRNNLFHGVEKFKFPELKDVSHKIRNILEPEVDPKYTLTDKLWVYLQN 326

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             + ++ +G GFG+GL  +      TLSARYYKDGSEI
Sbjct: 327 YAKKHQDSGNGFGFGL-VDLDGIARTLSARYYKDGSEI 363


>gi|296282358|ref|ZP_06860356.1| DNA-cytosine methyltransferase [Citromicrobium bathyomarinum JL354]
          Length = 439

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 8/100 (8%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLWEGH 61
           VPQ+RER++I+ F   S       + P  +   P+LG ILE H  +D K T++ +LWE  
Sbjct: 250 VPQKRERIFIVGFREKSAFNLAGLEIPA-VADGPKLGSILEPHDQVDPKYTLTPRLWEYL 308

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q+ ++ ++  G GFGY LF        TLSARY+KDGSEI
Sbjct: 309 QEYRKKHEAKGNGFGYSLFGPGD-VARTLSARYHKDGSEI 347


>gi|85709931|ref|ZP_01040996.1| Type II restriction-modification system methylation subunit
           [Erythrobacter sp. NAP1]
 gi|85688641|gb|EAQ28645.1| Type II restriction-modification system methylation subunit
           [Erythrobacter sp. NAP1]
          Length = 370

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 63/111 (56%), Gaps = 10/111 (9%)

Query: 1   MKACDFGVPQRRERLYIIDF-------LNPSVEFKFPTPLGIKPRLGDILEEHIDD---K 50
           + A +FGVPQ+RER+YI+ F       ++ +  F      G   RLGD LE    +   +
Sbjct: 184 LAATEFGVPQKRERVYIVGFDRDHFGNIDANDVFAQLERGGHPTRLGDALEPEGANSLAR 243

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            TIS+KLW G  +R   ++  G GFG+ +F  +    NT+++RYYKDG EI
Sbjct: 244 YTISDKLWSGLIRRMARHEAKGNGFGHKVFNYDDPYCNTITSRYYKDGREI 294


>gi|53714966|ref|YP_100958.1| C-5 cytosine-specific DNA-methylase [Bacteroides fragilis YCH46]
 gi|52217831|dbj|BAD50424.1| C-5 cytosine-specific DNA-methylase [Bacteroides fragilis YCH46]
          Length = 431

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 56/98 (57%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+ I+    D  +   +F FP        + +IL+  ID K T+S+KLW   Q 
Sbjct: 270 VPQHRERIMIVGFNQDVFHGKEQFAFPEQKQSTRSIKEILDPDIDGKYTLSDKLWSYLQN 329

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             E ++  G GFG+G+   N   + TLSARYYKDGSEI
Sbjct: 330 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 366


>gi|210631776|ref|ZP_03297018.1| hypothetical protein COLSTE_00903 [Collinsella stercoris DSM 13279]
 gi|210159896|gb|EEA90867.1| hypothetical protein COLSTE_00903 [Collinsella stercoris DSM 13279]
          Length = 390

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 6/95 (6%)

Query: 10  QRRERLYIIDFLNPSVEFKFP---TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKE 66
           Q RER+YI+ F +  V+F +     P   + +  +ILE  +DD+  +S+KLW   +  K 
Sbjct: 231 QHRERIYIVGFRD-DVDFSWDDLDCPQNGQ-KAAEILETDVDDRYVLSDKLWSYLKAYKA 288

Query: 67  NNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            ++ AG GFGYGL    S TT TLSARY+KDGSEI
Sbjct: 289 KHEAAGNGFGYGL-ITPSDTTRTLSARYHKDGSEI 322


>gi|167035739|ref|YP_001670970.1| DNA cytosine methylase [Pseudomonas putida GB-1]
 gi|166862227|gb|ABZ00635.1| DNA-cytosine methyltransferase [Pseudomonas putida GB-1]
          Length = 447

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 58/105 (55%), Gaps = 16/105 (15%)

Query: 8   VPQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
            PQ RER+ ++ F           L    E  FP     +P LGDIL+E +DDK  ++ K
Sbjct: 261 TPQHRERIVLVGFRKDLGVHSGFTLKDIAEL-FPKK---RPALGDILDEKVDDKYILTPK 316

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW+        +K  G GFG+GL  + S+ T TLSARYYKDGSEI
Sbjct: 317 LWQYLFNYAIKHKAKGNGFGFGLVGK-SSVTRTLSARYYKDGSEI 360


>gi|296114735|ref|ZP_06833385.1| DNA-cytosine methyltransferase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978659|gb|EFG85387.1| DNA-cytosine methyltransferase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 419

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 57/100 (57%), Gaps = 8/100 (8%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPT----PLGIKPRLGDILEEH--IDDKSTISNKLWEGH 61
           VPQ+RER++I+ F     +F   +    P+   PRLG IL  H  ++ K T++  LW   
Sbjct: 230 VPQKRERIFIVGF-REKTDFDLKSLVVPPIEKGPRLGSILLPHAEVEPKYTLTEHLWNYL 288

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q  K  +  AG GFG+GL   +     TLSARY+KDGSEI
Sbjct: 289 QNYKAKHAAAGNGFGFGLCGPDD-VARTLSARYFKDGSEI 327


>gi|86136173|ref|ZP_01054752.1| hypothetical protein MED193_18659 [Roseobacter sp. MED193]
 gi|85827047|gb|EAQ47243.1| hypothetical protein MED193_18659 [Roseobacter sp. MED193]
          Length = 399

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 58/116 (50%), Gaps = 24/116 (20%)

Query: 8   VPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRLGDIL--------------EEH-- 46
           VPQ RER++I  F    V  +F       P G  PRL DIL              E H  
Sbjct: 207 VPQHRERIFISGFRR-DVPTRFCLDDVVIPPGPNPRLSDILHPENGSEIAEPPYTEGHLA 265

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            I DK T+S+KLW   Q     +K AG GFG+GL    S    TLSARYYKDGSEI
Sbjct: 266 RIADKYTLSDKLWAYLQNYAAKHKAAGNGFGFGLCTPES-VARTLSARYYKDGSEI 320


>gi|94501925|ref|ZP_01308434.1| DNA-cytosine methyltransferase [Oceanobacter sp. RED65]
 gi|94425919|gb|EAT10918.1| DNA-cytosine methyltransferase [Oceanobacter sp. RED65]
          Length = 287

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (58%), Gaps = 9/102 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEF---KFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           +PQ RER+ ++ F   LN +  F     P P  + P L  +LE+ +D+K  ++ +LWE  
Sbjct: 94  LPQHRERIVLVGFRKDLNLTNRFTLTNLPKPREV-PSLSSLLEKSVDEKYVLTPRLWEYL 152

Query: 62  QKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
            +  + ++  G GFGYGL     +SA   TLSARY+KDGSEI
Sbjct: 153 YEYAKKHQAKGNGFGYGLVDPKNSSAVCRTLSARYHKDGSEI 194


>gi|239621327|ref|ZP_04664358.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|239515788|gb|EEQ55655.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 343

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 10/100 (10%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKP----RLGDIL--EEHIDDKSTISNKLWEGH 61
           VPQ RER YI+ F   +  F F     +KP     +G IL     + DK  +S+KLW   
Sbjct: 185 VPQHRERTYIVGFREEN-GFTFDD---VKPIAHGNVGSILLPASQVPDKYVLSDKLWTYL 240

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 241 QNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 280


>gi|189439219|ref|YP_001954300.1| site-specific DNA methylase [Bifidobacterium longum DJO10A]
 gi|189427654|gb|ACD97802.1| Site-specific DNA methylase [Bifidobacterium longum DJO10A]
          Length = 323

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 10/100 (10%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKP----RLGDIL--EEHIDDKSTISNKLWEGH 61
           VPQ RER YI+ F   +  F F     +KP     +G IL     + DK  +S+KLW   
Sbjct: 165 VPQHRERTYIVGFREEN-GFTFDD---VKPIAHGNVGSILLPASQVPDKYVLSDKLWTYL 220

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 221 QNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 260


>gi|46191283|ref|ZP_00120453.2| COG0270: Site-specific DNA methylase [Bifidobacterium longum
           DJO10A]
          Length = 315

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 10/100 (10%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKP----RLGDIL--EEHIDDKSTISNKLWEGH 61
           VPQ RER YI+ F   +  F F     +KP     +G IL     + DK  +S+KLW   
Sbjct: 157 VPQHRERTYIVGFREEN-GFTFDD---VKPIAHGNVGSILLPASQVPDKYVLSDKLWTYL 212

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 213 QNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 252


>gi|23466029|ref|NP_696632.1| modification methylase very EcoRII
           (cytosine-specificmethyltransferase [Bifidobacterium
           longum NCC2705]
 gi|23326750|gb|AAN25268.1| modification methylase very similar to EcoRII
           (cytosine-specificmethyltransferase [Bifidobacterium
           longum NCC2705]
          Length = 323

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 56/100 (56%), Gaps = 10/100 (10%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKP----RLGDIL--EEHIDDKSTISNKLWEGH 61
           VPQ RER YI+ F   +  F F     +KP     +G IL     + DK  +S+KLW   
Sbjct: 165 VPQHRERTYIVGFREEN-GFTFDD---VKPIAHGNVGSILLPASQVPDKYVLSDKLWTYL 220

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 221 QNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 260


>gi|56751653|ref|YP_172354.1| hypothetical protein syc1644_d [Synechococcus elongatus PCC 6301]
 gi|81301269|ref|YP_401477.1| DNA-cytosine methyltransferase [Synechococcus elongatus PCC 7942]
 gi|56686612|dbj|BAD79834.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81170150|gb|ABB58490.1| DNA-cytosine methyltransferase [Synechococcus elongatus PCC 7942]
          Length = 424

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 58/114 (50%), Gaps = 22/114 (19%)

Query: 8   VPQRRERLYIIDFLNPSVEF---KFPTPLGIKPRLGDIL-----------------EEHI 47
           VPQ RER+YI+ F    V F    F  P      + DIL                 E  +
Sbjct: 234 VPQHRERIYIVGF-REEVGFNWDSFSQPPTDTKCMADILHPNDGSEEVEEPYTVGIEAKV 292

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +DK T+S+KLW   Q     ++ AG GFG+GL  ++S    TLSARYYKDGSEI
Sbjct: 293 NDKYTLSDKLWNYLQNYANKHRAAGNGFGFGLVNKDS-IARTLSARYYKDGSEI 345


>gi|114571596|ref|YP_758276.1| DNA-cytosine methyltransferase [Maricaulis maris MCS10]
 gi|114342058|gb|ABI67338.1| DNA-cytosine methyltransferase [Maricaulis maris MCS10]
          Length = 406

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 10/102 (9%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFP------TPLGIKPRLGDILEEH--IDDKSTISNKLWE 59
           VPQ+RER++I+ F + S +F F             P L  IL+ H  I  K T++ KLW+
Sbjct: 228 VPQKRERVFIVGFRD-STDFSFEGFERLIPHASNHPTLDSILQSHNEIGQKYTLTEKLWD 286

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             Q  ++ ++  G GFGY LF  +     TLSARY+KDGSEI
Sbjct: 287 YLQAYRQKHESKGNGFGYSLFGPDD-VARTLSARYHKDGSEI 327


>gi|328947602|ref|YP_004364939.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
 gi|328447926|gb|AEB13642.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
          Length = 431

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 59/117 (50%), Gaps = 24/117 (20%)

Query: 8   VPQRRERLYIIDFLN------------PSVEFKFPTPL----GIKPRLGDILEEHID--- 48
           VPQ RER+ I+ F N            P  E K  + L    G +PRL    +++ D   
Sbjct: 233 VPQHRERIVIVGFRNKVDFSLEDMELPPKGEVKLASILHKTDGTEPRLPQDGDKYFDFEN 292

Query: 49  ----DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
               DK T+++ LW   Q   + ++  G GFGYGL  EN     TLSARYYKDGSEI
Sbjct: 293 NKVLDKYTLTDNLWAYLQAYAQKHRSMGNGFGYGLVNEND-IARTLSARYYKDGSEI 348


>gi|261337441|ref|ZP_05965325.1| modification methylase HpaII [Bifidobacterium gallicum DSM 20093]
 gi|270277829|gb|EFA23683.1| modification methylase HpaII [Bifidobacterium gallicum DSM 20093]
          Length = 442

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 62/119 (52%), Gaps = 29/119 (24%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILE------------------- 44
           VPQ RER+YI+ F + +     + KFP     +P L DIL                    
Sbjct: 231 VPQHRERIYIVGFCSKTDFTWDDLKFPDH---QPILADILHKTDGTEPYLPWDGDKYFDF 287

Query: 45  EH--IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           EH  + DK T++ +LW+  Q  ++ ++  G GFGYGL   +   + TLSARY+KDGSEI
Sbjct: 288 EHQKVQDKYTLTPRLWQYLQDYRKKHEALGHGFGYGLVTPD-MVSRTLSARYHKDGSEI 345


>gi|10957343|ref|NP_058367.1| DNA cytosine methylase [Salmonella typhi]
 gi|7800396|gb|AAF69992.1|AF250878_153 EcoRII cytosine methylase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|145849042|emb|CAM91602.1| ecoRII cytosine methylase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 475

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 15/105 (14%)

Query: 9   PQRRERLYIIDFLN----------PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           PQ RER+ ++ F              V   +P+    +P LG++L+  +D +  +S KLW
Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSR---RPTLGELLDAEVDSRYILSPKLW 334

Query: 59  EGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
           E      + ++  G GFG+GL    + S    TLSARYY+DGSEI
Sbjct: 335 EYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379


>gi|313651376|gb|EFS15772.1| modification methylase EcoRII [Shigella flexneri 2a str. 2457T]
          Length = 463

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 15/105 (14%)

Query: 9   PQRRERLYIIDFLN----------PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           PQ RER+ ++ F              V   +P+    +P LG++L+  +D +  +S KLW
Sbjct: 266 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSR---RPTLGELLDAEVDSRYILSPKLW 322

Query: 59  EGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
           E      + ++  G GFG+GL    + S    TLSARYY+DGSEI
Sbjct: 323 EYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 367


>gi|18466581|ref|NP_569389.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|160431784|ref|YP_001551898.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis]
 gi|16505897|emb|CAD09776.1| putative DNA modification methylase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|159885325|dbj|BAF92929.1| putative DNA modification methylase [Salmonella enterica subsp.
           enterica serovar Choleraesuis]
          Length = 475

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 15/105 (14%)

Query: 9   PQRRERLYIIDFLN----------PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           PQ RER+ ++ F              V   +P+    +P LG++L+  +D +  +S KLW
Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSR---RPTLGELLDAEVDSRYILSPKLW 334

Query: 59  EGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
           E      + ++  G GFG+GL    + S    TLSARYY+DGSEI
Sbjct: 335 EYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379


>gi|260752101|ref|YP_003237616.1| putative DNA modification methylase [Escherichia coli O111:H- str.
           11128]
 gi|257767571|dbj|BAI39065.1| putative DNA modification methylase [Escherichia coli O111:H- str.
           11128]
          Length = 475

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 15/105 (14%)

Query: 9   PQRRERLYIIDFLN----------PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           PQ RER+ ++ F              V   +P+    +P LG++L+  +D +  +S KLW
Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSR---RPTLGELLDAEVDSRYILSPKLW 334

Query: 59  EGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
           E      + ++  G GFG+GL    + S    TLSARYY+DGSEI
Sbjct: 335 EYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379


>gi|212716092|ref|ZP_03324220.1| hypothetical protein BIFCAT_01005 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661459|gb|EEB22034.1| hypothetical protein BIFCAT_01005 [Bifidobacterium catenulatum DSM
           16992]
          Length = 453

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 45/119 (37%), Positives = 60/119 (50%), Gaps = 29/119 (24%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILE------------------- 44
           VPQ RER+YI+ F + +     + K P     KP L DIL                    
Sbjct: 242 VPQHRERIYIVGFRSHTDFTWDDLKLPEH---KPVLADILHKNDGTEPYLPWDGDRYFDY 298

Query: 45  EH--IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           EH  + DK T++ +LW+  Q  K  ++  G GFGYGL   +   + TLSARY+KDGSEI
Sbjct: 299 EHNKVQDKYTLTPRLWQYLQDYKAKHEAMGHGFGYGLVTPD-MVSRTLSARYHKDGSEI 356


>gi|148244085|ref|YP_001220322.1| DNA-cytosine methyltransferase [Acidiphilium cryptum JF-5]
 gi|146400648|gb|ABQ29180.1| DNA-cytosine methyltransferase [Acidiphilium cryptum JF-5]
          Length = 487

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 56/116 (48%), Gaps = 24/116 (20%)

Query: 8   VPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRLGDILEEH---------------- 46
           VPQ RER++I  F + + EF F     P P    PRL  IL                   
Sbjct: 291 VPQHRERIFIAGFRDRNAEFTFKTLDIPDPAS-GPRLASILHPEDGTEKPDGHFTEGPLA 349

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            + ++ T+++ LW   Q   E ++ AG GFG+GL         TLSARYYKDGSEI
Sbjct: 350 TVTERYTLTDHLWNYLQNYAEKHRRAGNGFGFGLCGPED-VARTLSARYYKDGSEI 404


>gi|226942156|ref|YP_002797230.1| Cytosine-specific methyltransferase [Laribacter hongkongensis
           HLHK9]
 gi|226717083|gb|ACO76221.1| Cytosine-specific methyltransferase [Laribacter hongkongensis
           HLHK9]
          Length = 420

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 59/117 (50%), Gaps = 26/117 (22%)

Query: 9   PQRRERLYIIDFLNPSVEFKF---PTPL--------------GIKPRL---GDILEEH-- 46
           PQ RER+ I  F  P V F +   P P               G +P L   GD   +H  
Sbjct: 231 PQHRERILIAGFREP-VAFDWDAIPLPPKGSRTLRTVLHRTDGSEPVLPWDGDRFFDHQA 289

Query: 47  --IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             + DK T++ KLW+  Q   E ++  G GFG+GL   +S  T TLSARYYKDGSEI
Sbjct: 290 RCVQDKYTLTPKLWDYLQAYAEKHRAKGNGFGFGLVGPDS-VTRTLSARYYKDGSEI 345


>gi|254251049|ref|ZP_04944367.1| Site-specific DNA methylase [Burkholderia dolosa AUO158]
 gi|124893658|gb|EAY67538.1| Site-specific DNA methylase [Burkholderia dolosa AUO158]
          Length = 530

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 45/116 (38%), Positives = 56/116 (48%), Gaps = 24/116 (20%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIK------------PRL---GDILEEH--- 46
           PQ RER+ I+ F  P+       + P   GIK            PRL   GD   +H   
Sbjct: 331 PQHRERIVIVGFREPTPFSWESLQLPEKGGIKMKDILHKLDGSEPRLEHDGDRYFDHEKQ 390

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            ++DK T++  LW+  Q     +K  G GFGYGL         TLSARYYKDGSEI
Sbjct: 391 KVNDKYTLTPNLWKYLQDYAAKHKAKGNGFGYGLVGPED-IARTLSARYYKDGSEI 445


>gi|126464142|ref|YP_001045255.1| DNA-cytosine methyltransferase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105953|gb|ABN78483.1| DNA-cytosine methyltransferase [Rhodobacter sphaeroides ATCC 17029]
          Length = 417

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 59/116 (50%), Gaps = 23/116 (19%)

Query: 8   VPQRRERLYIIDF---LNPSVEF-KFPTPLGIK-PRLGDIL-----------------EE 45
           VPQ RER++I+     L+  ++  K   P G+  PR G +L                 E 
Sbjct: 222 VPQHRERIFIVGVRKDLDMKIDLSKLVLPSGVTGPRFGTVLHKEDGSELPNNRSFLDPEG 281

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            + D+ T+S+KLW+  Q   E ++  G GFG+GL         TLSARY+KDGSEI
Sbjct: 282 RVSDRYTLSDKLWKYLQDYAEKHRQKGNGFGFGL-TRRGDVARTLSARYHKDGSEI 336


>gi|323968854|gb|EGB64190.1| DNA-cytosine methyltransferase [Escherichia coli TA007]
          Length = 272

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 4/57 (7%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSD 271


>gi|300899219|ref|ZP_07117494.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1]
 gi|300357175|gb|EFJ73045.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1]
          Length = 477

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F      G  P     L  +L+  ++ K  ++  LW+ 
Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 336

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 337 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|218695565|ref|YP_002403232.1| DNA cytosine methylase [Escherichia coli 55989]
 gi|256022383|ref|ZP_05436248.1| DNA cytosine methylase [Escherichia sp. 4_1_40B]
 gi|218352297|emb|CAU98056.1| DNA cytosine methylase [Escherichia coli 55989]
 gi|323972739|gb|EGB67939.1| DNA-cytosine methyltransferase [Escherichia coli TA007]
 gi|332343686|gb|AEE57020.1| DNA-cytosine methyltransferase [Escherichia coli UMNK88]
          Length = 472

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F      G  P     L  +L+  ++ K  ++  LW+ 
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 331

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|301029418|ref|ZP_07192512.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1]
 gi|299877722|gb|EFI85933.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1]
          Length = 476

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F      G  P     L  +L+  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378


>gi|193071315|ref|ZP_03052233.1| DNA-cytosine methyltransferase [Escherichia coli E110019]
 gi|331683510|ref|ZP_08384111.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299]
 gi|192955357|gb|EDV85842.1| DNA-cytosine methyltransferase [Escherichia coli E110019]
 gi|331079725|gb|EGI50922.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299]
          Length = 472

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F      G  P     L  +L+  ++ K  ++  LW+ 
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 331

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|186476891|ref|YP_001858361.1| DNA-cytosine methyltransferase [Burkholderia phymatum STM815]
 gi|184193350|gb|ACC71315.1| DNA-cytosine methyltransferase [Burkholderia phymatum STM815]
          Length = 428

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 55/118 (46%), Gaps = 29/118 (24%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45
           PQ RER+ +I F   +     + + P      PRL  IL                     
Sbjct: 237 PQHRERIIMIGFRARTSFSWDDLRLPEE---GPRLASILHRTDGTEPVLPWDGDRFFDHA 293

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             H+  K T++ KLW   Q   + ++ AG GFGYG+ +  S  T TLSARY+KDGSEI
Sbjct: 294 ARHVQPKYTLTPKLWTYLQNYADKHRAAGNGFGYGMAYPQS-VTRTLSARYHKDGSEI 350


>gi|82776352|ref|YP_402701.1| DNA cytosine methylase [Shigella dysenteriae Sd197]
 gi|309789422|ref|ZP_07684012.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1617]
 gi|81240500|gb|ABB61210.1| DNA cytosine methylase [Shigella dysenteriae Sd197]
 gi|308922816|gb|EFP68333.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1617]
          Length = 472

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F      G  P     L  +L+  ++ K  ++  LW+ 
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 331

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|311279100|ref|YP_003941331.1| DNA-cytosine methyltransferase [Enterobacter cloacae SCF1]
 gi|308748295|gb|ADO48047.1| DNA-cytosine methyltransferase [Enterobacter cloacae SCF1]
          Length = 492

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 37/103 (35%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN    F      G+    +P  G++LE  +D K  ++  LW+ 
Sbjct: 293 LPQHRERIVLVGFRRDLNLHQGFSLRALPGLYPAQRPTFGELLEPTVDAKFILTPVLWKY 352

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYGL    +  +   TLSARYYKDG+EI
Sbjct: 353 LYRYAKKHQARGNGFGYGLVDPTNPDSVARTLSARYYKDGAEI 395


>gi|261340425|ref|ZP_05968283.1| DNA (cytosine-5-)-methyltransferase [Enterobacter cancerogenus ATCC
           35316]
 gi|288317516|gb|EFC56454.1| DNA (cytosine-5-)-methyltransferase [Enterobacter cancerogenus ATCC
           35316]
          Length = 477

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F       +    +P + D+LE  +D K  ++  LW+ 
Sbjct: 277 LPQHRERIVLVGFRRDLNLMGDFTLRNLPALYPARRPTIADLLEPAVDAKFILTPVLWKY 336

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFG+G+   N   + T TLSARYYKDG+EI
Sbjct: 337 LYRYAKKHQAKGNGFGFGMVNPNDPHSVTRTLSARYYKDGAEI 379


>gi|296103580|ref|YP_003613726.1| DNA cytosine methylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058039|gb|ADF62777.1| DNA cytosine methylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 471

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 37/103 (35%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F       +    +P + D+LE  +D K  ++  LW+ 
Sbjct: 271 LPQHRERIVLVGFRRDLNLKGDFTLRDIPSLYPARRPSVADLLEPAVDAKFILTPVLWKY 330

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFG+GL   N     T TLSARYYKDG+EI
Sbjct: 331 LYRYAKKHQAKGNGFGFGLVNPNDPHCVTRTLSARYYKDGAEI 373


>gi|37524351|ref|NP_927695.1| DNA cytosine methylase [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|36783775|emb|CAE12633.1| DNA-cytosine methyltransferase [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 478

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        FP     +P L D+LE  +D K  ++  L
Sbjct: 281 LPQHRERIVLVGFRKDLNIHQGFTLRDISRYFPKE---RPTLADLLEPEVDSKYILTPNL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+        ++  G GFG+GL   N+  + T TLSARY+KDGSEI
Sbjct: 338 WKYLYNYARKHQAKGNGFGFGLIDPNNKDSVTRTLSARYHKDGSEI 383


>gi|163732386|ref|ZP_02139832.1| hypothetical protein RLO149_03007 [Roseobacter litoralis Och 149]
 gi|161394684|gb|EDQ19007.1| hypothetical protein RLO149_03007 [Roseobacter litoralis Och 149]
          Length = 410

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 45/114 (39%), Positives = 57/114 (50%), Gaps = 22/114 (19%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDIL---------EEH--------I 47
           VPQ RER+ I+ F    V F F     P   + R+ DIL         E H        +
Sbjct: 222 VPQHRERIVIVGF-REDVPFSFDDVILPPHRERRMRDILHPENGNENPESHFTLGNDAAV 280

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             K T+S+KLW+  Q     +K  G GFG+GL  +  +   TLSARYYKDGSEI
Sbjct: 281 SGKYTLSDKLWKYLQDYAAKHKAKGNGFGFGL-VDGDSIARTLSARYYKDGSEI 333


>gi|300904853|ref|ZP_07122678.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1]
 gi|301304244|ref|ZP_07210359.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1]
 gi|300403236|gb|EFJ86774.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1]
 gi|300840501|gb|EFK68261.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1]
 gi|315257206|gb|EFU37174.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 85-1]
          Length = 472

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + +++ G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQVRGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|237732007|ref|ZP_04562488.1| DNA cytosine methylase [Citrobacter sp. 30_2]
 gi|226907546|gb|EEH93464.1| DNA cytosine methylase [Citrobacter sp. 30_2]
          Length = 476

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F     +   P+    L ++LE  +D K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKSDFTLRDIVTRYPQRRTTLAELLEPTVDAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ +  +  + T TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPGNPDSVTRTLSARYYKDGAEI 378


>gi|188494720|ref|ZP_03001990.1| DNA-cytosine methyltransferase [Escherichia coli 53638]
 gi|188489919|gb|EDU65022.1| DNA-cytosine methyltransferase [Escherichia coli 53638]
          Length = 472

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   +N   +F      G  P     L  +L+  ++ K  ++  LW+ 
Sbjct: 272 LPQHRERIVLVGFRRDINLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPVLWKY 331

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|324112381|gb|EGC06359.1| DNA-cytosine methyltransferase [Escherichia fergusonii B253]
          Length = 473

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G +LE  +D K  +S KL
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQ---RPLFGQLLESSVDSKYILSPKL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101
           W+      + +   G GFG+GL   N+A +   TLSARY+KDGSEI
Sbjct: 338 WQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 383


>gi|325499566|gb|EGC97425.1| DNA cytosine methylase [Escherichia fergusonii ECD227]
          Length = 473

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G +LE  +D K  +S KL
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQ---RPLFGQLLESSVDSKYILSPKL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101
           W+      + +   G GFG+GL   N+A +   TLSARY+KDGSEI
Sbjct: 338 WQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 383


>gi|291085206|ref|ZP_06352388.2| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC
           29220]
 gi|291072321|gb|EFE10430.1| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC
           29220]
          Length = 476

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   L    +F         PR    L D+LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLQLKSDFTLRNIATCYPRRRTTLADLLEPTVEAKYVLTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ +  +    T TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPGNPDCVTRTLSARYYKDGAEI 378


>gi|218551294|ref|YP_002385086.1| DNA cytosine methylase [Escherichia fergusonii ATCC 35469]
 gi|218358836|emb|CAQ91493.1| DNA modification methylase [Escherichia fergusonii ATCC 35469]
          Length = 485

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G +LE  +D K  +S KL
Sbjct: 293 LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQ---RPLFGQLLESSVDSKYILSPKL 349

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101
           W+      + +   G GFG+GL   N+A +   TLSARY+KDGSEI
Sbjct: 350 WQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 395


>gi|170769440|ref|ZP_02903893.1| DNA-cytosine methyltransferase [Escherichia albertii TW07627]
 gi|170121764|gb|EDS90695.1| DNA-cytosine methyltransferase [Escherichia albertii TW07627]
          Length = 472

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        FPT    +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKASFTLRDINQCFPTQ---RVTLAQLLDPVVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|209520785|ref|ZP_03269531.1| DNA-cytosine methyltransferase [Burkholderia sp. H160]
 gi|209498782|gb|EDZ98891.1| DNA-cytosine methyltransferase [Burkholderia sp. H160]
          Length = 432

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 55/118 (46%), Gaps = 29/118 (24%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45
           PQ RER+ I+ F   +     + + P      PRLG IL                     
Sbjct: 238 PQHRERIIIVGFRGETTFTWDDLRLPEQ---GPRLGAILHRKDGSEPVLPWDHDRFFDHA 294

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              +  K T++ KLW   Q     ++ AG GFG+GL + +S  T TLSARY+KDGSEI
Sbjct: 295 ARRVQPKYTLTPKLWAYLQNYAAKHRAAGNGFGFGLAYPDS-VTRTLSARYHKDGSEI 351


>gi|157158517|ref|YP_001463262.1| DNA cytosine methylase [Escherichia coli E24377A]
 gi|157080547|gb|ABV20255.1| DNA-cytosine methyltransferase [Escherichia coli E24377A]
          Length = 472

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDSMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|238783073|ref|ZP_04627100.1| Modification methylase EcoRII [Yersinia bercovieri ATCC 43970]
 gi|238716074|gb|EEQ08059.1| Modification methylase EcoRII [Yersinia bercovieri ATCC 43970]
          Length = 475

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +P  G++LE  +DDK  ++  L
Sbjct: 281 LPQHRERIVLVGFRKDLNIDKDFTLKDIHKFFPEK---RPTFGELLEPVVDDKYILTPHL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
           W+      + ++  G GFG+GL     + +   TLSARY+KDGSEI
Sbjct: 338 WKYLYNYAKKHQAKGNGFGFGLVDPTNSDSVARTLSARYHKDGSEI 383


>gi|323186716|gb|EFZ72038.1| DNA-cytosine methyltransferase [Escherichia coli RN587/1]
          Length = 472

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|215487159|ref|YP_002329590.1| DNA cytosine methylase [Escherichia coli O127:H6 str. E2348/69]
 gi|312967158|ref|ZP_07781376.1| DNA-cytosine methyltransferase [Escherichia coli 2362-75]
 gi|215265231|emb|CAS09622.1| DNA cytosine methylase [Escherichia coli O127:H6 str. E2348/69]
 gi|312288622|gb|EFR16524.1| DNA-cytosine methyltransferase [Escherichia coli 2362-75]
          Length = 472

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|152970972|ref|YP_001336081.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150955821|gb|ABR77851.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 477

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDFLNP----------SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F              +  ++P    ++P  G++LE  +D K  ++  L
Sbjct: 277 LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYP---AVRPTFGELLEPTVDSKFILTPVL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
           W+   +    ++  G GFGYGL       +   TLSARYYKDG+EI
Sbjct: 334 WKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379


>gi|187923141|ref|YP_001894783.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN]
 gi|187714335|gb|ACD15559.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN]
          Length = 426

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 54/118 (45%), Gaps = 29/118 (24%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45
           PQ RER+ I+ F   +     + + P      PRLG IL                     
Sbjct: 232 PQHRERIIIVGFRGKTAFSWDDLRLPQD---GPRLGSILHRTDGSEPVLPWDHDRFFDHA 288

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              +  K T++  LW   Q   E ++ AG GFG+G+ +  S  T TLSARY+KDGSEI
Sbjct: 289 GRRVQPKYTLTPNLWTYLQNYAEKHRAAGNGFGFGMAYPTS-VTRTLSARYHKDGSEI 345


>gi|213581465|ref|ZP_03363291.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
          Length = 295

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 108 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 167

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 168 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 210


>gi|119355933|ref|YP_910577.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides DSM
           266]
 gi|119353282|gb|ABL64153.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides DSM
           266]
          Length = 425

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 57/114 (50%), Gaps = 21/114 (18%)

Query: 8   VPQRRERLYIIDFL-NPSVEF-KFPTPLG-IKPRLGDILE-----------------EHI 47
           VPQ RER++I  F  +    F +F  P G  +P +  IL                    I
Sbjct: 224 VPQHRERIFIAGFREDCGFSFDRFDLPHGNERPVIETILHPENGMEDEEPPYTVGPLARI 283

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            D+ T+S+ LWE  QK  E ++  G GFG+GL   +     TLSARYYKDGSEI
Sbjct: 284 SDRYTLSDHLWEYLQKYAEKHRAKGNGFGFGLVGPHD-VARTLSARYYKDGSEI 336


>gi|62180565|ref|YP_216982.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62128198|gb|AAX65901.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322715041|gb|EFZ06612.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|322616984|gb|EFY13892.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322618223|gb|EFY15115.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322625894|gb|EFY22713.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626346|gb|EFY23156.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322632761|gb|EFY29506.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322639103|gb|EFY35796.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322640419|gb|EFY37075.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322647220|gb|EFY43719.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322648528|gb|EFY44979.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655540|gb|EFY51848.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322660318|gb|EFY56556.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662999|gb|EFY59206.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322668184|gb|EFY64343.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322674057|gb|EFY70151.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675591|gb|EFY71665.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682998|gb|EFY79014.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686692|gb|EFY82670.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323195420|gb|EFZ80600.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323198052|gb|EFZ83169.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323204476|gb|EFZ89482.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207566|gb|EFZ92514.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323210995|gb|EFZ95855.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323217551|gb|EGA02270.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323226697|gb|EGA10894.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231573|gb|EGA15686.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323236016|gb|EGA20095.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240586|gb|EGA24629.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245478|gb|EGA29478.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323247596|gb|EGA31547.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323254424|gb|EGA38240.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257764|gb|EGA41444.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323262129|gb|EGA45692.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323266252|gb|EGA49742.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323270729|gb|EGA54168.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPGSVARTLSARYYKDGAEI 378


>gi|168462467|ref|ZP_02696398.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194443436|ref|YP_002041256.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|238912436|ref|ZP_04656273.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|194402099|gb|ACF62321.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|195634356|gb|EDX52708.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|168239231|ref|ZP_02664289.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194734985|ref|YP_002115026.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|204931362|ref|ZP_03222061.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|194710487|gb|ACF89708.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288080|gb|EDY27467.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|204319845|gb|EDZ05054.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|167552776|ref|ZP_02346527.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205322616|gb|EDZ10455.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|161613440|ref|YP_001587405.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|205352316|ref|YP_002226117.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207856496|ref|YP_002243147.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|161362804|gb|ABX66572.1| hypothetical protein SPAB_01156 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205272097|emb|CAR36949.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206708299|emb|CAR32602.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326627365|gb|EGE33708.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|200390041|ref|ZP_03216652.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199602486|gb|EDZ01032.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|168259722|ref|ZP_02681695.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|205351069|gb|EDZ37700.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNISRCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|197251440|ref|YP_002146032.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197215143|gb|ACH52540.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|198242597|ref|YP_002215094.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|197937113|gb|ACH74446.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326622842|gb|EGE29187.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNISRCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|56413096|ref|YP_150171.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197362022|ref|YP_002141659.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56127353|gb|AAV76859.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197093499|emb|CAR58960.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|224583511|ref|YP_002637309.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224468038|gb|ACN45868.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|168244842|ref|ZP_02669774.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194449372|ref|YP_002046042.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194407676|gb|ACF67895.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205336375|gb|EDZ23139.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|168234164|ref|ZP_02659222.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168821682|ref|ZP_02833682.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194470868|ref|ZP_03076852.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197263635|ref|ZP_03163709.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|194457232|gb|EDX46071.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197241890|gb|EDY24510.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205331847|gb|EDZ18611.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205341769|gb|EDZ28533.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320085391|emb|CBY95172.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|331668651|ref|ZP_08369499.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271]
 gi|331063845|gb|EGI35756.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271]
          Length = 458

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 258 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 314

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 315 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 360


>gi|309795932|ref|ZP_07690345.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7]
 gi|308120382|gb|EFO57644.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|301018179|ref|ZP_07182696.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1]
 gi|300399832|gb|EFJ83370.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|16765328|ref|NP_460943.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167993566|ref|ZP_02574660.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|16420526|gb|AAL20902.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|205328427|gb|EDZ15191.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261247157|emb|CBG24980.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993981|gb|ACY88866.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301158505|emb|CBW18015.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912981|dbj|BAJ36955.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321224636|gb|EFX49699.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323130270|gb|ADX17700.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332988880|gb|AEF07863.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|260855934|ref|YP_003229825.1| DNA cytosine methylase [Escherichia coli O26:H11 str. 11368]
 gi|300822269|ref|ZP_07102410.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7]
 gi|257754583|dbj|BAI26085.1| DNA cytosine methylase [Escherichia coli O26:H11 str. 11368]
 gi|300525152|gb|EFK46221.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7]
 gi|309702249|emb|CBJ01566.1| DNA-cytosine methyltransferase [Escherichia coli ETEC H10407]
 gi|323937230|gb|EGB33510.1| DNA-cytosine methyltransferase [Escherichia coli E1520]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|16760934|ref|NP_456551.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29141374|ref|NP_804716.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|213424982|ref|ZP_03357732.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|289829483|ref|ZP_06547095.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|25286126|pir||AH0754 site-specific DNA-methyltransferase (cytosine-specific) (EC
           2.1.1.73) - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16503231|emb|CAD05739.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137001|gb|AAO68565.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|157161430|ref|YP_001458748.1| DNA cytosine methylase [Escherichia coli HS]
 gi|157067110|gb|ABV06365.1| DNA-cytosine methyltransferase [Escherichia coli HS]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQTRGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|331653374|ref|ZP_08354379.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718]
 gi|331049472|gb|EGI21544.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|46581246|ref|YP_012054.1| type II DNA modification methyltransferase [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|46450667|gb|AAS97314.1| type II DNA modification methyltransferase, putative [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311234912|gb|ADP87766.1| DNA-cytosine methyltransferase [Desulfovibrio vulgaris RCH1]
          Length = 358

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 55/109 (50%), Gaps = 15/109 (13%)

Query: 8   VPQRRERLYIIDFLNPSV-------------EFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           +PQ RER++++ F  P               +F   +  G +  L  ++E  + +K T+ 
Sbjct: 172 IPQHRERIFMVGFRLPEACPAGAQKWDVKDFDFGKVSRRGSQKDLESVIEPDVPEKYTLG 231

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
              W    + K N+   G+GFGYG+     A  TT TLSARY+KDG+EI
Sbjct: 232 PGTWNTLVRHKANHAAKGQGFGYGMITPPFAGQTTRTLSARYHKDGAEI 280


>gi|320641809|gb|EFX11197.1| DNA cytosine methylase [Escherichia coli O157:H7 str. G5101]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|307138628|ref|ZP_07497984.1| DNA cytosine methylase [Escherichia coli H736]
 gi|331642581|ref|ZP_08343716.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736]
 gi|331039379|gb|EGI11599.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|291283137|ref|YP_003499955.1| DNA-cytosine methyltransferase [Escherichia coli O55:H7 str.
           CB9615]
 gi|209766674|gb|ACI81649.1| DNA cytosine methylase [Escherichia coli]
 gi|290763010|gb|ADD56971.1| DNA-cytosine methyltransferase [Escherichia coli O55:H7 str.
           CB9615]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|91211180|ref|YP_541166.1| DNA cytosine methylase [Escherichia coli UTI89]
 gi|117624099|ref|YP_853012.1| DNA cytosine methylase [Escherichia coli APEC O1]
 gi|218558817|ref|YP_002391730.1| DNA cytosine methylase [Escherichia coli S88]
 gi|91072754|gb|ABE07635.1| DNA cytosine methylase [Escherichia coli UTI89]
 gi|115513223|gb|ABJ01298.1| DNA cytosine methylase [Escherichia coli APEC O1]
 gi|218365586|emb|CAR03313.1| DNA cytosine methylase [Escherichia coli S88]
 gi|294492656|gb|ADE91412.1| DNA-cytosine methyltransferase [Escherichia coli IHE3034]
 gi|307626564|gb|ADN70868.1| DNA cytosine methylase [Escherichia coli UM146]
 gi|323952452|gb|EGB48325.1| DNA-cytosine methyltransferase [Escherichia coli H252]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323977859|gb|EGB72945.1| DNA-cytosine methyltransferase [Escherichia coli TW10509]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLREISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323962004|gb|EGB57603.1| DNA-cytosine methyltransferase [Escherichia coli H489]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|15802395|ref|NP_288421.1| DNA cytosine methylase [Escherichia coli O157:H7 EDL933]
 gi|15831953|ref|NP_310726.1| DNA cytosine methylase [Escherichia coli O157:H7 str. Sakai]
 gi|16129907|ref|NP_416470.1| DNA cytosine methyltransferase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89108792|ref|AP_002572.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. W3110]
 gi|168752207|ref|ZP_02777229.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758275|ref|ZP_02783282.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168771615|ref|ZP_02796622.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777717|ref|ZP_02802724.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783359|ref|ZP_02808366.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789321|ref|ZP_02814328.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC869]
 gi|168801737|ref|ZP_02826744.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC508]
 gi|170081604|ref|YP_001730924.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. DH10B]
 gi|195939267|ref|ZP_03084649.1| DNA cytosine methylase [Escherichia coli O157:H7 str. EC4024]
 gi|208810340|ref|ZP_03252216.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816602|ref|ZP_03257722.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821263|ref|ZP_03261583.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400193|ref|YP_002271076.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209919382|ref|YP_002293466.1| DNA cytosine methylase [Escherichia coli SE11]
 gi|217328629|ref|ZP_03444710.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218689956|ref|YP_002398168.1| DNA cytosine methylase [Escherichia coli ED1a]
 gi|238901165|ref|YP_002926961.1| DNA cytosine methylase [Escherichia coli BW2952]
 gi|253773091|ref|YP_003035922.1| DNA cytosine methylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254793611|ref|YP_003078448.1| DNA cytosine methylase [Escherichia coli O157:H7 str. TW14359]
 gi|256017846|ref|ZP_05431711.1| DNA cytosine methylase [Shigella sp. D9]
 gi|261227545|ref|ZP_05941826.1| DNA cytosine methylase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254631|ref|ZP_05947164.1| DNA cytosine methylase [Escherichia coli O157:H7 str. FRIK966]
 gi|293415271|ref|ZP_06657914.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli B185]
 gi|300818618|ref|ZP_07098826.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1]
 gi|300920181|ref|ZP_07136630.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1]
 gi|301327749|ref|ZP_07220953.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1]
 gi|301644580|ref|ZP_07244570.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1]
 gi|307312454|ref|ZP_07592088.1| DNA-cytosine methyltransferase [Escherichia coli W]
 gi|312973821|ref|ZP_07787993.1| DNA-cytosine methyltransferase [Escherichia coli 1827-70]
 gi|332278872|ref|ZP_08391285.1| DNA cytosine methylase [Shigella sp. D9]
 gi|83305674|sp|P0AEE0|DCM_ECO57 RecName: Full=DNA-cytosine methyltransferase
 gi|83305675|sp|P0AED9|DCM_ECOLI RecName: Full=DNA-cytosine methyltransferase; AltName:
           Full=M.EcoDcm
 gi|12516070|gb|AAG56975.1|AE005418_3 DNA cytosine methylase [Escherichia coli O157:H7 str. EDL933]
 gi|41239|emb|CAA31705.1| unnamed protein product [Escherichia coli K-12]
 gi|145719|gb|AAA03723.1| DNA cytosine methylase [Escherichia coli]
 gi|1736630|dbj|BAA15788.1| DNA cytosine methylase [Escherichia coli str. K12 substr. W3110]
 gi|1788271|gb|AAC75027.1| DNA cytosine methyltransferase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13362167|dbj|BAB36122.1| DNA cytosine methylase [Escherichia coli O157:H7 str. Sakai]
 gi|169889439|gb|ACB03146.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. DH10B]
 gi|187767102|gb|EDU30946.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188013903|gb|EDU52025.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999305|gb|EDU68291.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354901|gb|EDU73320.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359668|gb|EDU78087.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189371047|gb|EDU89463.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC869]
 gi|189376137|gb|EDU94553.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC508]
 gi|208724856|gb|EDZ74563.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208730945|gb|EDZ79634.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741386|gb|EDZ89068.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161593|gb|ACI39026.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209766668|gb|ACI81646.1| DNA cytosine methylase [Escherichia coli]
 gi|209766670|gb|ACI81647.1| DNA cytosine methylase [Escherichia coli]
 gi|209766672|gb|ACI81648.1| DNA cytosine methylase [Escherichia coli]
 gi|209766676|gb|ACI81650.1| DNA cytosine methylase [Escherichia coli]
 gi|209912641|dbj|BAG77715.1| DNA cytosine methylase [Escherichia coli SE11]
 gi|217317976|gb|EEC26403.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218427520|emb|CAR08415.2| DNA cytosine methylase [Escherichia coli ED1a]
 gi|238860813|gb|ACR62811.1| DNA cytosine methylase [Escherichia coli BW2952]
 gi|253324135|gb|ACT28737.1| DNA-cytosine methyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254593011|gb|ACT72372.1| DNA cytosine methylase [Escherichia coli O157:H7 str. TW14359]
 gi|260448927|gb|ACX39349.1| DNA-cytosine methyltransferase [Escherichia coli DH1]
 gi|291432919|gb|EFF05898.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli B185]
 gi|300412803|gb|EFJ96113.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1]
 gi|300528790|gb|EFK49852.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1]
 gi|300845711|gb|EFK73471.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1]
 gi|301077088|gb|EFK91894.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1]
 gi|306907625|gb|EFN38128.1| DNA-cytosine methyltransferase [Escherichia coli W]
 gi|310332416|gb|EFP99651.1| DNA-cytosine methyltransferase [Escherichia coli 1827-70]
 gi|315061260|gb|ADT75587.1| DNA cytosine methylase [Escherichia coli W]
 gi|315136597|dbj|BAJ43756.1| DNA cytosine methylase [Escherichia coli DH1]
 gi|320191934|gb|EFW66581.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320198651|gb|EFW73251.1| DNA-cytosine methyltransferase [Escherichia coli EC4100B]
 gi|320647167|gb|EFX16000.1| DNA cytosine methylase [Escherichia coli O157:H- str. 493-89]
 gi|320652452|gb|EFX20750.1| DNA cytosine methylase [Escherichia coli O157:H- str. H 2687]
 gi|320658054|gb|EFX25816.1| DNA cytosine methylase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320658625|gb|EFX26319.1| DNA cytosine methylase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668523|gb|EFX35350.1| DNA cytosine methylase [Escherichia coli O157:H7 str. LSU-61]
 gi|323174657|gb|EFZ60277.1| DNA-cytosine methyltransferase [Escherichia coli LT-68]
 gi|323183944|gb|EFZ69331.1| DNA-cytosine methyltransferase [Escherichia coli 1357]
 gi|323378163|gb|ADX50431.1| DNA-cytosine methyltransferase [Escherichia coli KO11]
 gi|323948336|gb|EGB44323.1| DNA-cytosine methyltransferase [Escherichia coli H120]
 gi|326342371|gb|EGD66152.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. 1044]
 gi|326344875|gb|EGD68622.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. 1125]
 gi|332101224|gb|EGJ04570.1| DNA cytosine methylase [Shigella sp. D9]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|110642066|ref|YP_669796.1| DNA cytosine methylase [Escherichia coli 536]
 gi|191173268|ref|ZP_03034798.1| DNA-cytosine methyltransferase [Escherichia coli F11]
 gi|110343658|gb|ABG69895.1| DNA-cytosine methyltransferase [Escherichia coli 536]
 gi|190906385|gb|EDV65994.1| DNA-cytosine methyltransferase [Escherichia coli F11]
 gi|222033699|emb|CAP76440.1| DNA-cytosine methyltransferase [Escherichia coli LF82]
 gi|312946553|gb|ADR27380.1| DNA cytosine methylase [Escherichia coli O83:H1 str. NRG 857C]
 gi|324013473|gb|EGB82692.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 60-1]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300931174|ref|ZP_07146520.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1]
 gi|300461007|gb|EFK24500.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1]
          Length = 477

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 334 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|300975476|ref|ZP_07173024.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1]
 gi|300410366|gb|EFJ93904.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|74312499|ref|YP_310918.1| DNA cytosine methylase [Shigella sonnei Ss046]
 gi|73855976|gb|AAZ88683.1| DNA cytosine methylase [Shigella sonnei Ss046]
 gi|323168918|gb|EFZ54598.1| DNA-cytosine methyltransferase [Shigella sonnei 53G]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|295675907|ref|YP_003604431.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1002]
 gi|295435750|gb|ADG14920.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1002]
          Length = 430

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 55/118 (46%), Gaps = 29/118 (24%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45
           PQ RER+ I+ F   +     + + P      PRLG IL                     
Sbjct: 236 PQHRERIIIVGFRGKTAFTWDDLRLPDE---GPRLGAILHRTDGTEPVLPWDHDRFFDHA 292

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              +  K T++ KLW   Q     ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 293 TRRVQPKYTLTPKLWAYLQNYAAKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 349


>gi|284921868|emb|CBG34943.1| DNA-cytosine methyltransferase [Escherichia coli 042]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|259909642|ref|YP_002649998.1| DNA cytosine methylase [Erwinia pyrifoliae Ep1/96]
 gi|224965264|emb|CAX56796.1| Cytosine-specific methyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|261863687|gb|ACY01298.1| unknown [Erwinia pyrifoliae]
 gi|283479721|emb|CAY75637.1| DNA cytosine methylase [Erwinia pyrifoliae DSM 12163]
          Length = 473

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 55/106 (51%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        FP     +P  G +LE+ +D K  ++ +L
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQNFTLSNISRYFPDK---RPEFGSLLEKTVDSKYILTPRL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL     + +   TLSARY+KDGSEI
Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVDPTNSGSVARTLSARYHKDGSEI 383


>gi|218554541|ref|YP_002387454.1| DNA cytosine methylase [Escherichia coli IAI1]
 gi|260868553|ref|YP_003234955.1| DNA cytosine methylase [Escherichia coli O111:H- str. 11128]
 gi|218361309|emb|CAQ98893.1| DNA cytosine methylase [Escherichia coli IAI1]
 gi|257764909|dbj|BAI36404.1| DNA cytosine methylase [Escherichia coli O111:H- str. 11128]
 gi|323180787|gb|EFZ66327.1| DNA-cytosine methyltransferase [Escherichia coli 1180]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323968376|gb|EGB63783.1| DNA-cytosine methyltransferase [Escherichia coli M863]
 gi|327253092|gb|EGE64746.1| DNA-cytosine methyltransferase [Escherichia coli STEC_7v]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLREISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|218699478|ref|YP_002407107.1| DNA cytosine methylase [Escherichia coli IAI39]
 gi|218369464|emb|CAR17229.1| DNA cytosine methylase [Escherichia coli IAI39]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|315290247|gb|EFU49625.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 153-1]
          Length = 478

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 278 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 334

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 335 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 380


>gi|300940416|ref|ZP_07155001.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1]
 gi|300454810|gb|EFK18303.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378


>gi|288934555|ref|YP_003438614.1| DNA-cytosine methyltransferase [Klebsiella variicola At-22]
 gi|288889264|gb|ADC57582.1| DNA-cytosine methyltransferase [Klebsiella variicola At-22]
          Length = 466

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF-----LNPSVEFKFPTPL--GIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F     L+     +    L   ++P  G++LE  +D K  ++  LW+ 
Sbjct: 266 LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTVDAKFILTPVLWKY 325

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +    ++  G GFGYGL    +  +   TLSARYYKDG+EI
Sbjct: 326 LYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 368


>gi|170681403|ref|YP_001743285.1| DNA cytosine methylase [Escherichia coli SMS-3-5]
 gi|170519121|gb|ACB17299.1| DNA-cytosine methyltransferase [Escherichia coli SMS-3-5]
 gi|324119009|gb|EGC12898.1| DNA-cytosine methyltransferase [Escherichia coli E1167]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|82543581|ref|YP_407528.1| DNA cytosine methylase [Shigella boydii Sb227]
 gi|81244992|gb|ABB65700.1| DNA cytosine methylase [Shigella boydii Sb227]
 gi|332096894|gb|EGJ01883.1| DNA-cytosine methyltransferase [Shigella boydii 3594-74]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|187732725|ref|YP_001879611.1| DNA cytosine methylase [Shigella boydii CDC 3083-94]
 gi|293446340|ref|ZP_06662762.1| DNA-cytosine methyltransferase [Escherichia coli B088]
 gi|187429717|gb|ACD08991.1| DNA-cytosine methyltransferase [Shigella boydii CDC 3083-94]
 gi|291323170|gb|EFE62598.1| DNA-cytosine methyltransferase [Escherichia coli B088]
 gi|320175451|gb|EFW50550.1| DNA-cytosine methyltransferase [Shigella dysenteriae CDC 74-1112]
 gi|320184499|gb|EFW59303.1| DNA-cytosine methyltransferase [Shigella flexneri CDC 796-83]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|315286667|gb|EFU46100.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 110-3]
          Length = 475

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 275 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 331

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 332 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 377


>gi|331663456|ref|ZP_08364366.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143]
 gi|331059255|gb|EGI31232.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300923873|ref|ZP_07139889.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1]
 gi|300419870|gb|EFK03181.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1]
          Length = 477

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 334 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|300956520|ref|ZP_07168803.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1]
 gi|300316661|gb|EFJ66445.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1]
          Length = 477

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 334 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|293410317|ref|ZP_06653893.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291470785|gb|EFF13269.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|170019707|ref|YP_001724661.1| DNA cytosine methylase [Escherichia coli ATCC 8739]
 gi|169754635|gb|ACA77334.1| DNA-cytosine methyltransferase [Escherichia coli ATCC 8739]
 gi|323940380|gb|EGB36571.1| DNA-cytosine methyltransferase [Escherichia coli E482]
 gi|332093084|gb|EGI98148.1| DNA-cytosine methyltransferase [Shigella boydii 5216-82]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|191169235|ref|ZP_03030988.1| DNA-cytosine methyltransferase [Escherichia coli B7A]
 gi|190900713|gb|EDV60509.1| DNA-cytosine methyltransferase [Escherichia coli B7A]
          Length = 472

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|315296465|gb|EFU55762.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 16-3]
          Length = 476

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 333 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378


>gi|300994233|ref|ZP_07180788.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1]
 gi|300304943|gb|EFJ59463.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1]
          Length = 477

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 334 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|324018843|gb|EGB88062.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 117-3]
          Length = 472

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300951590|ref|ZP_07165422.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1]
 gi|300449174|gb|EFK12794.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1]
          Length = 478

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 278 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 334

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 335 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 380


>gi|218705454|ref|YP_002412973.1| DNA cytosine methylase [Escherichia coli UMN026]
 gi|293405443|ref|ZP_06649435.1| DNA cytosine methylase [Escherichia coli FVEC1412]
 gi|298381087|ref|ZP_06990686.1| DNA cytosine methylase [Escherichia coli FVEC1302]
 gi|218432551|emb|CAR13444.1| DNA cytosine methylase [Escherichia coli UMN026]
 gi|291427651|gb|EFF00678.1| DNA cytosine methylase [Escherichia coli FVEC1412]
 gi|298278529|gb|EFI20043.1| DNA cytosine methylase [Escherichia coli FVEC1302]
          Length = 472

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|238919389|ref|YP_002932904.1| DNA cytosine methylase [Edwardsiella ictaluri 93-146]
 gi|238868958|gb|ACR68669.1| modification methylase [Edwardsiella ictaluri 93-146]
          Length = 471

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F            KP  G++LE  +D K  +S KLWE 
Sbjct: 279 LPQHRERIVLVGFRRDLNIHHDFTLQKIQQFYPEKKPTFGELLEPAVDSKYILSPKLWEY 338

Query: 61  HQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
                + +   G GFG+GL       +   TLSARY+KDGSEI
Sbjct: 339 LYNYAKKHAEKGNGFGFGLVDPKNKESIARTLSARYHKDGSEI 381


>gi|206577074|ref|YP_002237693.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342]
 gi|206566132|gb|ACI07908.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342]
          Length = 477

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF-----LNPSVEFKFPTPL--GIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F     L+     +    L   ++P  G++LE  +D K  ++  LW+ 
Sbjct: 277 LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTVDAKFILTPVLWKY 336

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +    ++  G GFGYGL    +  +   TLSARYYKDG+EI
Sbjct: 337 LYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 379


>gi|193066646|ref|ZP_03047681.1| DNA-cytosine methyltransferase [Escherichia coli E22]
 gi|260844359|ref|YP_003222137.1| DNA cytosine methylase [Escherichia coli O103:H2 str. 12009]
 gi|192925721|gb|EDV80380.1| DNA-cytosine methyltransferase [Escherichia coli E22]
 gi|257759506|dbj|BAI31003.1| DNA cytosine methylase [Escherichia coli O103:H2 str. 12009]
          Length = 472

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|330911766|gb|EGH40276.1| DNA-cytosine methyltransferase [Escherichia coli AA86]
          Length = 472

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|301050676|ref|ZP_07197538.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1]
 gi|300297633|gb|EFJ54018.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1]
          Length = 477

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 277 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 334 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|26248232|ref|NP_754272.1| DNA cytosine methylase [Escherichia coli CFT073]
 gi|227885611|ref|ZP_04003416.1| DNA cytosine methylase [Escherichia coli 83972]
 gi|237705920|ref|ZP_04536401.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|331647554|ref|ZP_08348646.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605]
 gi|26108636|gb|AAN80839.1|AE016762_92 DNA-cytosine methyltransferase [Escherichia coli CFT073]
 gi|226900677|gb|EEH86936.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|227837184|gb|EEJ47650.1| DNA cytosine methylase [Escherichia coli 83972]
 gi|281179022|dbj|BAI55352.1| DNA cytosine methylase [Escherichia coli SE15]
 gi|307553973|gb|ADN46748.1| DNA cytosine methylase [Escherichia coli ABU 83972]
 gi|320194327|gb|EFW68958.1| DNA-cytosine methyltransferase [Escherichia coli WV_060327]
 gi|323956356|gb|EGB52099.1| DNA-cytosine methyltransferase [Escherichia coli H263]
 gi|324005878|gb|EGB75097.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 57-2]
 gi|331043278|gb|EGI15416.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605]
          Length = 472

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|295098276|emb|CBK87366.1| DNA-methyltransferase (dcm) [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 477

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F       +    +P + D+LE  +D K  ++  LW+ 
Sbjct: 277 LPQHRERIVLVGFRRDLNLKGDFTLRDLPSLYPARRPTVADLLEPAVDAKFILTPVLWKY 336

Query: 61  HQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
             +  + ++  G GFG+G+       + T TLSARYYKDG+EI
Sbjct: 337 LYRYAKKHQAKGNGFGFGMVNPLNPDSVTRTLSARYYKDGAEI 379


>gi|320182772|gb|EFW57655.1| DNA-cytosine methyltransferase [Shigella boydii ATCC 9905]
          Length = 472

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|24113334|ref|NP_707844.1| DNA cytosine methylase [Shigella flexneri 2a str. 301]
 gi|30063396|ref|NP_837567.1| DNA cytosine methylase [Shigella flexneri 2a str. 2457T]
 gi|110805927|ref|YP_689447.1| DNA cytosine methylase [Shigella flexneri 5 str. 8401]
 gi|24052347|gb|AAN43551.1| DNA cytosine methylase [Shigella flexneri 2a str. 301]
 gi|30041648|gb|AAP17376.1| DNA cytosine methylase [Shigella flexneri 2a str. 2457T]
 gi|110615475|gb|ABF04142.1| DNA cytosine methylase [Shigella flexneri 5 str. 8401]
 gi|281601397|gb|ADA74381.1| Cytosine-specific methyltransferase [Shigella flexneri 2002017]
 gi|313650184|gb|EFS14597.1| DNA-cytosine methyltransferase [Shigella flexneri 2a str. 2457T]
 gi|332756118|gb|EGJ86471.1| DNA-cytosine methyltransferase [Shigella flexneri 4343-70]
 gi|332757312|gb|EGJ87649.1| DNA-cytosine methyltransferase [Shigella flexneri 2747-71]
 gi|332757528|gb|EGJ87863.1| DNA-cytosine methyltransferase [Shigella flexneri K-671]
 gi|332766700|gb|EGJ96904.1| cytosine-specific methyltransferase [Shigella flexneri 2930-71]
 gi|333003060|gb|EGK22614.1| DNA-cytosine methyltransferase [Shigella flexneri VA-6]
 gi|333003307|gb|EGK22853.1| DNA-cytosine methyltransferase [Shigella flexneri K-218]
 gi|333004068|gb|EGK23602.1| DNA-cytosine methyltransferase [Shigella flexneri K-272]
 gi|333017687|gb|EGK36999.1| DNA-cytosine methyltransferase [Shigella flexneri K-304]
 gi|333017841|gb|EGK37148.1| DNA-cytosine methyltransferase [Shigella flexneri K-227]
          Length = 472

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|238895488|ref|YP_002920223.1| DNA cytosine methylase [Klebsiella pneumoniae NTUH-K2044]
 gi|330000908|ref|ZP_08303852.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. MS 92-3]
 gi|238547805|dbj|BAH64156.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|328537840|gb|EGF64032.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. MS 92-3]
          Length = 477

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDFLNP----------SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F              +  ++P    ++P  G++LE  +D K  ++  L
Sbjct: 277 LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYP---AVRPTFGELLEPTVDAKFILTPVL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
           W+   +    ++  G GFGYGL       +   TLSARYYKDG+EI
Sbjct: 334 WKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379


>gi|194430436|ref|ZP_03062919.1| DNA-cytosine methyltransferase [Escherichia coli B171]
 gi|194411515|gb|EDX27854.1| DNA-cytosine methyltransferase [Escherichia coli B171]
          Length = 472

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQCVTRTLSARYYKDGAEI 374


>gi|320331203|gb|EFW87160.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330882725|gb|EGH16874.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 420

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 56/118 (47%), Gaps = 29/118 (24%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEH------------------ 46
           PQ RER+ I+ F   +     + + PT     PRL  IL +                   
Sbjct: 228 PQHRERIIIVGFREKTGFSWDDLRLPTD---GPRLASILHKTDGTERVLPWDEDRFFDHK 284

Query: 47  ---IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              +  K T++  LW   Q   E ++ AG GFG+G+ F +S  T TLSARY+KDGSEI
Sbjct: 285 KRVVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGMAFPDS-VTRTLSARYHKDGSEI 341


>gi|306814216|ref|ZP_07448382.1| DNA cytosine methylase [Escherichia coli NC101]
 gi|305852375|gb|EFM52826.1| DNA cytosine methylase [Escherichia coli NC101]
          Length = 472

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F         P     L  +L+  ++ K  ++  LW+ 
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISACFPAQRVTLAQLLDPIVEAKYILTPVLWKY 331

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323222338|gb|EGA06720.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
          Length = 259

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 59  LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 118

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 119 LYRYAKKHQARGNGFGYGMVYPDNPGSVARTLSARYYKDGAEI 161


>gi|323191533|gb|EFZ76794.1| modification methylase EcoRII [Escherichia coli RN587/1]
          Length = 474

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 11/104 (10%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPT-----PLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +PQ RER+ ++ F   LN   +F         P   +P  G++L+ ++DDK  ++ +LWE
Sbjct: 281 LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQN-RPTFGELLDHNVDDKYILTPRLWE 339

Query: 60  GHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
                 + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 340 YLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|169786848|ref|YP_001700742.1| modification methylase (cytosine-specific
           methyltransferase)(HpaIIM-like) [Acinetobacter baumannii
           SDF]
 gi|169150765|emb|CAP02959.1| modification methylase (Cytosine-specific
           methyltransferase)(HpaIIM-like) [Acinetobacter
           baumannii]
          Length = 366

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 53/87 (60%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +   +F++PTP G K    D+ EE+ +  K  +SN+ 
Sbjct: 186 INAKDFGVPQNRERIFIVGFHKDTGVHDFEYPTPTGKKVCFADVKEENVVPTKYYLSNQY 245

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
            +  ++ K +++  G GFGY +  +NS
Sbjct: 246 LQTLERHKAHHESKGNGFGYAIIPDNS 272


>gi|161505003|ref|YP_001572115.1| DNA cytosine methylase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160866350|gb|ABX22973.1| hypothetical protein SARI_03133 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 474

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN    F            +P  G +L+  +D K  +S KLWE 
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLKNIHKFYPEKRPTFGQLLDPAVDSKYILSPKLWEY 340

Query: 61  HQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
                + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 341 LYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|331645413|ref|ZP_08346517.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli M605]
 gi|331045575|gb|EGI17701.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli M605]
          Length = 474

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 11/104 (10%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPT-----PLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +PQ RER+ ++ F   LN   +F         P   +P  G++L+ ++DDK  ++ +LWE
Sbjct: 281 LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQN-RPTFGELLDHNVDDKYILTPRLWE 339

Query: 60  GHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
                 + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 340 YLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|213853126|ref|ZP_03382658.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
          Length = 219

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 19  LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 78

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 79  LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 121


>gi|323158561|gb|EFZ44575.1| DNA-cytosine methyltransferase [Escherichia coli E128010]
          Length = 472

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVMLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQCVTRTLSARYYKDGAEI 374


>gi|300724477|ref|YP_003713798.1| DNA cytosine methylase [Xenorhabdus nematophila ATCC 19061]
 gi|297631015|emb|CBJ91699.1| DNA cytosine methylase [Xenorhabdus nematophila ATCC 19061]
          Length = 476

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        FP     +P L ++L+ ++D K  ++  L
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRNMNQLFPAQ---RPTLKELLDSNVDKKYILTPAL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           W+      + ++  G GFG+GL F +  ++   TLSARY+KDGSEI
Sbjct: 338 WKYLYNYAKKHQAKGNGFGFGLVFPDNPNSVARTLSARYHKDGSEI 383


>gi|213650730|ref|ZP_03380783.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
          Length = 405

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 205 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 261

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 262 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 307


>gi|157147667|ref|YP_001454986.1| DNA cytosine methylase [Citrobacter koseri ATCC BAA-895]
 gi|157084872|gb|ABV14550.1| hypothetical protein CKO_03470 [Citrobacter koseri ATCC BAA-895]
          Length = 474

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN    F            +P  G +L+  +D K  +S KLWE 
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLKNIHKFYPEKRPTFGQLLDPAVDSKYILSPKLWEY 340

Query: 61  HQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
                + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 341 LYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|149184876|ref|ZP_01863193.1| hypothetical protein ED21_17522 [Erythrobacter sp. SD-21]
 gi|148830987|gb|EDL49421.1| hypothetical protein ED21_17522 [Erythrobacter sp. SD-21]
          Length = 410

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 55/113 (48%), Gaps = 20/113 (17%)

Query: 8   VPQRRERLYIIDFLNPS----VEFKFPTPLGIKPRL-------GDILEEH--------ID 48
           +PQ RER+ ++ F   S     + K P     + R         +I E H        + 
Sbjct: 222 LPQNRERIVLVGFREKSGFDWADLKLPVEGEARMRSVLHPENGSEIAESHYTEGELATVS 281

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            K T+SN LW+  +     ++ AG GFGYGL   +  T  TLSARYYKDGSEI
Sbjct: 282 AKYTLSNHLWKYLRDYSAKHRAAGNGFGYGLVGPDD-TCRTLSARYYKDGSEI 333


>gi|331658007|ref|ZP_08358969.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206]
 gi|331056255|gb|EGI28264.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206]
          Length = 472

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPIVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|327394286|dbj|BAK11708.1| modification methylase EcoRII [Pantoea ananatis AJ13355]
          Length = 459

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 55/108 (50%), Gaps = 15/108 (13%)

Query: 6   FGVPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISN 55
           F +PQ RER+ ++     +  S +F        FP  +   P L  +LE   DDK  +S 
Sbjct: 270 FFLPQHRERIVLVGIRRDIAGSAQFSLRDIRQFFPAQV---PSLQSLLEPQPDDKYILSP 326

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
            LW    +  + +K  G GFG+GL   ++      TLSARYYKDGSEI
Sbjct: 327 VLWRYLYQYAKKHKARGNGFGFGLNDPHNVHCCVRTLSARYYKDGSEI 374


>gi|213622824|ref|ZP_03375607.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-2068]
          Length = 324

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        +P     +P L ++LE  ++ K  ++  L
Sbjct: 124 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 180

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 181 WKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 226


>gi|189423370|ref|YP_001950547.1| DNA-cytosine methyltransferase [Geobacter lovleyi SZ]
 gi|189419629|gb|ACD94027.1| DNA-cytosine methyltransferase [Geobacter lovleyi SZ]
          Length = 415

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 55/113 (48%), Gaps = 21/113 (18%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIK--PRLGDIL-----------------EEHID 48
           VPQ RER+ I+ F      F F +    K  P+L  IL                 +  + 
Sbjct: 226 VPQHRERIIIVGF-REKTGFSFDSLQLPKEGPKLFSILHPEDGTEQEETPFTVGDKAKVH 284

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +K  ++N LW   Q     +K AG GFG+GL  +N  T  TLSARYYKDGSEI
Sbjct: 285 EKYILTNNLWSYLQAYAAKHKAAGNGFGFGLVGKND-TARTLSARYYKDGSEI 336


>gi|291617874|ref|YP_003520616.1| EcoRIIM [Pantoea ananatis LMG 20103]
 gi|291152904|gb|ADD77488.1| EcoRIIM [Pantoea ananatis LMG 20103]
          Length = 459

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 55/108 (50%), Gaps = 15/108 (13%)

Query: 6   FGVPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISN 55
           F +PQ RER+ ++     +  S +F        FP  +   P L  +LE   DDK  +S 
Sbjct: 270 FFLPQHRERIVLVGIRRDIAGSAQFSLRDIRQFFPAQV---PSLQSLLEPQPDDKYILSP 326

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
            LW    +  + +K  G GFG+GL   ++      TLSARYYKDGSEI
Sbjct: 327 VLWRYLYQYAKKHKARGNGFGFGLNDPHNVHCCVRTLSARYYKDGSEI 374


>gi|217980150|ref|YP_002364200.1| DNA-cytosine methyltransferase [Thauera sp. MZ1T]
 gi|217508321|gb|ACK55106.1| DNA-cytosine methyltransferase [Thauera sp. MZ1T]
          Length = 419

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 26/119 (21%)

Query: 8   VPQRRERLYIIDFLNPS-VEFKFPT-----------------PLGIKPRL---GDILEEH 46
           VPQ RER+ I+ F N   + F +                     G +P L   GD   +H
Sbjct: 223 VPQHRERILIVGFRNEDGIRFDWDAVGLPQKGVHVMRDILHRTDGTEPVLPWDGDRFFDH 282

Query: 47  ----IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
               + DK T++ KLW   Q   + ++  G GFG+GL    S    TLSARYYKDGSEI
Sbjct: 283 AGRRVQDKYTLTPKLWRYLQDYADKHRAKGNGFGFGLVHPGS-VARTLSARYYKDGSEI 340


>gi|331677842|ref|ZP_08378517.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
 gi|331074302|gb|EGI45622.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
          Length = 320

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 120 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 176

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 177 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 222


>gi|161617789|ref|YP_001591754.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|161367153|gb|ABX70921.1| hypothetical protein SPAB_05653 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 474

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G +L+  +D K  +S KL
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLKNIDKFYPEK---RPTFGQLLDSVVDSKYILSPKL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|331671799|ref|ZP_08372595.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli TA280]
 gi|331070788|gb|EGI42147.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli TA280]
          Length = 474

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 11/104 (10%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPT-----PLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +PQ RER+ ++ F   LN   +F         P   +P  G++L+  +DDK  ++ +LWE
Sbjct: 281 LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQN-RPTFGELLDHDVDDKYILTPRLWE 339

Query: 60  GHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
                 + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 340 YLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|168234623|ref|ZP_02659681.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194736513|ref|YP_002117411.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|194712015|gb|ACF91236.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197291717|gb|EDY31067.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 474

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G +L+  +D K  +S KL
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLKNIDKFYPEK---RPTFGQLLDSVVDSKYILSPKL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|157145245|ref|YP_001452564.1| DNA cytosine methylase [Citrobacter koseri ATCC BAA-895]
 gi|157082450|gb|ABV12128.1| hypothetical protein CKO_00981 [Citrobacter koseri ATCC BAA-895]
          Length = 477

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F         P+    L ++LE  ++ +  ++  LW+ 
Sbjct: 277 LPQHRERIVLVGFRRDLNLKTDFTLRDIATRYPQQRITLAELLEPAVEARYVLTPVLWKY 336

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ +  +  + T TLSARYYKDG+EI
Sbjct: 337 LYRYAKKHQARGNGFGYGMVYPANPGSVTRTLSARYYKDGAEI 379


>gi|327254549|gb|EGE66165.1| modification methylase EcoRII [Escherichia coli STEC_7v]
          Length = 474

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 11/104 (10%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPT-----PLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +PQ RER+ ++ F   LN   +F         P   +P  G++L+  +DDK  ++ +LWE
Sbjct: 281 LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQN-RPTFGELLDHDVDDKYILTPRLWE 339

Query: 60  GHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
                 + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 340 YLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|310767946|gb|ADP12896.1| DNA cytosine methylase [Erwinia sp. Ejp617]
          Length = 467

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 18/107 (16%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPT----------PLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F     + K P           PL   P L  +L+ H++ K  ++  L
Sbjct: 278 LPQHRERIILVGFRR---DLKLPAFSLSALPALYPLQRTP-LKALLDSHVEAKYILTPTL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGL---FFENSATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYGL     EN     TLSARYYKDGSEI
Sbjct: 334 WKYLYQYAKKHQARGNGFGYGLVDPVLEN-GVVRTLSARYYKDGSEI 379


>gi|259908144|ref|YP_002648500.1| DNA cytosine methylase [Erwinia pyrifoliae Ep1/96]
 gi|224963766|emb|CAX55267.1| DNA-cytosine methyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|283478063|emb|CAY73979.1| DNA cytosine methylase [Erwinia pyrifoliae DSM 12163]
          Length = 467

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 18/107 (16%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPT----------PLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F     + K P           PL   P L  +L+ H++ K  ++  L
Sbjct: 278 LPQHRERIILVGFRR---DLKLPAFSLSALPALYPLQRTP-LKALLDSHVEAKYILTPTL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLF---FENSATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYGL     EN     TLSARYYKDGSEI
Sbjct: 334 WKYLYQYAKKHQARGNGFGYGLVDPALEN-GVVRTLSARYYKDGSEI 379


>gi|296159065|ref|ZP_06841892.1| DNA-cytosine methyltransferase [Burkholderia sp. Ch1-1]
 gi|295890626|gb|EFG70417.1| DNA-cytosine methyltransferase [Burkholderia sp. Ch1-1]
          Length = 426

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 54/118 (45%), Gaps = 29/118 (24%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45
           PQ RER+ I+ F   +     +   P      PRLG IL                     
Sbjct: 232 PQHRERIIIVGFRGETSFSWDDLHLPEN---GPRLGSILHRTDGSEPVLPWDHDRFFDHT 288

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              +  K T++  LW   Q   E ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 289 SRRVQPKYTLTPNLWTYLQNYAEKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 345


>gi|170691874|ref|ZP_02883038.1| DNA-cytosine methyltransferase [Burkholderia graminis C4D1M]
 gi|170143158|gb|EDT11322.1| DNA-cytosine methyltransferase [Burkholderia graminis C4D1M]
          Length = 438

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 54/117 (46%), Gaps = 27/117 (23%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDIL---------------------E 44
           PQ RER+ II F     EF F     P    PRL  IL                     +
Sbjct: 245 PQHRERIVIIGF-RSDTEFSFDDLRLP-ATGPRLASILHKTDGSEPLLPHDGERFFDHVQ 302

Query: 45  EHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             +  K T++  LW   Q   + ++ AG GFG+GL    ++ T TLSARY+KDGSEI
Sbjct: 303 RKVQPKYTLTPNLWAYLQAYADKHRAAGNGFGFGL-VTPASVTRTLSARYHKDGSEI 358


>gi|294979850|pdb|3ME5|A Chain A, Crystal Structure Of Putative Dna Cytosine Methylase From
           Shigella Flexneri 2a Str. 301
          Length = 482

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 274 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPXVEAKYILTPVL 330

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG  + N+  + T TLSARYYKDG+EI
Sbjct: 331 WKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 376


>gi|290508755|ref|ZP_06548126.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. 1_1_55]
 gi|289778149|gb|EFD86146.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. 1_1_55]
          Length = 477

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF-----LNPSVEFKFPTPL--GIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F     L+     +    L   ++P  G++LE   D K  ++  LW+ 
Sbjct: 277 LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTADAKFILTPVLWKY 336

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +    ++  G GFGYGL    +  +   TLSARYYKDG+EI
Sbjct: 337 LYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 379


>gi|194433657|ref|ZP_03065933.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1012]
 gi|194418086|gb|EDX34179.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1012]
 gi|332095525|gb|EGJ00541.1| DNA-cytosine methyltransferase [Shigella dysenteriae 155-74]
          Length = 472

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (53%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F    N   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 272 LPQHRERIVLVGFRRDFNLKADFTLRDISECFPAQ---RVTLAQLLDPMVEAKYILTPVL 328

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 329 WKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|331673470|ref|ZP_08374238.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280]
 gi|331069668|gb|EGI41055.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280]
          Length = 472

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKF----PTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F            +  L  +L+  ++ K  ++  LW+ 
Sbjct: 272 LPQHRERIVLVGFRRDLNLKADFTLRDISECFSAQRVTLAQLLDPMVEAKYILTPVLWKY 331

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + N+  + T TLSARYYKDG+EI
Sbjct: 332 LYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|238787820|ref|ZP_04631617.1| Modification methylase EcoRII [Yersinia frederiksenii ATCC 33641]
 gi|238724163|gb|EEQ15806.1| Modification methylase EcoRII [Yersinia frederiksenii ATCC 33641]
          Length = 475

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +P  G++LE  + DK  ++  L
Sbjct: 281 LPQHRERIVLVGFRKDLNIDKDFTLKDINKFFPEK---RPEFGELLESVVADKYILTPHL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
           W+      + ++  G GFG+GL     + +   TLSARY+KDGSEI
Sbjct: 338 WKYLYNYAKKHQAKGNGFGFGLVDPTNSESVARTLSARYHKDGSEI 383


>gi|315498495|ref|YP_004087299.1| transcriptional regulator, xre family [Asticcacaulis excentricus CB
           48]
 gi|315416507|gb|ADU13148.1| transcriptional regulator, XRE family [Asticcacaulis excentricus CB
           48]
          Length = 410

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 53/113 (46%), Gaps = 20/113 (17%)

Query: 8   VPQRRERLYIIDF------------LNPSVEFKFPTPLG-------IKPRLGDILEEHID 48
           VPQ RER+ I+ F            L P    K  + L         +P     +   + 
Sbjct: 224 VPQHRERIVIVGFREDVPFSWDDLNLPPKGSVKLSSILHPENAIEEAEPPYTTGIRAEVA 283

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            K T+++KLW   Q   + +K AG GFG+GL       + TLSARYYKDGSEI
Sbjct: 284 SKYTLTDKLWAYLQNYADKHKAAGNGFGFGLVGPGD-VSRTLSARYYKDGSEI 335


>gi|156933419|ref|YP_001437335.1| DNA cytosine methylase [Cronobacter sakazakii ATCC BAA-894]
 gi|156531673|gb|ABU76499.1| hypothetical protein ESA_01237 [Cronobacter sakazakii ATCC BAA-894]
          Length = 481

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 58/107 (54%), Gaps = 17/107 (15%)

Query: 8   VPQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +PQ RER+ ++ F           L    EF +P     +P  G++L+  +D +  ++  
Sbjct: 283 LPQHRERIVLVGFRRSLNLHDGFTLRALPEF-YPAR---RPAFGELLDPTVDARYVLTPT 338

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFF-ENSAT-TNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYGL   +N A+   TLSARYYKDG+EI
Sbjct: 339 LWKYLYRYAQKHQAKGNGFGYGLVDPQNPASVARTLSARYYKDGAEI 385


>gi|291463698|pdb|3LX6|A Chain A, Structure Of Probable Cytosine-Specific Methyltransferase
           From Shigella Flexneri
 gi|291463699|pdb|3LX6|B Chain B, Structure Of Probable Cytosine-Specific Methyltransferase
           From Shigella Flexneri
          Length = 410

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +  L  +L+  ++ K  ++  L
Sbjct: 212 LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQ---RVTLAQLLDPXVEAKYILTPVL 268

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG  + N+  + T TLSARYYKDG+EI
Sbjct: 269 WKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 314


>gi|300717257|ref|YP_003742060.1| cytosine-specific methyltransferase [Erwinia billingiae Eb661]
 gi|299063093|emb|CAX60213.1| Cytosine-specific methyltransferase [Erwinia billingiae Eb661]
          Length = 466

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 52/102 (50%), Gaps = 8/102 (7%)

Query: 8   VPQRRERLYII----DFLNPSVEFKFPTPLGIKPR--LGDILEEHIDDKSTISNKLWEGH 61
           +PQ RER+ ++    D   P    K  + L  K R  L  ++E  +D K  ++  LW+  
Sbjct: 278 LPQHRERIVLVGMRRDLKLPEFTLKALSTLYPKQRIPLRALMEPEVDSKYILTPTLWKYL 337

Query: 62  QKRKENNKIAGKGFGYGLFFENSAT--TNTLSARYYKDGSEI 101
               + ++  G GFGYGL      T    TLSARYYKDGSEI
Sbjct: 338 YNYAKKHQAKGNGFGYGLVDPQVETGVVRTLSARYYKDGSEI 379


>gi|304398880|ref|ZP_07380750.1| DNA-cytosine methyltransferase [Pantoea sp. aB]
 gi|304353584|gb|EFM17961.1| DNA-cytosine methyltransferase [Pantoea sp. aB]
          Length = 458

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 53/105 (50%), Gaps = 14/105 (13%)

Query: 8   VPQRRERLYII---------DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           +PQ RER+ ++         DF    +   +P  +   P L  +LE   DDK  +S  LW
Sbjct: 272 LPQHRERIVLVGIRRDLKKQDFTLRDIRRFYPAQV---PSLQSLLERAPDDKYILSPVLW 328

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
               +  + +K  G GFG+GL   ++      TLSARYYKDGSEI
Sbjct: 329 RYLYQYAKKHKAKGNGFGFGLNDPHNPDCCVRTLSARYYKDGSEI 373


>gi|262043463|ref|ZP_06016586.1| DNA (cytosine-5-)-methyltransferase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039205|gb|EEW40353.1| DNA (cytosine-5-)-methyltransferase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 477

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDFLNP----------SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F              +  ++P    + P  G++LE  +D K  ++  L
Sbjct: 277 LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYP---AVWPTFGELLEPTVDAKFILTPVL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKDGSEI 101
           W+   +    ++  G GFGYGL       +   TLSARYYKDG+EI
Sbjct: 334 WKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379


>gi|260598469|ref|YP_003211040.1| DNA cytosine methylase [Cronobacter turicensis z3032]
 gi|260217646|emb|CBA31957.1| DNA-cytosine methyltransferase [Cronobacter turicensis z3032]
          Length = 450

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 37/106 (34%), Positives = 58/106 (54%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++L+  +D +  ++  L
Sbjct: 252 LPQHRERIVLVGFRRDLNLHDGFTLRALPELYPAR---RPAFGELLDPTVDARYVLTPTL 308

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-ENSAT-TNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYGL   +N A+   TLSARYYKDG+EI
Sbjct: 309 WKYLYRYAQKHQAKGNGFGYGLVDPQNPASVARTLSARYYKDGAEI 354


>gi|133756232|ref|YP_001096382.1| DNA cytosine methylase [Escherichia coli]
 gi|110084067|gb|ABG49221.1| hypothetical protein [Escherichia coli]
          Length = 566

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 370 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 426

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 427 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 472


>gi|330960632|gb|EGH60892.1| DNA cytosine methylase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 178

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 1/66 (1%)

Query: 36  KPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
           +P  GD+L++ +D K  ++  LW+   +  E ++  G GFG+GL   N     TLSARY+
Sbjct: 18  RPSFGDLLDKEVDSKYILTPNLWDYLYRYAEKHRQKGNGFGFGLTRPND-IARTLSARYH 76

Query: 96  KDGSEI 101
           KDGSEI
Sbjct: 77  KDGSEI 82


>gi|165938005|ref|ZP_02226565.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165914028|gb|EDR32645.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Yersinia pestis biovar Orientalis
           str. IP275]
          Length = 282

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 86  LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 142

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 143 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 188


>gi|160431610|ref|YP_001551777.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Dublin]
 gi|298206539|ref|YP_003717476.1| EcoRII modification enzyme [Escherichia coli]
 gi|159885479|dbj|BAF93082.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Dublin]
 gi|296537944|gb|ADH29964.1| EcoRII modification enzyme [Escherichia coli O25b:H4 str. EC958]
          Length = 477

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|134044844|ref|YP_001102126.1| cytosine-specific methyltransferase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|133905378|gb|ABO42140.1| cytosine-specific methyltransferase [Yersinia pestis biovar
           Orientalis str. IP275]
          Length = 274

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 78  LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 134

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 135 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 180


>gi|296538000|gb|ADH30019.1| EcoRII cytosine methylase [Escherichia coli O25b:H4 str. EC958]
          Length = 477

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|118614638|ref|YP_908421.1| DNA methyltrasferase [Photobacterium damselae subsp. piscicida]
 gi|118596729|dbj|BAF38033.1| DNA methyltrasferase [Photobacterium damselae subsp. piscicida]
          Length = 266

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 70  LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 126

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 127 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 172


>gi|327198092|ref|YP_004306459.1| gp47 [Burkholderia phage KL3]
 gi|310657226|gb|ADP02340.1| gp47 [Burkholderia phage KL3]
          Length = 422

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 55/119 (46%), Gaps = 29/119 (24%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------ 45
            PQ RER+ I+ F   +     + + P      PRL  IL +                  
Sbjct: 228 TPQHRERIVIVGFRKKTGFSWDDLRLPAD---GPRLASILHKTDGSEPVLPWDGERFFDH 284

Query: 46  ---HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
               +  K T++  LW   Q   E ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 285 EKRKVQSKYTLTPNLWTYLQAYAEKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 342


>gi|308187315|ref|YP_003931446.1| DNA cytosine methylase [Pantoea vagans C9-1]
 gi|308057825|gb|ADO09997.1| DNA cytosine methylase [Pantoea vagans C9-1]
          Length = 458

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 53/105 (50%), Gaps = 14/105 (13%)

Query: 8   VPQRRERLYII---------DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           +PQ RER+ ++         DF    +   +P  +   P L  +LE+  DDK  +S  LW
Sbjct: 272 LPQHRERIVLVGIRRDLKKQDFTLRDIRRFYPAQV---PSLQSLLEKAPDDKYILSPVLW 328

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
               +  + +K  G GFG+GL    +      TLSARYYKDGSEI
Sbjct: 329 RYLYQYAKKHKAKGNGFGFGLNDPRNPDCCVRTLSARYYKDGSEI 373


>gi|113706802|ref|YP_724464.1| DNA cytosine methylase [Escherichia coli]
 gi|190576899|ref|YP_001966231.1| M.EcoRII DNA methylase [Klebsiella pneumoniae]
 gi|194433606|ref|ZP_03065883.1| modification methylase EcoRII [Shigella dysenteriae 1012]
 gi|209901141|ref|YP_002286923.1| DNA cytosine methylase [Klebsiella pneumoniae]
 gi|209901236|ref|YP_002287017.1| DNA cytosine methylase [Klebsiella pneumoniae]
 gi|215528089|ref|YP_002332862.1| EcoRII cytosine methylase [Klebsiella pneumoniae]
 gi|302141639|ref|YP_003813098.1| EcoRII methylase [Klebsiella pneumoniae]
 gi|127448|sp|P05101|MTE2_ECOLX RecName: Full=Modification methylase EcoRII; Short=M.EcoRII;
           AltName: Full=Cytosine-specific methyltransferase EcoRII
 gi|41317|emb|CAA28725.1| unnamed protein product [Escherichia coli HB101]
 gi|109390538|gb|ABG33840.1| EcoRII modification enzyme [Escherichia coli]
 gi|110264483|gb|ABG56846.1| M.EcoRII DNA methylase [Klebsiella pneumoniae]
 gi|165928612|gb|ABY74380.1| EcoRII cytosine methylase [Klebsiella pneumoniae]
 gi|194418198|gb|EDX34290.1| modification methylase EcoRII [Shigella dysenteriae 1012]
 gi|197092209|gb|ACH42172.1| EcoRII cytosine methylase [Klebsiella pneumoniae]
 gi|209574187|gb|ACI63075.1| modification methylase [Klebsiella pneumoniae]
 gi|209574298|gb|ACI63184.1| modification methylase [Klebsiella pneumoniae]
 gi|296033904|gb|ADG84867.1| EcoRII methylase [Klebsiella pneumoniae]
          Length = 477

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|48093754|gb|AAT40239.1| Eco128I DNA methylase [Escherichia coli]
          Length = 332

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 200 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 256

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 257 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 302


>gi|297622183|ref|YP_003675732.1| EcoRII cytosine-methyltransferase [Klebsiella oxytoca KOX105]
 gi|296492002|gb|ADH29504.1| EcoRII cytosine-methyltransferase [Klebsiella oxytoca KOX105]
          Length = 491

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 295 LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQ---RPSFGELLEPVVDSKYILTPKL 351

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 352 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397


>gi|307729019|ref|YP_003906243.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1003]
 gi|307583554|gb|ADN56952.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1003]
          Length = 428

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 54/118 (45%), Gaps = 29/118 (24%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45
           PQ RER+ I+ F   +     + K P      PRL  IL +                   
Sbjct: 235 PQHRERIVIVGFRQETGFSFDDLKLPAS---GPRLASILHKTDGSEPLLPHDGERFFDPV 291

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              +  K T++  LW   Q   E ++ AG GFG+GL    ++ T TLSARY+KDGSEI
Sbjct: 292 RRSVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGL-VTPASVTRTLSARYHKDGSEI 348


>gi|91782477|ref|YP_557683.1| C-5 cytosine-specific DNA methylase [Burkholderia xenovorans LB400]
 gi|91686431|gb|ABE29631.1| C-5 cytosine-specific DNA methylase [Burkholderia xenovorans LB400]
          Length = 418

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 54/117 (46%), Gaps = 27/117 (23%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTPLGIK---PRLGDILEE-------------------- 45
           PQ RER+ I+ F     EF F   L +    PRL  IL +                    
Sbjct: 231 PQHRERIVIVGF-REETEFTFDD-LNVPAEGPRLASILHKTDGSEPVLAHDGDRFFDHAS 288

Query: 46  -HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             +  + T++  LW   Q     ++ AG GFG+GL   +S  T TLSARY+KDGSEI
Sbjct: 289 REVQPRYTLTANLWAYLQAYAAKHRAAGNGFGFGLVTPDS-VTRTLSARYFKDGSEI 344


>gi|226807724|ref|YP_002791420.1| Dcm [Enterobacter cloacae]
 gi|226810038|ref|YP_002791733.1| Dcm [Enterobacter cloacae]
 gi|226425951|gb|ACO54044.1| Dcm [Enterobacter cloacae]
 gi|226426265|gb|ACO54357.1| Dcm [Enterobacter cloacae]
          Length = 489

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 17/106 (16%)

Query: 9   PQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           PQ RER+ +I F           L    +F +P     +P L D+L+  +D K  +S KL
Sbjct: 292 PQHRERIVLIGFRRDLRLKDGFTLRDIKDF-YPDK---RPSLSDLLDPSVDSKYILSPKL 347

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 348 WEYLYNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 393


>gi|323960520|gb|EGB56149.1| DNA-cytosine methyltransferase [Escherichia coli H489]
          Length = 477

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 281 LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEH---RPSFGELLEPVVDSKYILTPKL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|157412142|ref|YP_001481483.1| DNA cytosine methylase [Escherichia coli APEC O1]
 gi|99867167|gb|ABF67812.1| cytosine methylase [Escherichia coli APEC O1]
          Length = 489

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 17/106 (16%)

Query: 9   PQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           PQ RER+ +I F           L    +F +P     +P L D+L+  +D K  +S KL
Sbjct: 292 PQHRERIVLIGFRRDLRLKDGFTLRDIKDF-YPDK---RPSLSDLLDPSVDSKYILSPKL 347

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 348 WEYLYNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 393


>gi|331643338|ref|ZP_08344469.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli H736]
 gi|331036809|gb|EGI09033.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli H736]
          Length = 491

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 295 LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEH---RPSFGELLEPVVDSKYILTPKL 351

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 352 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397


>gi|218701133|ref|YP_002408762.1| DNA cytosine methylase [Escherichia coli IAI39]
 gi|218371119|emb|CAR18947.1| Modification methylase EcoRII (M.EcoRII) (Cytosine-specific
           methyltransferase EcoRII) [Escherichia coli IAI39]
          Length = 491

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 295 LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEH---RPSFGELLEPVVDSKYILTPKL 351

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 352 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397


>gi|307139342|ref|ZP_07498698.1| DNA cytosine methylase [Escherichia coli H736]
          Length = 477

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN    F        +P     +P  G++LE  +D K  ++ KL
Sbjct: 281 LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEH---RPSFGELLEPVVDSKYILTPKL 337

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF-EN-SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   EN  +   TLSARY+KDGSEI
Sbjct: 338 WEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|121997219|ref|YP_001002006.1| DNA-cytosine methyltransferase [Halorhodospira halophila SL1]
 gi|121588624|gb|ABM61204.1| DNA-cytosine methyltransferase [Halorhodospira halophila SL1]
          Length = 436

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 53/113 (46%), Gaps = 20/113 (17%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLG------IKPRLGDILEE---------HID 48
           VPQ RER+Y++ F   +     +  FP P        + P  G    E          + 
Sbjct: 241 VPQHRERIYMVGFRKDTPFTWNQLDFPAPDARTLREVLHPEDGSEAAEPPYTEGDLATVG 300

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           DK  +S KLW+  Q  +  ++ AG GFGY        T  TLSARY+KDGSEI
Sbjct: 301 DKYVLSEKLWKYLQDYRAKHEHAGNGFGYSKVGPED-TARTLSARYHKDGSEI 352


>gi|38347986|ref|NP_941235.1| DNA cytosine methylase [Serratia marcescens]
 gi|190410308|ref|YP_001965811.1| dcm [Klebsiella pneumoniae]
 gi|38259463|emb|CAE51691.1| DNA-cytosine methyltransferase [Serratia marcescens]
 gi|146151102|gb|ABQ02868.1| dcm [Klebsiella pneumoniae]
          Length = 475

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 17/106 (16%)

Query: 9   PQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           PQ RER+ +I F           L    +F +P     +P L D+L+  +D K  +S KL
Sbjct: 278 PQHRERIVLIGFRRDLRLKDGFTLRDIKDF-YPDK---RPSLSDLLDPSVDSKYILSPKL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 334 WEYLYNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 379


>gi|283785730|ref|YP_003365595.1| DNA-cytosine methyltransferase [Citrobacter rodentium ICC168]
 gi|282949184|emb|CBG88792.1| DNA-cytosine methyltransferase [Citrobacter rodentium ICC168]
          Length = 477

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEF-------KFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F       ++P     +  L ++LE  ++ K  ++  L
Sbjct: 277 LPQHRERIVLVGFRRDLNLKGDFTLRDISTRYPQR---RTTLAELLEPVVEAKYVLTPVL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF--ENSATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYG+    + ++ T TLSARYYKDG+EI
Sbjct: 334 WKYLYRYAKKHQAKGNGFGYGMVSPSDPNSVTRTLSARYYKDGAEI 379


>gi|188533556|ref|YP_001907353.1| DNA cytosine methylase [Erwinia tasmaniensis Et1/99]
 gi|188028598|emb|CAO96460.1| DNA-cytosine methyltransferase [Erwinia tasmaniensis Et1/99]
          Length = 469

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 36/103 (34%), Positives = 53/103 (51%), Gaps = 10/103 (9%)

Query: 8   VPQRRERLYIIDFLN----PSVEFKFPTPLGIKPR--LGDILEEHIDDKSTISNKLWEGH 61
           +PQ RER+ ++ F      P+        L  + R  L  +L+  +++K  ++  LW+  
Sbjct: 280 LPQHRERIVLVGFRRDLQLPAFSLSLLPALYPRQRTPLNALLDSQVEEKYILTPTLWKYL 339

Query: 62  QKRKENNKIAGKGFGYGLF---FENSATTNTLSARYYKDGSEI 101
               + ++  G GFGYGL     EN     TLSARYYKDGSEI
Sbjct: 340 YHYAKKHQARGNGFGYGLVDPALEN-GVVRTLSARYYKDGSEI 381


>gi|225076313|ref|ZP_03719512.1| hypothetical protein NEIFLAOT_01354 [Neisseria flavescens
           NRL30031/H210]
 gi|224952437|gb|EEG33646.1| hypothetical protein NEIFLAOT_01354 [Neisseria flavescens
           NRL30031/H210]
          Length = 359

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 5/81 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILE-EHIDDKSTISNK 56
           + A DFGVPQ RER++I+ F +P     +F++P P+G+K    DI E E +  K  +S  
Sbjct: 181 INAKDFGVPQNRERIFIVGF-HPDTKVNDFEYPKPIGLKTSFSDIREKETVPTKYYLSTV 239

Query: 57  LWEGHQKRKENNKIAGKGFGY 77
             +  +K KE ++  G GFGY
Sbjct: 240 YIDTLRKHKERHEAKGNGFGY 260


>gi|146312197|ref|YP_001177271.1| DNA cytosine methylase [Enterobacter sp. 638]
 gi|145319073|gb|ABP61220.1| DNA-cytosine methyltransferase [Enterobacter sp. 638]
          Length = 471

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F   LN   +F       +    +P + ++LE   D K  ++  LW+ 
Sbjct: 271 LPQHRERIVLVGFRRDLNLKGDFTLRDIPSLYPAHRPSVAELLEPAFDAKFILTPVLWKY 330

Query: 61  HQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
             +  + ++  G GFG+G+    +  + T TLSARYYKDG+EI
Sbjct: 331 LYRYAKKHQAKGNGFGFGMVDPRNPHSVTRTLSARYYKDGAEI 373


>gi|157368818|ref|YP_001476807.1| DNA cytosine methylase [Serratia proteamaculans 568]
 gi|157320582|gb|ABV39679.1| DNA-cytosine methyltransferase [Serratia proteamaculans 568]
          Length = 491

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 55/106 (51%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F   LN   +F        FP     +P  G++L E +  K  ++  L
Sbjct: 297 LPQHRERIVLVGFRRDLNIHGDFSLKNLSQFFPKK---RPSFGELLLEDVAPKYILTEHL 353

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF--ENSATTNTLSARYYKDGSEI 101
           W+      + ++  G GFG+GL      S+   TLSARY+KDGSEI
Sbjct: 354 WKYLYNYAKKHQAKGNGFGFGLVNPKNESSVARTLSARYHKDGSEI 399


>gi|149926993|ref|ZP_01915251.1| C-5 cytosine-specific DNA methylase [Limnobacter sp. MED105]
 gi|149824214|gb|EDM83434.1| C-5 cytosine-specific DNA methylase [Limnobacter sp. MED105]
          Length = 435

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 54/118 (45%), Gaps = 26/118 (22%)

Query: 8   VPQRRERLYIIDFLNPSVEFKF---PTPLGIKPRLGDILEE------------------- 45
            PQ RER+ I  F +  V F +   P P     +L +IL +                   
Sbjct: 244 TPQHRERILIAGFAD-QVAFDWDAIPLPPKGSRKLKEILHKTDGSEPYLPWDENRFFDHD 302

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              + DK T++  LW   Q     +K  G GFG+GL    S TT TLSARYYKDGSEI
Sbjct: 303 SKKVQDKYTLTPGLWTYLQNYAAKHKAKGNGFGFGLVGPES-TTRTLSARYYKDGSEI 359


>gi|323525262|ref|YP_004227415.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1001]
 gi|323382264|gb|ADX54355.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1001]
          Length = 428

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 54/118 (45%), Gaps = 29/118 (24%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45
           PQ RER+ I+ F   +     + + P      PRL  IL +                   
Sbjct: 235 PQHRERIVIVGFREETGFSFDDLRLPAN---GPRLASILHKTDGSEPLLPHDGERFFDHV 291

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              +  K T++  LW   Q   E ++ AG GFG+GL    ++ T TLSARY+KDGSEI
Sbjct: 292 RRKVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGL-VTPASVTRTLSARYHKDGSEI 348


>gi|169334482|ref|ZP_02861675.1| hypothetical protein ANASTE_00885 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259199|gb|EDS73165.1| hypothetical protein ANASTE_00885 [Anaerofustis stercorihominis DSM
           17244]
          Length = 337

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 5   DFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWEGH 61
           +FGVPQ RER+YI+ F N     +F FPTP+    ++ DI+EE  +  K  +S+   E  
Sbjct: 160 NFGVPQNRERIYIVAFRNDIAPKDFIFPTPIDENKKIKDIMEEKPVSPKYYLSDVYLETL 219

Query: 62  QKRKENNKIAGKGFGY 77
           +K K  ++  G GFGY
Sbjct: 220 RKHKARHEAKGNGFGY 235


>gi|161502886|ref|YP_001569998.1| DNA cytosine methylase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160864233|gb|ABX20856.1| hypothetical protein SARI_00944 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 476

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYII----------DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++          DF   ++   +P     +P L ++LE  ++ K  ++  L
Sbjct: 276 LPQHRERIVLVGVRRDLNLKTDFTLRNIARCYPPR---RPTLAELLEPVVEAKYILTPVL 332

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W+      + ++  G GFGYG+ + ++  +   TLSARYYKDG+EI
Sbjct: 333 WKYLYCYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|317048624|ref|YP_004116272.1| DNA-cytosine methyltransferase [Pantoea sp. At-9b]
 gi|316950241|gb|ADU69716.1| DNA-cytosine methyltransferase [Pantoea sp. At-9b]
          Length = 467

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 39/103 (37%), Positives = 51/103 (49%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDF-----LNPSVEFKFPTPLGIK--PRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++       L+     +    L  K  P L  +LE   D K T+S  LW  
Sbjct: 277 LPQHRERIVLVGIRRDTRLSEGFTLRALAQLYPKKVPTLKSLLEPQPDAKYTLSPVLWNY 336

Query: 61  HQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
             +  + +K  G GFG+GL      S    TLSARYYKDGSEI
Sbjct: 337 LYQYAKKHKAKGNGFGFGLNDPRNPSVCVRTLSARYYKDGSEI 379


>gi|238898088|ref|YP_002923769.1| DNA cytosine methylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465848|gb|ACQ67622.1| DNA cytosine methylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 401

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 55/118 (46%), Gaps = 29/118 (24%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDIL--------------EEHIDD- 49
           PQ RER+ I+ F   +     + K P      PRL  IL              E   D  
Sbjct: 208 PQHRERIIIVGFREKTGFSWDDLKLPEE---GPRLASILHRTDGTEPVLPWDGERFFDHD 264

Query: 50  ------KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                 + T++  LW   Q   + ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 265 RRAVPLRYTLTPNLWAYLQAYADKHRAAGNGFGFGIVYPDS-VTRTLSARYHKDGSEI 321


>gi|7636053|emb|CAB88410.1| putative methyltransferase [Serratia marcescens]
          Length = 290

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 54/106 (50%), Gaps = 17/106 (16%)

Query: 9   PQRRERLYIIDF-----------LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           PQ RER+ +I F           L    +F +P     +P L D+L+  +D K  +S  L
Sbjct: 93  PQHRERIVLIGFRRDLRLKDGFTLRDIKDF-YPDK---RPSLSDLLDPSVDSKYILSPXL 148

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           WE      + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 149 WEYLYNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 194


>gi|254526757|ref|ZP_05138809.1| modification methylase EcoRII [Prochlorococcus marinus str. MIT
           9202]
 gi|221538181|gb|EEE40634.1| modification methylase EcoRII [Prochlorococcus marinus str. MIT
           9202]
          Length = 298

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 57/115 (49%), Gaps = 23/115 (20%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPT----PLGIKPRLGDILE-----------------EH 46
           VPQ R+R+YI+ F   +  F F       +   P L  +L                    
Sbjct: 105 VPQNRQRIYIVGFREEN-NFNFDDLIIPDISKGPTLSSVLHPEDGSENFEDPYTIPHLSK 163

Query: 47  IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +++K TI+NKLW+  +  ++ ++  G GFG+GL  +      TLSARY+KDG+EI
Sbjct: 164 VNEKYTITNKLWDYLKMYEKKHRAKGNGFGFGL-CKREDVARTLSARYHKDGAEI 217


>gi|213027601|ref|ZP_03342048.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. 404ty]
          Length = 176

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 2/68 (2%)

Query: 36  KPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSAR 93
           +P L ++LE  ++ K  ++  LW+   +  + ++  G GFGYG+ + ++  +   TLSAR
Sbjct: 11  RPTLAELLEPVVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSAR 70

Query: 94  YYKDGSEI 101
           YYKDG+EI
Sbjct: 71  YYKDGAEI 78


>gi|213053049|ref|ZP_03345927.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
          Length = 169

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%), Gaps = 2/68 (2%)

Query: 36  KPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSAR 93
           +P L ++LE  ++ K  ++  LW+   +  + ++  G GFGYG+ + ++  +   TLSAR
Sbjct: 4   RPTLAELLEPVVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTLSAR 63

Query: 94  YYKDGSEI 101
           YYKDG+EI
Sbjct: 64  YYKDGAEI 71


>gi|281420730|ref|ZP_06251729.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205]
 gi|281405022|gb|EFB35702.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205]
          Length = 432

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 39/56 (69%), Gaps = 1/56 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + +CD+G+PQ RER++ + F  P+ +FK+P P+ ++ ++ D LE++ID K  +  K
Sbjct: 203 LNSCDYGIPQHRERVFCLGFKKPT-DFKYPAPIKLEYKMYDFLEDYIDTKYFLKEK 257


>gi|113971536|ref|YP_735329.1| DNA-cytosine methyltransferase [Shewanella sp. MR-4]
 gi|113886220|gb|ABI40272.1| DNA-cytosine methyltransferase [Shewanella sp. MR-4]
          Length = 417

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 51/100 (51%), Gaps = 8/100 (8%)

Query: 8   VPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDILEE---HIDDKSTISNKLWEG 60
           V QRR R +++    D       FKFP   G    L D LEE    + ++ TIS++LWEG
Sbjct: 254 VAQRRVRCFMVCVREDVFQEFGAFKFPEFEGEPIPLRDALEELTAELMEEYTISDRLWEG 313

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           H  R + N   G GF   +   N   +NT+ ARY KDG E
Sbjct: 314 HINRTQRNLDRGTGFTAHVADLNRP-SNTIVARYGKDGKE 352


>gi|54293106|ref|YP_125521.1| hypothetical protein lpl0145 [Legionella pneumophila str. Lens]
 gi|53752938|emb|CAH14374.1| hypothetical protein lpl0145 [Legionella pneumophila str. Lens]
          Length = 417

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 54/115 (46%), Gaps = 24/115 (20%)

Query: 8   VPQRRERLYIIDF------------LNPSVEFKFPTPLGIKPRLGDILEE---------H 46
           VPQ RER++I+ F            L P       + L   P  G  +EE          
Sbjct: 226 VPQHRERIFIVGFREDLPFSWNDLRLPPKNSVLLESIL--HPENGTEIEEKPYTFGEKAE 283

Query: 47  IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +    T+S+KLW   Q  K+ +   G GFG+GL  E +    TLSARY+KDGSEI
Sbjct: 284 VSSCFTLSDKLWNYLQDYKKKHSEKGNGFGFGLVSEKN-IARTLSARYHKDGSEI 337


>gi|16923911|gb|AAL31632.1|AF438204_2 C5 DNA methyltransferase [Positive selection vector pMTet1]
          Length = 418

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  FG+PQ+R+R Y++ FLN ++ F+FP P  I   +G++LE  +   S IS  L + 
Sbjct: 246 LDASHFGIPQKRKRFYLVAFLNQNIHFEFPKPPMISKDIGEVLESDVTGYS-ISEHLQKS 304

Query: 61  HQKRKENNK 69
           +  +K++ K
Sbjct: 305 YLFKKDDGK 313


>gi|127464|sp|P11408|MTM1_MORSP RecName: Full=Modification methylase MspI; Short=M.MspI; AltName:
           Full=Cytosine-specific methyltransferase MspI
 gi|44539|emb|CAA32393.1| unnamed protein product [Moraxella sp.]
          Length = 418

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  FG+PQ+R+R Y++ FLN ++ F+FP P  I   +G++LE  +   S IS  L + 
Sbjct: 246 LDASHFGIPQKRKRFYLVAFLNQNIHFEFPKPPMISKDIGEVLESDVTGYS-ISEHLQKS 304

Query: 61  HQKRKENNK 69
           +  +K++ K
Sbjct: 305 YLFKKDDGK 313


>gi|313668796|ref|YP_004049080.1| C-5 cytosine-specific DNA-methylase [Neisseria lactamica ST-640]
 gi|313006258|emb|CBN87720.1| C-5 cytosine-specific DNA-methylase [Neisseria lactamica 020-06]
          Length = 362

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +   +FK+P P GI+    DI E + +  K  +S + 
Sbjct: 180 VNAKDFGVPQNRERIFIVGFRGDTDIKDFKYPEPTGIQTAFQDIREKDTVPTKYYLSTQY 239

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            +  +K K+ ++  G GFGY
Sbjct: 240 IDTLRKHKQRHEEKGNGFGY 259


>gi|254429380|ref|ZP_05043087.1| DNA-cytosine methyltransferase superfamily [Alcanivorax sp. DG881]
 gi|196195549|gb|EDX90508.1| DNA-cytosine methyltransferase superfamily [Alcanivorax sp. DG881]
          Length = 435

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 58/117 (49%), Gaps = 24/117 (20%)

Query: 8   VPQRRERLYIIDFLNPSV------------EFKFPTPL----GIKPRL---GDILEEH-- 46
           VPQ RER+ I+ F  P              E +    L    G +P L   GD   +H  
Sbjct: 244 VPQHRERIAIVGFREPMPFSWDAMKMAGKGEKRMREVLHREDGSEPYLEWDGDRFFDHGK 303

Query: 47  --IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             +++K  ++ KLW+  +  K  ++  G GFG+GL   +S    TLSARYYKDGSEI
Sbjct: 304 GEVNEKYILTPKLWKYLKDYKAKHQAKGNGFGFGLVGPDS-VARTLSARYYKDGSEI 359


>gi|462658|sp|P34878|MTSB_LACLC RecName: Full=Modification methylase ScrFIB; Short=M.ScrFI-B;
           Short=M.ScrFIB; AltName: Full=Cytosine-specific
           methyltransferase ScrFIB
 gi|149495|gb|AAA16838.1| methyl-5-cytosine methylase [Lactococcus lactis]
 gi|2327032|gb|AAB66694.1| 5-methyl-cytosine-methyltransferase [Lactococcus lactis subsp.
           cremoris]
 gi|739995|prf||2004282A methyl-5-cytosine methyltransferase
          Length = 360

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A DFG+PQ RER++ I  LNP+ +F FP    +   + D+LEE++ +K  + N
Sbjct: 201 LNARDFGIPQNRERVFCISILNPNEDFTFPQKQNLTLSMNDLLEENVSEKFYLKN 255


>gi|261400408|ref|ZP_05986533.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
 gi|269209852|gb|EEZ76307.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
          Length = 362

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +   +FK+P P GI+    DI E + +  K  +S + 
Sbjct: 180 VNAKDFGVPQNRERIFIVGFRGDTDIKDFKYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 239

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            +  +K K+ ++  G GFGY
Sbjct: 240 IDTLRKHKQRHEEKGNGFGY 259


>gi|315608882|ref|ZP_07883855.1| modification methylase EcoRII [Prevotella buccae ATCC 33574]
 gi|315249409|gb|EFU29425.1| modification methylase EcoRII [Prevotella buccae ATCC 33574]
          Length = 312

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR--LGDILEEHIDDKSTISNKLW 58
           + A DFG+PQ+RER+ I+ F + ++ F FPTP+ I  R  L DILE  +D K  + +K+ 
Sbjct: 147 LNALDFGIPQKRERIIIVGFKD-NILFSFPTPVPISQRKTLKDILEIDVDKKYYVKDKIR 205

Query: 59  EGHQKR 64
           E    R
Sbjct: 206 ESRLMR 211


>gi|153870185|ref|ZP_01999636.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS]
 gi|152073352|gb|EDN70367.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS]
          Length = 235

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 4/70 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + + DFG+PQ+RER  I+ F   ++ F FP PLGIKP L  ILE+   D     N L   
Sbjct: 144 LNSLDFGIPQKRERTIIVGF-QENIAFSFPKPLGIKPDLTKILEK---DSEVEKNILLLM 199

Query: 61  HQKRKENNKI 70
             K++E  K+
Sbjct: 200 SLKKRECKKL 209


>gi|255514225|gb|EET90487.1| DNA-cytosine methyltransferase [Candidatus Micrarchaeum acidiphilum
           ARMAN-2]
          Length = 328

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 14/113 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---------GIKPRLGD----ILEEHI 47
           + A ++GVPQ+R+R++ I       E     P+         G+KP +      +  + +
Sbjct: 156 LNAANYGVPQKRQRIFFIGVNRRQAEKAILPPVPTHSEHPTNGLKPWVPSKQFLLPPQKV 215

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
             +   S ++  G  +RK+ N     GFG+  F + S  +NT+SARY+KDG+E
Sbjct: 216 SKRFYYSERMINGFIRRKKKNAERNIGFGWQ-FLDFSKPSNTISARYWKDGAE 267


>gi|167746073|ref|ZP_02418200.1| hypothetical protein ANACAC_00768 [Anaerostipes caccae DSM 14662]
 gi|167654588|gb|EDR98717.1| hypothetical protein ANACAC_00768 [Anaerostipes caccae DSM 14662]
          Length = 312

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   D+G+PQ R R YI+ F N + EF+FP    +   L D+LE  +DDK  +S ++
Sbjct: 148 LNTADYGIPQTRNRTYIVCFANDNAEFEFPDKQELNLTLQDLLETEVDDKYFLSERI 204


>gi|292488627|ref|YP_003531511.1| DNA cytosine methylase [Erwinia amylovora CFBP1430]
 gi|292899788|ref|YP_003539157.1| modification methylase EcoRII [Erwinia amylovora ATCC 49946]
 gi|291199636|emb|CBJ46755.1| modification methylase EcoRII [Erwinia amylovora ATCC 49946]
 gi|291554058|emb|CBA21160.1| DNA cytosine methylase [Erwinia amylovora CFBP1430]
 gi|312172770|emb|CBX81026.1| DNA cytosine methylase [Erwinia amylovora ATCC BAA-2158]
          Length = 469

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 52/107 (48%), Gaps = 18/107 (16%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPT----------PLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++ F     + K P           P    P L  +L+  ++ K  ++  L
Sbjct: 280 LPQHRERIILVGFRR---DLKLPAFSLSALPAWYPQQRTP-LHALLDTDVEAKYILTPTL 335

Query: 58  WEGHQKRKENNKIAGKGFGYGLF---FENSATTNTLSARYYKDGSEI 101
           W+      + ++  G GFGYGL     EN     TLSARYYKDGSEI
Sbjct: 336 WKYLYHYAKKHQARGNGFGYGLVDPALEN-GVVRTLSARYYKDGSEI 381


>gi|320156908|ref|YP_004189287.1| DNA-cytosine methyltransferase [Vibrio vulnificus MO6-24/O]
 gi|319932220|gb|ADV87084.1| DNA-cytosine methyltransferase [Vibrio vulnificus MO6-24/O]
          Length = 552

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 8   VPQRRERLYII----DFLNPSVEFKFPTPLGI-----KPRLGDIL---EEHIDDKSTISN 55
            PQ RER+ ++    D +  + E+K  +   I     + R+ DIL    E    K T++ 
Sbjct: 310 TPQHRERIVLVGVRKDLVEKNPEYKKLSLKNIEVPQERLRVSDILTDLSEEETKKYTLTP 369

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
            LW         ++  G GFG+GL   ++  A T TLSARYYKDGSEI
Sbjct: 370 NLWNYLYHYALKHQSKGNGFGFGLVDPSNPNAVTRTLSARYYKDGSEI 417


>gi|300813374|ref|ZP_07093725.1| Modification methylase HpaII [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300512517|gb|EFK39666.1| Modification methylase HpaII [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 347

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (55%), Gaps = 5/84 (5%)

Query: 5   DFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKLWEG 60
           DFGVPQ RER+YI+ F   ++P+ +F FP        + DI+EE     K  +S+   E 
Sbjct: 151 DFGVPQNRERIYIVAFREDISPN-KFIFPEETDDTKVIADIMEEKETSPKYYLSDVYLES 209

Query: 61  HQKRKENNKIAGKGFGYGLFFENS 84
            +K K+ +K  G GFGY +   NS
Sbjct: 210 LRKHKQRHKAKGNGFGYEIRDVNS 233


>gi|317497298|ref|ZP_07955621.1| C-5 cytosine-specific DNA methylase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316895367|gb|EFV17526.1| C-5 cytosine-specific DNA methylase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 363

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A D+GVPQ RER++ I  LN   +F+FP    +K +L DILE+++D K  + N
Sbjct: 204 LNARDYGVPQNRERVFCISELNGENKFEFPKSRELKLKLYDILEKNVDSKYYLKN 258


>gi|238917714|ref|YP_002931231.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC
           27750]
 gi|238873074|gb|ACR72784.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC
           27750]
          Length = 311

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 35/57 (61%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + + D+GVPQ R R YI+ F N +  F+FP    +   L D+LE  +DDK  +S+++
Sbjct: 148 LNSADYGVPQTRNRTYIVCFDNQNARFEFPEKKKLNKTLQDLLEPEVDDKYFLSDRI 204


>gi|309378773|emb|CBX22599.1| putative DNA cytosine methyltransferase [Neisseria lactamica
           Y92-1009]
          Length = 342

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +    F++P P GI+    DI E + +  K  +S + 
Sbjct: 160 VNAKDFGVPQNRERIFIVGFRGDTDIKYFEYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 219

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            +  +K K+ ++  G GFGY
Sbjct: 220 IDTLRKHKQRHEEKGNGFGY 239


>gi|332188292|ref|ZP_08390019.1| DNA-cytosine methyltransferase family protein [Sphingomonas sp.
           S17]
 gi|332011688|gb|EGI53766.1| DNA-cytosine methyltransferase family protein [Sphingomonas sp.
           S17]
          Length = 423

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 28/120 (23%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD-------------------------- 41
           VPQ R+R+ ++ F    V F +   L   P + D                          
Sbjct: 229 VPQHRQRILLVGF-QKDVGFDWEKVLAKMPAVADGPKLASILHREDGTEEEGEDDDRRFI 287

Query: 42  ILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           + +  +  K  ++++LW+  Q   E ++ AG GFG  +      T+ TLSARYYKDGSEI
Sbjct: 288 LADGKVQKKYVLTDRLWQYLQGYAEKHRQAGNGFGCSVVGPKD-TSRTLSARYYKDGSEI 346


>gi|27497145|gb|AAO17336.1| methylase [Neisseria lactamica]
          Length = 384

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +    F++P P GI+    DI E + +  K  +S + 
Sbjct: 202 VNAKDFGVPQNRERIFIVGFRGDTDIKYFEYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 261

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            +  +K K+ ++  G GFGY
Sbjct: 262 IDTLRKHKQRHEEKGNGFGY 281


>gi|282879499|ref|ZP_06288233.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS
           5C-B1]
 gi|281306646|gb|EFA98672.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS
           5C-B1]
          Length = 438

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 5   DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           D+G+PQ RER++ I F  P V+F FP P+ ++ ++ D LE+++D K  +  K
Sbjct: 212 DYGIPQHRERIFCIGFHTP-VKFAFPAPIPLEYKMYDFLEDYVDTKYFLKEK 262


>gi|154484133|ref|ZP_02026581.1| hypothetical protein EUBVEN_01844 [Eubacterium ventriosum ATCC
           27560]
 gi|149735175|gb|EDM51061.1| hypothetical protein EUBVEN_01844 [Eubacterium ventriosum ATCC
           27560]
          Length = 366

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 5   DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR--LGDILEEH-IDDKSTISNKLWEGH 61
           DFGVPQ RER+YI+ F        F  P+G KP   + DI+EE  +  K  +S    E  
Sbjct: 168 DFGVPQNRERIYIVAFRKDINSENFEFPVGNKPDTCIRDIMEEQEVSVKYYLSTTYIETL 227

Query: 62  QKRKENNKIAGKGFGY 77
           ++ K  +   G GFGY
Sbjct: 228 KRHKARHAAKGNGFGY 243


>gi|313892290|ref|ZP_07825883.1| modification methylase HpaII [Dialister microaerophilus UPII 345-E]
 gi|313119428|gb|EFR42627.1| modification methylase HpaII [Dialister microaerophilus UPII 345-E]
          Length = 329

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 41/82 (50%), Gaps = 3/82 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + + +FGVPQ RER+YI+ F N      F FP     +  L DI+E E +  +  +S   
Sbjct: 147 LNSKNFGVPQNRERIYIVAFRNDISPENFDFPEGTDTEKTLKDIIEKEEVSSRYYLSETY 206

Query: 58  WEGHQKRKENNKIAGKGFGYGL 79
                K KE  K  G GFGY +
Sbjct: 207 LNSLIKHKERQKAKGNGFGYEI 228


>gi|12229852|sp|O30868|MTH2_HAEAE RecName: Full=Modification methylase HaeII; Short=M.HaeII; AltName:
           Full=Cytosine-specific methyltransferase HaeII
 gi|2425087|gb|AAB70829.1| HaeII methylase [Haemophilus aegyptius ATCC 11116]
          Length = 318

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ FL+  + F+FP P+G    L +ILE    D    +N     
Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILES---DDVVPNNYFLSD 199

Query: 61  HQKRKENNKIA 71
             KRK  + I 
Sbjct: 200 ELKRKRLSSIT 210


>gi|254282099|ref|ZP_04957067.1| modification methylase SsoII [gamma proteobacterium NOR51-B]
 gi|219678302|gb|EED34651.1| modification methylase SsoII [gamma proteobacterium NOR51-B]
          Length = 356

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 48/98 (48%), Gaps = 7/98 (7%)

Query: 8   VPQRRERLYIIDFLNPSVE----FKFPT-PLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62
           V QRR R +++   N        F+FP  P G  P L  +L +  D K T+S+K+W GH+
Sbjct: 192 VAQRRVRCFMVAVRNDIAANRGAFEFPKFPEGSIP-LRSVLSKEPDPKYTLSDKMWAGHK 250

Query: 63  KRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
            R   N   G GF   L       +NT+ ARY KD  E
Sbjct: 251 ARTIRNVERGTGF-TALEANLDKPSNTIVARYGKDAKE 287


>gi|319776347|ref|YP_004138835.1| Cytosine-specific methyltransferase [Haemophilus influenzae F3047]
 gi|329123500|ref|ZP_08252064.1| modification methylase HaeII [Haemophilus aegyptius ATCC 11116]
 gi|317450938|emb|CBY87164.1| Cytosine-specific methyltransferase [Haemophilus influenzae F3047]
 gi|327471082|gb|EGF16537.1| modification methylase HaeII [Haemophilus aegyptius ATCC 11116]
          Length = 318

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ FL+  + F+FP P+G    L +ILE    D    +N     
Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILES---DDVVPNNYFLSD 199

Query: 61  HQKRKENNKIA 71
             KRK  + I 
Sbjct: 200 ELKRKRLSSIT 210


>gi|68250112|ref|YP_249224.1| modification methylase HaeII [Haemophilus influenzae 86-028NP]
 gi|68058311|gb|AAX88564.1| modification methylase HaeII [Haemophilus influenzae 86-028NP]
          Length = 318

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ FL+  + F+FP P+G    L +ILE    D    +N     
Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILES---DDVVPNNYFLSD 199

Query: 61  HQKRKENNKIA 71
             KRK  + I 
Sbjct: 200 ELKRKRLSSIT 210


>gi|148826843|ref|YP_001291596.1| modification methylase HaeII [Haemophilus influenzae PittGG]
 gi|148718085|gb|ABQ99212.1| modification methylase HaeII [Haemophilus influenzae PittGG]
          Length = 318

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ FL+  + F+FP P+G    L +ILE    D    +N     
Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILES---DDVVPNNYFLSD 199

Query: 61  HQKRKENNKIA 71
             KRK  + I 
Sbjct: 200 ELKRKRLSSIT 210


>gi|219870523|ref|YP_002474898.1| Type II modification methyltransferase HpaII/DNA
           (cytosine-5-)-methyltransferase [Haemophilus parasuis
           SH0165]
 gi|219690727|gb|ACL31950.1| Type II modification methyltransferase HpaII/DNA
           (cytosine-5-)-methyltransferase [Haemophilus parasuis
           SH0165]
          Length = 350

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F        F +P PL  K    D+ E++ +  K  +S + 
Sbjct: 170 LNAKDFGVPQNRERIFIVGFRQDLAINSFYYPAPLNRKVCFNDVKEKNVVPTKYYLSTQY 229

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            E  +K K  ++  G GFGY
Sbjct: 230 IETLRKHKARHQDKGNGFGY 249


>gi|127459|sp|P15446|MTH2_HAEPA RecName: Full=Modification methylase HpaII; Short=M.HpaII; AltName:
           Full=Cytosine-specific methyltransferase HpaII
 gi|43630|emb|CAA35705.1| unnamed protein product [Haemophilus parainfluenzae]
 gi|305377|gb|AAA20481.1| HpaII modification methyltransferase [Haemophilus parainfluenzae]
          Length = 358

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A +FGVPQ RER+YI+ F   +    F +P PL       DI EE  +  K  +S + 
Sbjct: 176 VNAKNFGVPQNRERIYIVGFHKSTGVNSFSYPEPLDKIVTFADIREEKTVPTKYYLSTQY 235

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            +  +K KE ++  G GFGY
Sbjct: 236 IDTLRKHKERHESKGNGFGY 255


>gi|167854713|ref|ZP_02477492.1| cell division protein MukB [Haemophilus parasuis 29755]
 gi|167854127|gb|EDS25362.1| cell division protein MukB [Haemophilus parasuis 29755]
          Length = 361

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F        F +P PL  K    D+ E++ +  K  +S + 
Sbjct: 181 LNAKDFGVPQNRERIFIVGFRQDLAINSFYYPAPLNRKVCFNDVKEKNVVPTKYYLSTQY 240

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            E  +K K  ++  G GFGY
Sbjct: 241 IETLRKHKARHQDKGNGFGY 260


>gi|145629543|ref|ZP_01785341.1| modification methylase HaeII [Haemophilus influenzae 22.1-21]
 gi|144978386|gb|EDJ88150.1| modification methylase HaeII [Haemophilus influenzae 22.1-21]
          Length = 219

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ FL+  + F+FP P+G    L +ILE    D    +N     
Sbjct: 45  LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILES---DDVVPNNYFLSD 100

Query: 61  HQKRKENNKIA 71
             KRK  + I 
Sbjct: 101 ELKRKRLSSIT 111


>gi|292670064|ref|ZP_06603490.1| modification methylase EcoRII [Selenomonas noxia ATCC 43541]
 gi|292648252|gb|EFF66224.1| modification methylase EcoRII [Selenomonas noxia ATCC 43541]
          Length = 377

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 5   DFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKLWEGH 61
           DFGVPQ RER+YI+ F N   S  F FP        + DI+E E +  K  +S       
Sbjct: 185 DFGVPQNRERIYIVAFRNDIDSTGFAFPEGHDSNTTIRDIMEAEEVSVKYYLSTVYLASL 244

Query: 62  QKRKENNKIAGKGFGY 77
           ++ K +++  G GFGY
Sbjct: 245 RRHKAHHEALGHGFGY 260


>gi|159026722|emb|CAO89036.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 455

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 33/48 (68%), Gaps = 3/48 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE 45
           + A DFG+PQ RER++I+     ++    FKFP PLGI P++ DILE+
Sbjct: 169 LNAYDFGLPQNRERVFIVGIRKDIDNYERFKFPLPLGIHPKVLDILED 216


>gi|166368611|ref|YP_001660884.1| cytosine-specific methyltransferase [Microcystis aeruginosa
           NIES-843]
 gi|166090984|dbj|BAG05692.1| cytosine-specific methyltransferase [Microcystis aeruginosa
           NIES-843]
          Length = 464

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 33/48 (68%), Gaps = 3/48 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE 45
           + A DFG+PQ RER++I+     ++    FKFP PLGI P++ DILE+
Sbjct: 177 LNAYDFGLPQNRERVFIVGIRKDIDNYERFKFPLPLGIHPKVLDILED 224


>gi|119493789|ref|ZP_01624358.1| type II restriction enzyme HaeII [Lyngbya sp. PCC 8106]
 gi|119452484|gb|EAW33671.1| type II restriction enzyme HaeII [Lyngbya sp. PCC 8106]
          Length = 689

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 8/87 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58
           + A DFG+PQ+RER YI+ FL  ++ F FP P+  +  L +ILE  E + DKS  +++  
Sbjct: 150 LNALDFGLPQKRERTYIVGFLE-NIHFSFPKPIQKRVSLSEILEPDEQV-DKSLFASEFI 207

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSA 85
           +    +K   ++  K F   ++ EN +
Sbjct: 208 Q----KKRIQRLKVKPFYPSIWHENKS 230


>gi|288559284|ref|YP_003422770.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1]
 gi|288541994|gb|ADC45878.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1]
          Length = 339

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK--STISNKLW 58
           + + D+GVPQ RER++I+ F +    FKFP P   K  + D+LE+++ D   S I++   
Sbjct: 170 LNSKDYGVPQNRERIFIVGFKDNVNTFKFPLPFENKANINDLLEKNVKDHELSGIASDHL 229

Query: 59  EGHQKRKENNKIAGKGF 75
           + H +    NK   K +
Sbjct: 230 KKHYEEFLKNKKVNKNY 246


>gi|255279955|ref|ZP_05344510.1| modification methylase EcoRII [Bryantella formatexigens DSM 14469]
 gi|255269728|gb|EET62933.1| modification methylase EcoRII [Bryantella formatexigens DSM 14469]
          Length = 311

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + + DFGVPQ R R Y++ F N   EF FP    ++  L D+LE+ + +K  +S ++
Sbjct: 148 LNSADFGVPQTRNRTYLVCFSNQKAEFTFPQTEPLESTLQDLLEQDVAEKYFLSERI 204


>gi|290969050|ref|ZP_06560585.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781006|gb|EFD93599.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1
           str. 28L]
          Length = 333

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56
           + + DFGVPQ RER+YI+ F   + P+  F+FP        + DI+EE     K  +S+ 
Sbjct: 147 LNSKDFGVPQNRERIYIVAFREDIAPNT-FRFPEKTDDTKVIADIMEEKEPSSKYYLSDV 205

Query: 57  LWEGHQKRKENNKIAGKGFGY 77
                +K K+ ++  G GFGY
Sbjct: 206 YLASLRKHKQRHQAKGNGFGY 226


>gi|167751356|ref|ZP_02423483.1| hypothetical protein EUBSIR_02342 [Eubacterium siraeum DSM 15702]
 gi|167655602|gb|EDR99731.1| hypothetical protein EUBSIR_02342 [Eubacterium siraeum DSM 15702]
          Length = 475

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + + +FGVPQ RER+YI+ F N     +F+FP       R+ DI+EE+ +  K  +S+  
Sbjct: 294 LNSKNFGVPQNRERIYIVAFRNDIAPEKFEFPQGNDDTKRIKDIIEENPVPAKYYLSDVY 353

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            E  ++ K  ++  G GFGY
Sbjct: 354 LETLRRHKARHESKGNGFGY 373


>gi|329298618|ref|ZP_08255954.1| DNA cytosine methylase [Plautia stali symbiont]
          Length = 465

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 50/106 (47%), Gaps = 15/106 (14%)

Query: 8   VPQRRERLYIID----------FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +PQ RER+ ++           F   ++   +P  +   P L  +LE     K  +S  L
Sbjct: 275 LPQHRERIVLVGIRRDTGLSEGFSLRALAALYPPEV---PALHSLLELQPAAKYILSPTL 331

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           W    +  + +K  G GFG+GL    +      TLSARYYKDGSEI
Sbjct: 332 WHYLYQYAKKHKAKGNGFGFGLNDPRNPHCCVRTLSARYYKDGSEI 377


>gi|326573696|gb|EGE23654.1| DNA-cytosine methyltransferase [Moraxella catarrhalis O35E]
          Length = 408

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + + D+G+PQ RER+++I F N P   F+FP P+ ++  + D LE++ D K  +  K
Sbjct: 180 LNSKDYGIPQHRERIFVIGFKNKPKNGFEFPQPIELEYTMQDFLEDYTDSKYFLKEK 236


>gi|296114006|ref|YP_003627944.1| DNA-cytosine methyltransferase [Moraxella catarrhalis RH4]
 gi|295921700|gb|ADG62051.1| DNA-cytosine methyltransferase [Moraxella catarrhalis RH4]
          Length = 410

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + + D+G+PQ RER+++I F N P   F+FP P+ ++  + D LE++ D K  +  K
Sbjct: 182 LNSKDYGIPQHRERIFVIGFKNKPKNGFEFPQPIELEYTMQDFLEDYTDSKYFLKEK 238


>gi|15676724|ref|NP_273868.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis MC58]
 gi|7226061|gb|AAF41239.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis MC58]
 gi|308389005|gb|ADO31325.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha710]
 gi|316984499|gb|EFV63467.1| modification methylase HpaII [Neisseria meningitidis H44/76]
 gi|325129944|gb|EGC52743.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304]
 gi|325140023|gb|EGC62552.1| DNA-cytosine methyltransferase [Neisseria meningitidis CU385]
 gi|325206334|gb|ADZ01787.1| DNA-cytosine methyltransferase [Neisseria meningitidis M04-240196]
          Length = 411

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|218767941|ref|YP_002342453.1| putative modification methylase [Neisseria meningitidis Z2491]
 gi|6900408|emb|CAB72018.1| putative cytosine-specific methyltransferase [Neisseria
           meningitidis]
 gi|121051949|emb|CAM08255.1| putative modification methylase [Neisseria meningitidis Z2491]
          Length = 411

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|313668701|ref|YP_004048985.1| modification methylase [Neisseria lactamica ST-640]
 gi|313006163|emb|CBN87625.1| putative modification methylase [Neisseria lactamica 020-06]
          Length = 372

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 145 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 201


>gi|166368121|ref|YP_001660394.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
 gi|166090494|dbj|BAG05202.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
          Length = 347

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56
           + A  FGVPQ R R++I+ F   LN    F +P P   +  L DILEE  +  K  +SN+
Sbjct: 145 LNARYFGVPQNRPRIFIVGFREDLN-IYHFSYPQPTHQETCLKDILEEKEVSVKYYLSNQ 203

Query: 57  LWEGHQKRKENNKIAGKGFGY 77
             E   K K  ++  G GFGY
Sbjct: 204 YLETLFKHKARHQHKGNGFGY 224


>gi|304387865|ref|ZP_07370039.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|254670653|emb|CBA06706.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha153]
 gi|254672637|emb|CBA06420.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha275]
 gi|261392815|emb|CAX50396.1| putative type II restriction-modification system enzyme Mod
           [Neisseria meningitidis 8013]
 gi|304338130|gb|EFM04266.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|319410190|emb|CBY90526.1| putative type II restriction-modification system enzyme Mod
           [Neisseria meningitidis WUE 2594]
 gi|325134031|gb|EGC56686.1| DNA-cytosine methyltransferase [Neisseria meningitidis M13399]
 gi|325203903|gb|ADY99356.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240355]
          Length = 411

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|161869767|ref|YP_001598934.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
 gi|161595320|gb|ABX72980.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
          Length = 411

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|325127899|gb|EGC50802.1| DNA-cytosine methyltransferase [Neisseria meningitidis N1568]
          Length = 411

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|121634611|ref|YP_974856.1| putative modification methylase [Neisseria meningitidis FAM18]
 gi|4887086|gb|AAD32180.1|AF125564_2 putative site specific DNA methyltransferase [Neisseria
           meningitidis]
 gi|120866317|emb|CAM10058.1| putative modification methylase [Neisseria meningitidis FAM18]
 gi|325132026|gb|EGC54724.1| DNA-cytosine methyltransferase [Neisseria meningitidis M6190]
 gi|325135954|gb|EGC58564.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579]
 gi|325137780|gb|EGC60355.1| DNA-cytosine methyltransferase [Neisseria meningitidis ES14902]
 gi|325142075|gb|EGC64502.1| DNA-cytosine methyltransferase [Neisseria meningitidis 961-5945]
 gi|325198036|gb|ADY93492.1| DNA-cytosine methyltransferase [Neisseria meningitidis G2136]
 gi|325202381|gb|ADY97835.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149]
 gi|325207867|gb|ADZ03319.1| DNA-cytosine methyltransferase [Neisseria meningitidis NZ-05/33]
          Length = 411

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|325144138|gb|EGC66445.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240013]
 gi|325200491|gb|ADY95946.1| DNA-cytosine methyltransferase [Neisseria meningitidis H44/76]
          Length = 406

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 179 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 235


>gi|306828113|ref|ZP_07461376.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pyogenes ATCC
           10782]
 gi|304429650|gb|EFM32696.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pyogenes ATCC
           10782]
          Length = 214

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A D+GVPQ RER++ +  L     + FP    +  RL D+LEE +D+K  +S
Sbjct: 150 LNAKDYGVPQNRERVFCVSILGDHEPYIFPEKQELTIRLKDVLEEDVDEKYYLS 203


>gi|331270911|ref|YP_004385622.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
 gi|329127303|gb|AEB77247.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
          Length = 318

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 40/66 (60%), Gaps = 12/66 (18%)

Query: 1   MKACDFGVPQRRERLYII-------DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53
           M   D+G+P  R RLYI+       DF     ++KFPT + +K  + D+LE+ ++DK  +
Sbjct: 151 MNTSDYGLPHTRRRLYIVGQRKDLGDF-----DYKFPTEIELKLNVQDLLEKDVNDKYYL 205

Query: 54  SNKLWE 59
           ++K+++
Sbjct: 206 TDKMYK 211


>gi|254443346|ref|ZP_05056822.1| C-5 cytosine-specific DNA methylase superfamily [Verrucomicrobiae
           bacterium DG1235]
 gi|198257654|gb|EDY81962.1| C-5 cytosine-specific DNA methylase superfamily [Verrucomicrobiae
           bacterium DG1235]
          Length = 349

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVE-FKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           +KA DFG+ Q+RER++I+ F     VE F +P     + ++ DILE  H   +  ++ K 
Sbjct: 176 LKASDFGLAQKRERVFIVGFRKSLGVEGFSYPEKGNDRSKISDILEPSHSVGQWLLTKKS 235

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN 83
               +      K+AG G GY +  EN
Sbjct: 236 LACLRDHSSKQKLAGNGHGYAILDEN 261


>gi|56461628|ref|YP_156909.1| DNA cytosine methylase [Idiomarina loihiensis L2TR]
 gi|56180638|gb|AAV83360.1| DNA cytosine methylase [Idiomarina loihiensis L2TR]
          Length = 419

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ R+R Y++ F      F FP P  IK  +G +LE+  +  S IS  L + 
Sbjct: 240 LNASDFGVPQNRKRFYLVAFDGKDCGFSFPQPPMIKADIGTLLEKGAEGYS-ISEHLQKT 298

Query: 61  HQKRKENNK 69
           +  +K++ +
Sbjct: 299 YLFKKDDGR 307


>gi|150026305|ref|YP_001297131.1| Type II modification methyltransferase HpaII [Flavobacterium
           psychrophilum JIP02/86]
 gi|149772846|emb|CAL44330.1| Type II modification methyltransferase HpaII [Flavobacterium
           psychrophilum JIP02/86]
          Length = 425

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 45/87 (51%), Gaps = 5/87 (5%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHI-DDKSTISNK 56
           + A +FGVPQ RER+YI+ F   LN S  F++P PL   P    + E+ +   K  +S +
Sbjct: 239 VNAKNFGVPQNRERIYIVGFRQDLNIS-SFEYPEPLENNPTFESVKEKLVPPTKYYLSTQ 297

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFEN 83
             +     K  +   G GFGY +  +N
Sbjct: 298 YVQTLINHKARHASKGNGFGYAIIPDN 324


>gi|159027151|emb|CAO86782.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 347

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56
           + A  FGVPQ R R++I+ F   LN    F +P P   +  L DILEE  +  K  +SN+
Sbjct: 145 LNARYFGVPQNRPRIFIVGFREDLN-IYHFSYPQPTHPETCLKDILEEKEVSVKYYLSNQ 203

Query: 57  LWEGHQKRKENNKIAGKGFGY 77
             E   K K  ++  G GFGY
Sbjct: 204 YLETLFKHKARHENKGNGFGY 224


>gi|269121452|ref|YP_003309629.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
 gi|268615330|gb|ACZ09698.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
          Length = 372

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 34/54 (62%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A ++ +PQ RERL+ +  L+  V++ FP P  +   L D+LE+ +D+K  I+
Sbjct: 150 LNALNYEIPQNRERLFCLSILDDKVKYNFPGPKKLNILLKDLLEKEVDEKYFIN 203


>gi|261252209|ref|ZP_05944782.1| DNA-cytosine methyltransferase [Vibrio orientalis CIP 102891]
 gi|260935600|gb|EEX91589.1| DNA-cytosine methyltransferase [Vibrio orientalis CIP 102891]
          Length = 584

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 51/105 (48%), Gaps = 11/105 (10%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLG--IKPR----LGDILEEHIDDKS---TISNKLW 58
           +PQ RER+ ++         K    L    KP     L DIL E  D+ S   T++  LW
Sbjct: 307 LPQHRERVVLVGVRKDLTIDKSKLSLNNIQKPTERVPLKDILCELSDEDSSKYTLTPNLW 366

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
                    ++  G GFG+GL   ++    T TLSARY+KDGSEI
Sbjct: 367 NYLYNYALKHQTQGNGFGFGLVDPSNINTVTRTLSARYHKDGSEI 411


>gi|288576182|ref|ZP_05978340.2| DNA (cytosine-5-)-methyltransferase [Neisseria mucosa ATCC 25996]
 gi|288566126|gb|EFC87686.1| DNA (cytosine-5-)-methyltransferase [Neisseria mucosa ATCC 25996]
          Length = 406

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P    F+FP  + ++  + D LE++ D K  +  K
Sbjct: 179 MNSKDYGIPQHRERIFVVGFHTPPTNGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 235


>gi|149369548|ref|ZP_01889400.1| C-5 cytosine-specific DNA-methylase [unidentified eubacterium
           SCB49]
 gi|149356975|gb|EDM45530.1| C-5 cytosine-specific DNA-methylase [unidentified eubacterium
           SCB49]
          Length = 421

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 10/96 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-----LNPSVEFKFPTPLGIKPRLGDILE-EHIDDKSTIS 54
           + A  FGVPQ RER++I+ F     +N    FK+P P   +  L +ILE E +  K  +S
Sbjct: 241 LNAKKFGVPQNRERIFIVGFRKDLGIN---NFKYPEPTDTEAILENILEAEEVSVKYYLS 297

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
               +  +  +  ++  G GFGY +   N+ T N +
Sbjct: 298 EVYLQTLRNHRARHESKGNGFGYEI-IPNNGTANAV 332


>gi|296313699|ref|ZP_06863640.1| modification methylase NgoBI [Neisseria polysaccharea ATCC 43768]
 gi|296839717|gb|EFH23655.1| modification methylase NgoBI [Neisseria polysaccharea ATCC 43768]
          Length = 315

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LGD+LE   D
Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGDLLENDRD 188


>gi|327403407|ref|YP_004344245.1| DNA-cytosine methyltransferase [Fluviicola taffensis DSM 16823]
 gi|327318915|gb|AEA43407.1| DNA-cytosine methyltransferase [Fluviicola taffensis DSM 16823]
          Length = 422

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56
           M A +FGVPQ RER++I+ F   LN    F++P P+       D+ EE  +  K  +S  
Sbjct: 241 MNAKNFGVPQNRERIFIVGFRKDLNID-SFEYPLPVSKSVTFQDVREEKEVSVKYYLSET 299

Query: 57  LWEGHQKRKENNKIAGKGFGY 77
                 K KE +   G GFG+
Sbjct: 300 YLNTLVKHKERHASKGNGFGF 320


>gi|302671270|ref|YP_003831230.1| DNA-cytosine methyltransferase [Butyrivibrio proteoclasticus B316]
 gi|302395743|gb|ADL34648.1| DNA-cytosine methyltransferase [Butyrivibrio proteoclasticus B316]
          Length = 579

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RERL+++ F   L+  VEF FP  + ++ ++ D L
Sbjct: 354 LNARDYGVPQNRERLFVVGFRNDLDLDVEFSFPQAIELEKKMQDFL 399


>gi|325269501|ref|ZP_08136117.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
 gi|324988120|gb|EGC20087.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
          Length = 388

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           + A D+G+PQ RERLY + F     +FK+P P+ ++ ++ D LE++ +
Sbjct: 180 LNARDYGIPQTRERLYCVGF-KKKTKFKYPAPIPLRYKMYDFLEDYTN 226


>gi|291530358|emb|CBK95943.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3]
          Length = 696

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 5   DFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWEGH 61
           +FGVPQ RER+YI+ F N      F FP        L DI E + +  K  +S+   +  
Sbjct: 158 NFGVPQNRERIYIVAFRNDIAPDNFDFPESTDTNKCLLDIRERNPVPAKYYLSDVYVDTL 217

Query: 62  QKRKENNKIAGKGFGY 77
           +K K  ++  G GFGY
Sbjct: 218 RKHKARHEAKGNGFGY 233


>gi|313674544|ref|YP_004052540.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
 gi|312941242|gb|ADR20432.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
          Length = 420

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 3/93 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVE-FKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A D+GVPQ+RER++I+ F  +  +E F++P P        D+ EE  +  K  +SN  
Sbjct: 242 INAKDYGVPQKRERIFIVGFRKDLKIETFEYPEPSKSPVSFEDVKEEEPVSVKYYLSNTY 301

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
               +K K  +   G GFGY +  ++    + +
Sbjct: 302 LNTLKKHKARHLGKGNGFGYAVIADDEIANSVV 334


>gi|170719133|ref|YP_001784281.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336]
 gi|168827262|gb|ACA32633.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336]
          Length = 408

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + ++G+PQ RER++++ F  +P   F+FPT + ++  + D LE++ D K  +  K
Sbjct: 180 MNSKNYGIPQHRERIFVVGFKTSPKGGFQFPTKIPLERTMQDFLEDYTDSKYFLKEK 236


>gi|159026805|emb|CAO86650.1| ngoBIM [Microcystis aeruginosa PCC 7806]
          Length = 331

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FG+PQ+RER++I+ F   +  F +P P   +  L +ILEE++ D    S K+ + 
Sbjct: 156 LNALNFGLPQKRERIFIVGF-REARGFIWPKPALSRTSLTEILEENVSDFYYASEKIQKS 214

Query: 61  HQKRKENNK 69
              ++E  K
Sbjct: 215 RLLKREGKK 223


>gi|209524941|ref|ZP_03273486.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
 gi|209494590|gb|EDZ94900.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
          Length = 442

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFG+PQ R+R++I+     +N    F+FP PL + P+L D + E +  K  I  K 
Sbjct: 160 INASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNLHPKLFDFV-EGVSQKPVIKKKF 218


>gi|282859944|ref|ZP_06269032.1| DNA (cytosine-5-)-methyltransferase [Prevotella bivia JCVIHMP010]
 gi|282587347|gb|EFB92564.1| DNA (cytosine-5-)-methyltransferase [Prevotella bivia JCVIHMP010]
          Length = 448

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56
           + A +FGVPQ RER+YI+ F   LN    F +P P        DI E   +  K  +S  
Sbjct: 258 LNAANFGVPQHRERVYIVGFRKDLNIKA-FNYPMPTDNSKTFADIKEATTVSSKYYLSTT 316

Query: 57  LWEGHQKRKENNKIAGKGFGY 77
             +     K  +   G GFGY
Sbjct: 317 YLDTLIAHKARHAAKGHGFGY 337


>gi|313678561|ref|YP_004056301.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45]
 gi|312950401|gb|ADR24996.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45]
          Length = 315

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 3/54 (5%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKS 51
           + A D+G +PQ RER+YI+ F +      F FP P+ ++  + D LE ++DD S
Sbjct: 145 LNAKDYGDIPQNRERIYIVGFKDKHSHDAFSFPLPVKLRTSINDCLEVNVDDDS 198


>gi|254804105|ref|YP_003082326.1| putative type II DNA modification methyltransferase [Neisseria
           meningitidis alpha14]
 gi|254667647|emb|CBA03458.1| putative type II DNA modification methyltransferase [Neisseria
           meningitidis alpha14]
          Length = 315

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           +   DFG+PQ+RER+YII F + ++ F FP P+     LG++LE   D
Sbjct: 142 LNTLDFGLPQKRERIYIIGFSD-NIPFYFPEPINQYRPLGELLENDRD 188


>gi|291320332|ref|YP_003515594.1| modification methylase Bsp6I [Mycoplasma agalactiae]
 gi|290752665|emb|CBH40638.1| Modification methylase Bsp6I [Mycoplasma agalactiae]
          Length = 315

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDD 49
           + A D+G +PQ RER+YI+ F +      F FP P+ +K  L D LE ++DD
Sbjct: 145 LNAKDYGDIPQNRERIYIVGFKDKHSYDIFSFPLPVKLKTSLNDCLEVNVDD 196


>gi|254445875|ref|ZP_05059351.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
 gi|198260183|gb|EDY84491.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
          Length = 321

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 22/45 (48%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ R+RLYI+       S EFKFP   G + RL D+L
Sbjct: 147 LNASDYGVPQARKRLYIVGIRKDLGSGEFKFPETSGARVRLKDLL 191


>gi|281491829|ref|YP_003353809.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
 gi|281375540|gb|ADA65046.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
          Length = 351

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 8/80 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFP---TPLGIKPRLGDILEEHIDDKSTIS 54
           ++A ++G+PQ+RER++I+     LN    F  P   +PL   P L  +L++  D+K   S
Sbjct: 159 LRAVEYGIPQKRERVFIVGIRNDLNKKFHFADPPIQSPLDYTP-LKKVLQKDFDEKYYFS 217

Query: 55  NKLWEGHQKRKENNKIAGKG 74
           ++  EG  K K  +KI  KG
Sbjct: 218 DRAVEGMLKSKM-SKIMNKG 236


>gi|218248203|ref|YP_002373574.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|257060473|ref|YP_003138361.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|218168681|gb|ACK67418.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|256590639|gb|ACV01526.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 460

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFG+PQ R+R++++   N    S  ++FP PL I P++ DIL++  + K     KL
Sbjct: 168 LNAYDFGLPQNRDRVFLVGIRNDIEGSQNYQFPDPLNIHPKVLDILDDLKNIKPIKKVKL 227

Query: 58  WE 59
            E
Sbjct: 228 SE 229


>gi|12229862|sp|Q59603|MTB1_NEIGO RecName: Full=Modification methylase NgoBI; Short=M.NgoBI; AltName:
           Full=Cytosine-specific methyltransferase NgoBI;
           Short=M.NgoI
 gi|5924404|gb|AAB03206.2| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae]
          Length = 317

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D
Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 188


>gi|194099739|ref|YP_002002874.1| NgoIM [Neisseria gonorrhoeae NCCP11945]
 gi|240013125|ref|ZP_04720038.1| NgoIM [Neisseria gonorrhoeae DGI18]
 gi|240015568|ref|ZP_04722108.1| NgoIM [Neisseria gonorrhoeae FA6140]
 gi|240114103|ref|ZP_04728593.1| NgoIM [Neisseria gonorrhoeae MS11]
 gi|240114658|ref|ZP_04728720.1| NgoIM [Neisseria gonorrhoeae PID18]
 gi|240120196|ref|ZP_04733158.1| NgoIM [Neisseria gonorrhoeae PID24-1]
 gi|240122493|ref|ZP_04735449.1| NgoIM [Neisseria gonorrhoeae PID332]
 gi|240126658|ref|ZP_04739544.1| NgoIM [Neisseria gonorrhoeae SK-92-679]
 gi|254492718|ref|ZP_05105889.1| modification methylase NgoBI [Neisseria gonorrhoeae 1291]
 gi|260441536|ref|ZP_05795352.1| NgoIM [Neisseria gonorrhoeae DGI2]
 gi|268600171|ref|ZP_06134338.1| modification methylase NgoBI [Neisseria gonorrhoeae MS11]
 gi|268600304|ref|ZP_06134471.1| modification methylase NgoBI [Neisseria gonorrhoeae PID18]
 gi|268602536|ref|ZP_06136703.1| modification methylase NgoBI [Neisseria gonorrhoeae PID1]
 gi|268681085|ref|ZP_06147947.1| modification methylase NgoBI [Neisseria gonorrhoeae PID332]
 gi|268685237|ref|ZP_06152099.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-92-679]
 gi|268685565|ref|ZP_06152427.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-93-1035]
 gi|193935029|gb|ACF30853.1| NgoIM [Neisseria gonorrhoeae NCCP11945]
 gi|226511758|gb|EEH61103.1| modification methylase NgoBI [Neisseria gonorrhoeae 1291]
 gi|268584302|gb|EEZ48978.1| modification methylase NgoBI [Neisseria gonorrhoeae MS11]
 gi|268584435|gb|EEZ49111.1| modification methylase NgoBI [Neisseria gonorrhoeae PID18]
 gi|268586667|gb|EEZ51343.1| modification methylase NgoBI [Neisseria gonorrhoeae PID1]
 gi|268621369|gb|EEZ53769.1| modification methylase NgoBI [Neisseria gonorrhoeae PID332]
 gi|268625521|gb|EEZ57921.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-92-679]
 gi|268625849|gb|EEZ58249.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-93-1035]
 gi|317165226|gb|ADV08767.1| NgoIM [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 315

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D
Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 188


>gi|59802299|ref|YP_209011.1| NgoIM [Neisseria gonorrhoeae FA 1090]
 gi|240081825|ref|ZP_04726368.1| NgoIM [Neisseria gonorrhoeae FA19]
 gi|59719194|gb|AAW90599.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA 1090]
          Length = 315

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D
Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 188


>gi|307152213|ref|YP_003887597.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
 gi|306982441|gb|ADN14322.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
          Length = 317

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (61%), Gaps = 9/65 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL-GIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++I+  L P + F++P P+  IKP L +ILE      +T++   + 
Sbjct: 159 LNALDFGLPQKRERIFIVGCLEP-IPFEWPMPVRTIKP-LKEILE------TTVAASYYA 210

Query: 60  GHQKR 64
             Q R
Sbjct: 211 SEQIR 215


>gi|268597921|ref|ZP_06132088.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA19]
 gi|268551709|gb|EEZ46728.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA19]
          Length = 320

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D
Sbjct: 147 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 193


>gi|268595734|ref|ZP_06129901.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae 35/02]
 gi|291044897|ref|ZP_06570606.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293397972|ref|ZP_06642178.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|268549123|gb|EEZ44541.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae 35/02]
 gi|291011791|gb|EFE03787.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291611918|gb|EFF40987.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
          Length = 320

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D
Sbjct: 147 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 193


>gi|239999928|ref|ZP_04719852.1| NgoIM [Neisseria gonorrhoeae 35/02]
 gi|240116859|ref|ZP_04730921.1| NgoIM [Neisseria gonorrhoeae PID1]
 gi|240127204|ref|ZP_04739865.1| NgoIM [Neisseria gonorrhoeae SK-93-1035]
          Length = 278

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D
Sbjct: 105 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRD 151


>gi|167747653|ref|ZP_02419780.1| hypothetical protein ANACAC_02374 [Anaerostipes caccae DSM 14662]
 gi|239625035|ref|ZP_04668066.1| modification methylase Rho11sI [Clostridiales bacterium 1_7_47_FAA]
 gi|167653015|gb|EDR97144.1| hypothetical protein ANACAC_02374 [Anaerostipes caccae DSM 14662]
 gi|239521421|gb|EEQ61287.1| modification methylase Rho11sI [Clostridiales bacterium 1_7_47FAA]
          Length = 504

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A ++G+PQ RER+Y++       + +F FP P+    RL DILE+ +D+K  +S+
Sbjct: 158 LNAKNYGIPQNRERVYLVLIKKECDNGKFVFPEPMENGRRLMDILEDEVDEKYYLSD 214


>gi|166367724|ref|YP_001659997.1| modification methylase NgoBI [Microcystis aeruginosa NIES-843]
 gi|166090097|dbj|BAG04805.1| modification methylase NgoBI [Microcystis aeruginosa NIES-843]
          Length = 330

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FG+PQ+RER++I+ F   +  F +P P   +  L +ILEE++ D    S ++ + 
Sbjct: 156 LNALNFGLPQKRERIFIVGF-REARGFIWPKPALSRTTLTEILEENVSDFYYASARIQKS 214

Query: 61  HQKRKENNK 69
              ++E  K
Sbjct: 215 RFLKREGKK 223


>gi|189096062|pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With
           13mer Gcgc-Gmgc Oligonucleotide And Sah
          Length = 327

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            + +N+  E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGSGERIYSTRGIAITLSA 253


>gi|49476998|ref|YP_035184.1| modification methylase HpaII (cytosine-specific methyltransferase
           HpaII) [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|49328554|gb|AAT59200.1| modification methylase HpaII (Cytosine-specific methyltransferase
           HpaII) [Bacillus thuringiensis serovar konkukian str.
           97-27]
          Length = 373

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPR----------LGDILEEHIDD 49
           + + +FGVPQ R R+YI+ F       K  + PL   P+          + D+LE+++ +
Sbjct: 164 LNSRNFGVPQNRPRIYIVGFNQRLYRDKIESMPLFTLPKSRSRKKIYDSVRDVLEDNVGE 223

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGL 79
           K  +S    E  +K KE     G GFGY +
Sbjct: 224 KYYLSEGYLETLKKHKEAQGKKGNGFGYSI 253


>gi|319956919|ref|YP_004168182.1| DNA-cytosine methyltransferase [Nitratifractor salsuginis DSM
           16511]
 gi|319419323|gb|ADV46433.1| DNA-cytosine methyltransferase [Nitratifractor salsuginis DSM
           16511]
          Length = 394

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 6   FGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +G+PQ RER +++ F + +    F+FP  + +K  L D+LE  +D+K  +++K  E
Sbjct: 150 YGLPQNRERYFLVGFKSKTAGERFRFPKKVPLKLILSDVLENKVDEKYYLTDKALE 205


>gi|50513617|pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna
           Methyltransferase: An Insight Into Protein-Protein
           Interactions
 gi|50513618|pdb|1SVU|B Chain B, Structure Of The Q237w Mutant Of Hhai Dna
           Methyltransferase: An Insight Into Protein-Protein
           Interactions
          Length = 327

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 51/103 (49%), Gaps = 12/103 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKGFGYG-LFFENSATTNTLSA 92
            + +N+  E    +     I GKG G+G   +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKG-GWGERIYSTRGIAITLSA 253


>gi|118138268|pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances
           Sequence Discrimination Of Dna Methyltransferase M.Hhai
          Length = 327

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            + +N+  E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|159795737|pdb|2Z6A|A Chain A, S-Adenosyl-L-Methionine-Dependent Methyl Transfer:
           Observable Precatalytic Intermediates During Dna
           Cytosine Methylation
          Length = 327

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            + +N+  E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|160877870|pdb|2Z6U|A Chain A, Ternary Structure Of The Glu119ala M.Hhai, C5-Cytosine Dna
           Methyltransferase, With Unmodified Dna And Adohcy
          Length = 327

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            + +N+  E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|127455|sp|P05102|MTH1_HAEPH RecName: Full=Modification methylase HhaI; Short=M.HhaI; AltName:
           Full=Cytosine-specific methyltransferase HhaI
 gi|1065144|pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna
           And S-Adenosyl-L-Homocysteine
 gi|1942412|pdb|3MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With
           Unmodified Dna And Adohcy
 gi|1942415|pdb|4MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Native
           Dna And Adohcy
 gi|2392799|pdb|5MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With
           Hemimethylated Dna And Adohcy
 gi|3660437|pdb|6MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Adohcy
           And Dna Containing 4'-Thio-2'deoxycytidine At The Target
 gi|4139672|pdb|7MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX
 gi|4139675|pdb|8MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX
 gi|4139680|pdb|9MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX
 gi|4558252|pdb|10MH|A Chain A, Ternary Structure Of Hhai Methyltransferase With Adohcy
           And Hemimethylated Dna Containing
           5,6-Dihydro-5-Azacytosine At The Target
 gi|4699814|pdb|2HMY|B Chain B, Binary Complex Of Hhai Methyltransferase With Adomet
           Formed In The Presence Of A Short Nonpsecific Dna
           Oligonucleotide
 gi|24158912|pdb|1M0E|A Chain A, Zebularine: A Novel Dna Methylation Inhibitor That Forms A
           Covalent Complex With Dna Methyltransferase
 gi|52695513|pdb|1SKM|A Chain A, Hhai Methyltransferase In Complex With Dna Containing An
           Abasic South Carbocyclic Sugar At Its Target Site
 gi|85544385|pdb|2C7O|A Chain A, Hhai Dna Methyltransferase Complex With 13mer
           Oligonucleotide Containing 2-Aminopurine Adjacent To The
           Target Base (Pcgc:gmgc) And Sah
 gi|85544388|pdb|2C7P|A Chain A, Hhai Dna Methyltransferase Complex With Oligonucleotide
           Containing 2-Aminopurine Opposite To The Target Base (
           Gcgc:gmpc) And Sah
 gi|85544391|pdb|2C7Q|A Chain A, Hhai Dna Methyltransferase Complex With Oligonucleotide
           Containing 2-Aminopurine Outside The  Recognition
           Sequence (Paired With G) And Sah
 gi|116667789|pdb|2HR1|A Chain A, Ternary Structure Of Wt M.Hhai C5-Cytosine Dna
           Methyltransferase With Unmodified Dna And Adohcy
 gi|157831356|pdb|1HMY|A Chain A, Crystal Structure Of The Hhal Dna Methyltransferase
           Complexed With S-Adenosyl-L-Methionine
 gi|290560089|pdb|3EEO|A Chain A, M. Hhai Co-Crystallized With Synthetic Dsdna Containing A
           Propane Diol In Place Of The Deoxycytidine Residue
           Targeted For Methylation.
 gi|148949|gb|AAA24989.1| DNA methylase [Haemophilus haemolyticus]
          Length = 327

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            + +N+  E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|161761159|pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna
           Methyltransferase, With Unmodified Dna And Adohcy
          Length = 327

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            + +N+  E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|2599488|gb|AAB84141.1| FauI DNA methyltransferase [Flavobacterium aquatile]
          Length = 343

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 50/98 (51%), Gaps = 4/98 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + +FGVPQ+RER++I+ F   +  + FKFP P+ ++     +L+E ID K+    K W
Sbjct: 165 LNSSEFGVPQKRERVFIVGFRDFDDYLNFKFPQPITLEGS-KIVLKEVIDKKADTEEK-W 222

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
              QK  +      +    G   + +   NT+S+   K
Sbjct: 223 FFSQKAVDGMLRVREKMNKGRVQDLNQPCNTISSHLAK 260


>gi|148826164|ref|YP_001290917.1| modification methylase [Haemophilus influenzae PittEE]
 gi|148716324|gb|ABQ98534.1| modification methylase [Haemophilus influenzae PittEE]
 gi|162532590|gb|ABY16693.1| probable methylase [Haemophilus influenzae]
 gi|309973308|gb|ADO96509.1| Probable cytosine-specific DNA methyltransferase [Haemophilus
           influenzae R2846]
          Length = 409

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + ++G+PQ RER++++ F  P    F FP  + ++  + D LE++ D K  +  K
Sbjct: 181 MNSKNYGIPQHRERIFVVGFKTPPQGGFMFPAEIPLEHSMQDFLEDYTDSKYYLKEK 237


>gi|291530357|emb|CBK95942.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3]
          Length = 317

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 3   ACDFGVPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEEHID-DKS----TISN 55
           ACD+G+PQ R R YI+ F     SV F FP    ++  + D++++    DKS      S 
Sbjct: 145 ACDYGIPQHRTRTYIVAFRDFAKSVLFDFPQKQQLQKHIFDVIDKRTKADKSFYLDCNSR 204

Query: 56  KLWEGHQKRKENNKI 70
           + ++  Q   +NN+I
Sbjct: 205 QYYKMKQSIDDNNQI 219


>gi|237742049|ref|ZP_04572530.1| modification methylase HpaII [Fusobacterium sp. 4_1_13]
 gi|229429697|gb|EEO39909.1| modification methylase HpaII [Fusobacterium sp. 4_1_13]
          Length = 385

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 9/84 (10%)

Query: 3   ACDFGVPQRRERLYII----DFLNPSVEFKFPTP-----LGIKPRLGDILEEHIDDKSTI 53
           A DFG+PQRR R YII    D L  +     P P     L I   L D+LE   D K  +
Sbjct: 170 AKDFGIPQRRLRTYIIGFRKDLLQDNNFILEPLPKNRTDLKIYKNLNDLLEFQNDIKYYV 229

Query: 54  SNKLWEGHQKRKENNKIAGKGFGY 77
           ++   +  ++ K  + + G GFG+
Sbjct: 230 ASGYLKTLERHKLKHSLKGNGFGF 253


>gi|323650448|gb|ADX97301.1| M.Fnu4HI [Fusobacterium nucleatum]
          Length = 351

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 7/74 (9%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEE-HIDDKSTIS-- 54
           + A D+G +PQ RER+YI+ F N      F+FP PL +   + D+LE+ +ID+K   S  
Sbjct: 145 LNAKDYGNIPQNRERIYIVGFKNEEHFKNFEFPFPLELTRNIEDMLEKNNIDEKYYYSKE 204

Query: 55  -NKLWEGHQKRKEN 67
            NK ++  +K   N
Sbjct: 205 KNKFYDTLEKEITN 218


>gi|170757755|ref|YP_001781752.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str.
           Okra]
 gi|169122967|gb|ACA46803.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str.
           Okra]
          Length = 561

 Score = 40.8 bits (94), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A D+G+PQ RER++I+     ++  + F FP       RL D LE  +D+K  IS K 
Sbjct: 149 LNAKDYGIPQNRERVFIVSIRKDIDTGI-FSFPKGFDNGLRLKDFLENEVDEKYYISEKA 207

Query: 58  WEG 60
            +G
Sbjct: 208 TQG 210


>gi|126660265|ref|ZP_01731380.1| putative DNA modification methylase (N.MgoV) [Cyanothece sp.
           CCY0110]
 gi|126618440|gb|EAZ89194.1| putative DNA modification methylase (N.MgoV) [Cyanothece sp.
           CCY0110]
          Length = 458

 Score = 40.8 bits (94), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEE 45
           + + DFGVPQ RER++I+           ++FP PL ++ RL D+L+E
Sbjct: 173 INSYDFGVPQNRERVFIVGIRKDRKNCHHYQFPKPLKVQIRLLDVLDE 220


>gi|326798326|ref|YP_004316145.1| DNA-cytosine methyltransferase [Sphingobacterium sp. 21]
 gi|326549090|gb|ADZ77475.1| DNA-cytosine methyltransferase [Sphingobacterium sp. 21]
          Length = 409

 Score = 40.8 bits (94), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-EEHIDDKSTISNKL 57
           + A +FGVPQ RER++I+ +        F++P PL     + DI  EE +  K  +S + 
Sbjct: 229 VNAKNFGVPQNRERIFIVGYRKDLGIDRFEYPEPLDEPVAIEDIFEEEEVSVKYYLSTQY 288

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            +  ++ K  ++  G GFG+
Sbjct: 289 LKTLKEHKARHESKGNGFGF 308


>gi|308185227|ref|YP_003929360.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori SJM180]
 gi|308061147|gb|ADO03043.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori SJM180]
          Length = 317

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 16/102 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   DFG+PQ+R R++I+     S   +EF FP  +  K    D+L++ ++ K  IS K+
Sbjct: 141 LNTLDFGIPQQRNRVFIVALRKNSFTNLEFVFPAKIPCKISTLDLLDKQVELKYFISQKM 200

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATT---NTLSARYYK 96
            +          I GKG   G   E S  T    TL+A  +K
Sbjct: 201 IK---------TILGKG-TKGYIVEPSIDTPIAKTLTATMHK 232


>gi|296126993|ref|YP_003634245.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563]
 gi|296018809|gb|ADG72046.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563]
          Length = 324

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 4/48 (8%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEE 45
           + A D+G+PQ+RER+YI+ F   LN   +F FP P+ +   L D L E
Sbjct: 152 LNASDYGIPQKRERIYIVCFRKDLNIK-KFDFPKPIELIKHLEDFLLE 198


>gi|268607976|ref|ZP_06141707.1| cytosine-specific DNA-methyltransferase Sau96I [Ruminococcus
           flavefaciens FD-1]
          Length = 407

 Score = 40.4 bits (93), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RERL  I     L   ++F FPTP   KP L D+L
Sbjct: 224 LNAWDYGVAQKRERLITIGIRNDLTNQIKFTFPTPHEYKPVLRDVL 269


>gi|12084381|pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase
           Mutant (T250g) In Complex With Dna And Adohcy
 gi|85544394|pdb|2C7R|A Chain A, Hhai Dna Methyltransferase (T250g Mutant) Complex With
           Oligonucleotide Containing 2-Aminopurine As A Target
           Base (Gpgc:gmgc) And Sah
          Length = 327

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 43/84 (51%), Gaps = 10/84 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKG 74
            + +N+  E    +     I GKG
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKG 235


>gi|317057160|ref|YP_004105627.1| XRE family transcriptional regulator [Ruminococcus albus 7]
 gi|315449429|gb|ADU22993.1| transcriptional regulator, XRE family [Ruminococcus albus 7]
          Length = 407

 Score = 40.0 bits (92), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RERL  I     L   + F FPTP   KP L D+L
Sbjct: 224 LNAWDYGVAQKRERLITIGIRNNLTDKISFSFPTPHEYKPVLRDVL 269


>gi|54297036|ref|YP_123405.1| hypothetical protein lpp1078 [Legionella pneumophila str. Paris]
 gi|53750821|emb|CAH12229.1| hypothetical protein lpp1078 [Legionella pneumophila str. Paris]
          Length = 320

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 6/66 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + + DFGVPQ+RER YI+ F++ +V F+FP   G+   L  ILE+    +  I NK +  
Sbjct: 146 LNSLDFGVPQKRERTYIVGFID-NVPFEFPKG-GVPFNLESILEK----EQQIPNKYYAS 199

Query: 61  HQKRKE 66
              R++
Sbjct: 200 DYIRQK 205


>gi|219855710|ref|YP_002472832.1| hypothetical protein CKR_2367 [Clostridium kluyveri NBRC 12016]
 gi|219569434|dbj|BAH07418.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 419

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 14/101 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFP--TPLGIKPRLGDILEEHIDDKSTISN 55
           M A +FG+PQRRER+ I+ F +P +   +F FP   P    P +  IL EH     +IS 
Sbjct: 245 MDAQNFGLPQRRERIVIVGF-HPDLGINDFSFPKGNPDNKVP-INAIL-EHNPTGYSISK 301

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           +L E +  +K++ K         + F+++   NTL A Y+K
Sbjct: 302 RLQESYLFKKDDGK------PQIVDFDSTIQVNTLVASYHK 336


>gi|153955289|ref|YP_001396054.1| DNA methylase [Clostridium kluyveri DSM 555]
 gi|146348147|gb|EDK34683.1| Predicted DNA methylase [Clostridium kluyveri DSM 555]
          Length = 416

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 14/101 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFP--TPLGIKPRLGDILEEHIDDKSTISN 55
           M A +FG+PQRRER+ I+ F +P +   +F FP   P    P +  IL EH     +IS 
Sbjct: 242 MDAQNFGLPQRRERIVIVGF-HPDLGINDFSFPKGNPDNKVP-INAIL-EHNPTGYSISK 298

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           +L E +  +K++ K         + F+++   NTL A Y+K
Sbjct: 299 RLQESYLFKKDDGK------PQIVDFDSTIQVNTLVASYHK 333


>gi|220930232|ref|YP_002507141.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
 gi|220000560|gb|ACL77161.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
          Length = 416

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 14/101 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFP--TPLGIKPRLGDILEEHIDDKSTISN 55
           M A +FG+PQRRER+ I+ F +P +   +F FP   P    P +  IL EH     +IS 
Sbjct: 242 MDAQNFGLPQRRERIVIVGF-HPDLGINDFSFPKGNPDNKVP-INAIL-EHNPTGYSISK 298

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           +L E +  +K++ K         + F+++   NTL A Y+K
Sbjct: 299 RLQESYLFKKDDGK------PQIVDFDSTIQVNTLVASYHK 333


>gi|79835495|gb|ABB52098.1| Mod [Arthrospira platensis]
          Length = 412

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILE 44
           + A DFG+PQ R+R++I+     +N    F+FP PL   P+L + +E
Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206


>gi|284051619|ref|ZP_06381829.1| DNA-cytosine methyltransferase [Arthrospira platensis str. Paraca]
          Length = 443

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILE 44
           + A DFG+PQ R+R++I+     +N    F+FP PL   P+L + +E
Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206


>gi|315506801|ref|YP_004085688.1| DNA-cytosine methyltransferase [Micromonospora sp. L5]
 gi|315413420|gb|ADU11537.1| DNA-cytosine methyltransferase [Micromonospora sp. L5]
          Length = 412

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 8/73 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           ++A D+GVPQ R R  ++         F +P P G  P +GD L E + ++       W 
Sbjct: 148 LQASDYGVPQLRPRFILVALKTEDAPYFHWPEPQGAPPTVGDTLVELMAERG------WR 201

Query: 60  GHQKRKEN-NKIA 71
           G Q   E  NK+A
Sbjct: 202 GAQAWAERANKVA 214


>gi|269119458|ref|YP_003307635.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
 gi|268613336|gb|ACZ07704.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
          Length = 383

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK---STISNKL 57
           + A D+ +PQRR+R++ +       ++ FP P+ +K RL D+LE+ + +K     I N  
Sbjct: 148 LNAKDYRIPQRRKRVFCVSIFGNE-KYVFPKPVELKLRLRDMLEKEVPEKYYLKDIDNNK 206

Query: 58  WEGHQKRKENNKIAGK 73
           +  +  +K+   I+G+
Sbjct: 207 FHVNMNKKQGYFISGE 222


>gi|291570812|dbj|BAI93084.1| cytosine-specific DNA methyltransferase [Arthrospira platensis
           NIES-39]
          Length = 443

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILE 44
           + A DFG+PQ R+R++I+     +N    F+FP PL   P+L + +E
Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206


>gi|237739124|ref|ZP_04569605.1| C-5 cytosine-specific DNA methylase [Fusobacterium sp. 2_1_31]
 gi|229423724|gb|EEO38771.1| C-5 cytosine-specific DNA methylase [Fusobacterium sp. 2_1_31]
          Length = 361

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDIL 43
           + A ++GV Q+RERL I+    D +N  + F FPTP   KP L DIL
Sbjct: 179 LNAWNYGVAQKRERLIIVGIRNDLIN-KLNFLFPTPHKYKPVLRDIL 224


>gi|291549830|emb|CBL26092.1| DNA-methyltransferase (dcm) [Ruminococcus torques L2-14]
          Length = 410

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDIL 43
           + A D+GVPQ+RERL  I   N  VE   F FP     KP L DIL
Sbjct: 227 LNAWDYGVPQKRERLITIGIRNDLVEKTSFTFPKEQEYKPVLRDIL 272


>gi|319779706|ref|YP_004130619.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9]
 gi|317109730|gb|ADU92476.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9]
          Length = 329

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDIL 43
           + +CD+G+PQ R R++++ F       EFKFP P  +   + DIL
Sbjct: 152 LNSCDYGIPQSRARIFMVAFREDLKHQEFKFPAPKNLDKYVEDIL 196


>gi|320326214|gb|EFW82269.1| cytosine-specific DNA-methyltransferase [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 448

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 5   DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +FG+PQ RER+YI+  L P  +F +P        +  +L++H  D   +S ++
Sbjct: 153 NFGIPQIRERVYIVGSLIPLEDFSWPKKTDAPTSIDTVLDDHPADAKKLSTQV 205


>gi|312281368|ref|YP_004022731.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181897|gb|ADQ42066.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 319

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           + + ++G VPQ RER+YI+ FL+ S+   FKFP P+ +   + DI++
Sbjct: 146 LNSLEYGNVPQNRERVYIVGFLDKSMYEAFKFPEPVSLTVTIHDIIK 192


>gi|309379398|emb|CBX21965.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 223

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 7  GVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
          G PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 2  GFPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 52


>gi|167920593|ref|ZP_02507684.1| cytosine-specific DNA methylase [Burkholderia pseudomallei BCC215]
          Length = 454

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 5   DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +FG+PQ RER+YI+    P   F++P  +     +  IL+++ DD   +S ++
Sbjct: 153 NFGIPQIRERVYIVGSTEPLTSFQWPEMIDATTSIETILDKNPDDARQLSAQV 205


>gi|293596744|ref|ZP_05263998.2| DNA-methyltransferase [Listeria monocytogenes J2818]
 gi|293592003|gb|EFG00338.1| DNA-methyltransferase [Listeria monocytogenes J2818]
          Length = 327

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           + A DFG+PQ RER++++  L  +  F+FP  +     L D ++  +D
Sbjct: 150 LNARDFGIPQNRERVFVVSVLGNNTGFQFPEKIESAMSLKDYIDFEVD 197


>gi|254901064|ref|ZP_05260988.1| DNA-methyltransferase (cytosine-specific) [Listeria monocytogenes
           J0161]
          Length = 320

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           + A DFG+PQ RER++++  L  +  F+FP  +     L D ++  +D
Sbjct: 143 LNARDFGIPQNRERVFVVSVLGNNTGFQFPEKIESAMSLKDYIDFEVD 190


>gi|160934346|ref|ZP_02081733.1| hypothetical protein CLOLEP_03217 [Clostridium leptum DSM 753]
 gi|156867019|gb|EDO60391.1| hypothetical protein CLOLEP_03217 [Clostridium leptum DSM 753]
          Length = 433

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RERL  I   N  V+   F FP P   KP L DIL
Sbjct: 251 LNAWDYGVAQKRERLITIGIRNDLVQKIKFDFPAPHKYKPVLRDIL 296


>gi|317500279|ref|ZP_07958506.1| cytosine-specific methyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087487|ref|ZP_08336423.1| hypothetical protein HMPREF1025_00006 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|316898322|gb|EFV20366.1| cytosine-specific methyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330410467|gb|EGG89898.1| hypothetical protein HMPREF1025_00006 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 410

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A DFGVPQ+RERL  +   N     V F FP     KP L DIL
Sbjct: 227 LNAWDFGVPQKRERLITVGIRNDLVGKVSFSFPKEHNYKPVLRDIL 272


>gi|167751358|ref|ZP_02423485.1| hypothetical protein EUBSIR_02344 [Eubacterium siraeum DSM 15702]
 gi|167655604|gb|EDR99733.1| hypothetical protein EUBSIR_02344 [Eubacterium siraeum DSM 15702]
          Length = 316

 Score = 38.9 bits (89), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK 50
           ACD+G+PQ R R YI+ F +      F+FP    ++  L D++++ +  K
Sbjct: 145 ACDYGIPQHRTRTYIVAFKSQKACDSFRFPEKCELQKHLFDVIDKTVKGK 194


>gi|189339547|pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer
           Gcgc-Gmgc Oligonucleotide And Sah
          Length = 327

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+RE +Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKRENIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            + +N+  E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|189096047|pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer
           Gcgc-Gmgc Oligonucleotide And Sah
          Length = 327

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+ ER+Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKNERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            + +N+  E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|148380278|ref|YP_001254819.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum A str.
           ATCC 3502]
 gi|148289762|emb|CAL83870.1| putative C-5 cytosine-specific DNA methylase [Clostridium botulinum
           A str. ATCC 3502]
          Length = 340

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 5   DFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           D+G PQ RER++ I       +  FKFP P+     +  IL+E++D K    NK
Sbjct: 156 DYGSPQSRERMFCISIRKDIDACLFKFPKPMDSIVPINTILDEYVDKKYYCINK 209


>gi|328947611|ref|YP_004364948.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
 gi|328447935|gb|AEB13651.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
          Length = 391

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32
           + A DFGVPQ R+R +I+   NP+ E   PTP
Sbjct: 158 LCATDFGVPQTRKRFFILASKNPTTELSAPTP 189


>gi|291551321|emb|CBL27583.1| DNA-methyltransferase (dcm) [Ruminococcus torques L2-14]
          Length = 595

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 30/46 (65%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43
           + + ++G+PQ RERL+++ F   L  + +F FP P+ ++ ++ D L
Sbjct: 368 LNSKNYGIPQNRERLFVVGFREDLELAKKFSFPNPIPLRKKMKDFL 413


>gi|258511120|ref|YP_003184554.1| DNA-cytosine methyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477846|gb|ACV58165.1| DNA-cytosine methyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 395

 Score = 38.9 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 25/33 (75%), Gaps = 1/33 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32
           + A D+GVPQ+RER++I+ F +  ++E+ FP P
Sbjct: 178 LNAADYGVPQKRERVFIVGFRSDLNIEWSFPNP 210


>gi|158431504|pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna
           Methyltransferase With Unmodified Dna And Adohcy
          Length = 327

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-----EEH--IDDKS 51
           + A D+G+PQ+RE +Y+I F N      F+FP P  +   + D+L      EH  ID K 
Sbjct: 152 LNALDYGIPQKREAIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 52  TI-SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            + +N+  E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|291544225|emb|CBL17334.1| DNA-methyltransferase (dcm) [Ruminococcus sp. 18P13]
          Length = 407

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43
           + A ++GV Q+RERL  I     L   ++F FPTP   KP L D+L
Sbjct: 224 LNAWNYGVAQKRERLITIGIRNDLTNQIKFTFPTPHEYKPVLRDVL 269


>gi|320326171|gb|EFW82226.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea
           str. B076]
          Length = 404

 Score = 38.5 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 16/33 (48%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32
           + A D+GVPQ+RER+++I F +   VE+ FP P
Sbjct: 181 VNAADYGVPQKRERVFLIGFRDDLEVEWSFPAP 213


>gi|254933776|ref|ZP_05267135.1| DNA-cytosine methyltransferase [Listeria monocytogenes HPB2262]
 gi|293585336|gb|EFF97368.1| DNA-cytosine methyltransferase [Listeria monocytogenes HPB2262]
          Length = 325

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           + A D+G+PQ RER++++  L  + EF+FP  +     L D ++  +D
Sbjct: 143 LNARDYGIPQNRERVFVVSVLGNNKEFQFPEKVKPVKSLKDYIDFDVD 190


>gi|332310450|gb|EGJ23545.1| DNA-methyltransferase (Dcm) [Listeria monocytogenes str. Scott A]
          Length = 325

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           + A D+G+PQ RER++++  L  + EF+FP  +     L D ++  +D
Sbjct: 143 LNARDYGIPQNRERVFVVSVLGNNKEFQFPEKVKPVKSLKDYIDFDVD 190


>gi|314055145|ref|YP_004063483.1| putative cytosine-specific methyltransferase [Ostreococcus tauri
           virus 2]
 gi|313575036|emb|CBI70049.1| putative cytosine-specific methyltransferase [Ostreococcus tauri
           virus 2]
          Length = 349

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43
           +KA + GVPQ+RERL+I+   +    F+FP P   +  L DIL
Sbjct: 152 LKAHEHGVPQKRERLFIVGSRDADFTFEFPEPSNNEVGLKDIL 194


>gi|310657624|ref|YP_003935345.1| cytosine-specific methyltransferase [Clostridium sticklandii DSM
           519]
 gi|308824402|emb|CBH20440.1| Cytosine-specific methyltransferase [Clostridium sticklandii]
          Length = 326

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISN 55
           M + +FGVPQ+RER+ II F  +  +EF FP  +         L  ++E  + +K   S 
Sbjct: 154 MNSVNFGVPQKRERVIIIGFRKDLELEFNFPEEIIANEWEFLNLSMVIESEVSEKYFFSE 213

Query: 56  KLWEGHQKRK 65
           K  +G  K++
Sbjct: 214 KAVQGMLKKR 223


>gi|309776146|ref|ZP_07671137.1| CPG DNA methylase [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916097|gb|EFP61846.1| CPG DNA methylase [Erysipelotrichaceae bacterium 3_1_53]
          Length = 456

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           + A D G+PQ RER ++I  L     ++FP    +  ++ D+LEE +D
Sbjct: 224 VDAADHGIPQHRERCFMISILG-EYSYRFPAGRKLHIQMKDLLEEKVD 270


>gi|325269502|ref|ZP_08136118.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
 gi|324988121|gb|EGC20088.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
          Length = 393

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 5   DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           D+GVPQ R+R+Y I F     +FK+P P+ +   + D L++  + +  +  K
Sbjct: 184 DYGVPQSRDRIYCIGF-KKETDFKYPAPIPLVKTVYDYLQKKFEKRYLLRQK 234


>gi|329769727|ref|ZP_08261128.1| hypothetical protein HMPREF0433_00892 [Gemella sanguinis M325]
 gi|328838089|gb|EGF87707.1| hypothetical protein HMPREF0433_00892 [Gemella sanguinis M325]
          Length = 406

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 5   DFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK 50
           D+G +PQ RER+YI+ FL      +F+FP  + ++ +L DI++  I +K
Sbjct: 159 DYGNIPQNRERIYIVGFLEKESYDKFEFPNEIKLETKLSDIIDFDIKEK 207


>gi|167630879|ref|YP_001681378.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1]
 gi|167593619|gb|ABZ85367.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1]
          Length = 319

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R R+  +   N  + +F FPT +   P +G+IL + +     I  K W
Sbjct: 145 LNASDYGVPQLRPRVVFVAIRNDLAADFTFPTEIMHAPTVGEILGDLMGANGWIGVKQW 203


>gi|331091845|ref|ZP_08340677.1| hypothetical protein HMPREF9477_01320 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402744|gb|EGG82311.1| hypothetical protein HMPREF9477_01320 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 410

 Score = 38.1 bits (87), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A DFGVPQ+RERL  +   N     V F FP     KP L D+L
Sbjct: 227 LNAWDFGVPQKRERLITVGIRNDLVGKVSFSFPKEHDYKPVLRDVL 272


>gi|255018626|ref|ZP_05290752.1| DNA-methyltransferase (cytosine-specific) [Listeria monocytogenes
           FSL F2-515]
          Length = 172

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE 44
           + A DFG+PQ RER++++  L  + EF+FP  +     L D ++
Sbjct: 110 LNARDFGIPQNRERVFVVSVLGNNKEFQFPEKVEPVKSLKDYID 153


>gi|329767116|ref|ZP_08258644.1| hypothetical protein HMPREF0428_00341 [Gemella haemolysans M341]
 gi|328837841|gb|EGF87466.1| hypothetical protein HMPREF0428_00341 [Gemella haemolysans M341]
          Length = 396

 Score = 38.1 bits (87), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 5   DFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK 50
           D+G VPQ RER+YI+ FL      +F+FP  + ++ +L DI++  I +K
Sbjct: 149 DYGNVPQNRERIYIVGFLEKESFDKFEFPKKIKLETKLSDIIDFDIKEK 197


>gi|288929280|ref|ZP_06423125.1| modification methylase HphIA (Cytosine-specific methyltransferase
           HphIA) [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329382|gb|EFC67968.1| modification methylase HphIA (Cytosine-specific methyltransferase
           HphIA) [Prevotella sp. oral taxon 317 str. F0108]
          Length = 370

 Score = 38.1 bits (87), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 23/28 (82%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK 28
           +KA +FGVP++RERL++I  LN S+E +
Sbjct: 159 VKAIEFGVPEKRERLFVIGTLNKSIELE 186


>gi|1709163|sp|P50188|MTN1_NOCAE RecName: Full=Modification methylase NaeI; Short=M.NaeI; AltName:
           Full=Cytosine-specific methyltransferase NaeI
 gi|775103|gb|AAC43325.1| NaeI modification methyltransferase [Lechevalieria aerocolonigenes]
          Length = 413

 Score = 38.1 bits (87), Expect = 0.39,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFGVPQ R R  ++   N  +  F +P P G  P +G+ L      K  ++   WE
Sbjct: 148 LHASDFGVPQLRPRFVLVALQNKFAPYFTWPEPTGAAPTVGETL------KDLMAADGWE 201

Query: 60  GHQK 63
           G ++
Sbjct: 202 GAEE 205


>gi|34451619|gb|AAQ72366.1| TspRI methylase [Thermus sp. R]
          Length = 431

 Score = 38.1 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 1/32 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32
           + A DFGVPQ R+R++ +  + P +EF++P P
Sbjct: 215 LNAADFGVPQHRKRIFFVG-VRPGIEFRWPRP 245


>gi|218439646|ref|YP_002377975.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424]
 gi|218172374|gb|ACK71107.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424]
          Length = 320

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 9/71 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ+RER++I+  L+P + F +P        L +ILE      + +S+  +  
Sbjct: 159 LNALDFGLPQKRERIFIVGCLDP-IPFIWPNSTRPFKPLQEILE------TQVSSSYYAS 211

Query: 61  HQKRKENNKIA 71
            Q RK  N++A
Sbjct: 212 EQIRK--NRLA 220


>gi|218135211|ref|ZP_03464015.1| hypothetical protein BACPEC_03116 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990596|gb|EEC56607.1| hypothetical protein BACPEC_03116 [Bacteroides pectinophilus ATCC
           43243]
          Length = 344

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHID 48
           + A ++GVPQ+RERL  I   N  V   E++FP     KP L D+L +  D
Sbjct: 152 LNAWNYGVPQKRERLITIGIRNDLVGKTEYRFPKAHSYKPVLRDVLLDCPD 202


>gi|291528318|emb|CBK93904.1| DNA-methyltransferase (dcm) [Eubacterium rectale M104/1]
          Length = 344

 Score = 38.1 bits (87), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHID 48
           + A ++GVPQ+RERL  I   N  V   E++FP     KP L D+L +  D
Sbjct: 152 LNAWNYGVPQKRERLITIGIRNDLVGKTEYRFPKAHSYKPVLRDVLLDCPD 202


>gi|291561285|emb|CBL40084.1| DNA-methyltransferase (dcm) [butyrate-producing bacterium SS3/4]
          Length = 247

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + D+GVPQ RER++I+       +  F+FP  + ++  +GD+L+E +  +  +S +  
Sbjct: 153 LNSADYGVPQGRERVFIVSIRKDVDDHSFRFPPVIPLEMCMGDLLDEEVPAEFYLSEEKT 212

Query: 59  EGHQKRKENN--KIAGKGFG 76
           +   +   N+   IA +G G
Sbjct: 213 QSVIRHDSNHPGHIADRGGG 232


>gi|127427|sp|P17044|MTBF_BACSU RecName: Full=Modification methylase BsuFI; Short=M.BsuFI; AltName:
           Full=Cytosine-specific methyltransferase BsuFI
 gi|39984|emb|CAA35888.1| unnamed protein product [Bacillus subtilis]
          Length = 409

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 52/101 (51%), Gaps = 14/101 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFP--TPLGIKPRLGDILEEHIDDKSTISN 55
           M A +FG+PQRRER+ I+ F +P +   +F FP   P    P +  IL EH     +IS 
Sbjct: 241 MDAQNFGLPQRRERIVIVGF-HPDLGINDFSFPKGNPDNKVP-INAIL-EHNPTGYSISK 297

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           +L E +  +K++ K         + F  +   NTL A Y+K
Sbjct: 298 RLQESYLFKKDDGK------PQIVDFRCTYQVNTLVASYHK 332


>gi|220929948|ref|YP_002506857.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
 gi|220000276|gb|ACL76877.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
          Length = 338

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVE-FKFPTPLGIKPRLGDILEE 45
           + A ++G+PQ RER+Y++ F N  ++E F FP P  +K  + D L E
Sbjct: 152 LNAVNYGIPQNRERIYMVCFRNDLNIENFNFPKPFPLKRYVEDFLLE 198


>gi|307140960|ref|ZP_07500316.1| DNA-cytosine methyltransferase [Escherichia coli H736]
 gi|331645014|ref|ZP_08346131.1| DNA cytosine methyltransferase M.NgoMIII [Escherichia coli H736]
 gi|331035989|gb|EGI08227.1| DNA cytosine methyltransferase M.NgoMIII [Escherichia coli H736]
          Length = 413

 Score = 37.7 bits (86), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32
           + A D+GVPQ+RER++I+ F +   +E+ FP P
Sbjct: 192 VNAADYGVPQKRERVFIVGFRDDLEIEWSFPKP 224


>gi|269114810|ref|YP_003302573.1| Cytosine-specific DNA methyltransferase/Type II site-specific
           deoxyribonuclease [Mycoplasma hominis]
 gi|268322435|emb|CAX37170.1| Cytosine-specific DNA methyltransferase/Type II site-specific
           deoxyribonuclease [Mycoplasma hominis ATCC 23114]
          Length = 553

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 5/46 (10%)

Query: 1   MKACDFGVPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDI 42
           + A DFGVPQ+RERL  I    D L+  + F+FP     KP + D+
Sbjct: 151 LNAWDFGVPQKRERLITIGVRQDLLS-KISFEFPMEHSYKPTMRDV 195


>gi|288928693|ref|ZP_06422539.1| modification methylase NgoBI (Cytosine-specific methyltransferase
           NgoBI) [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329677|gb|EFC68262.1| modification methylase NgoBI (Cytosine-specific methyltransferase
           NgoBI) [Prevotella sp. oral taxon 317 str. F0108]
          Length = 309

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP-RLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER+ I+ F +      F      KP  L  ILEE  D    I  KL+ 
Sbjct: 142 LNAMDFGLPQKRERVIIVGFRDKMAYENFDFTFKKKPFNLATILEEEKD----IDPKLYA 197

Query: 60  GHQKR-KENNKIAGKGFGY-GLFFENSA 85
               R K     AGK   Y  ++ EN A
Sbjct: 198 SKTIREKRKASTAGKEVFYPSIWHENKA 225


>gi|195867949|ref|ZP_03079946.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           9 str. ATCC 33175]
 gi|195660345|gb|EDX53605.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           9 str. ATCC 33175]
          Length = 319

 Score = 37.7 bits (86), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           +   D+G VPQ RER+YI+ FL+      FK+P P+ +   + D+++
Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEAFKYPCPITLTNTIRDVID 192


>gi|323178455|gb|EFZ64033.1| modification methylase NgoMIV [Escherichia coli 1180]
          Length = 377

 Score = 37.7 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 8/71 (11%)

Query: 3   ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           A D+GVPQ R R+ ++      S  F++P+   I P +GD L +       +S   WEG 
Sbjct: 155 ASDYGVPQLRPRVLLVALRGKYSAHFRWPSETLIPPTVGDALFD------LMSQGGWEGA 208

Query: 62  QK-RKENNKIA 71
           +  RK  N IA
Sbjct: 209 EAWRKAANNIA 219


>gi|67922277|ref|ZP_00515790.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
 gi|67855853|gb|EAM51099.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
          Length = 226

 Score = 37.7 bits (86), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49
           + A DFG+PQ+RER++II   +P + F F  P   +  L +I+E+ + +
Sbjct: 167 LNALDFGLPQKRERIFIIGLRDP-LNFTFKKPNISRKPLSEIIEKSVSE 214


>gi|171920707|ref|ZP_02931926.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 13
           str. ATCC 33698]
 gi|185179015|ref|ZP_02964765.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 5
           str. ATCC 27817]
 gi|188024024|ref|ZP_02996783.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 7
           str. ATCC 27819]
 gi|188518336|ref|ZP_03003849.1| cytosine-specific methyltransferase NlaX [Ureaplasma urealyticum
           serovar 11 str. ATCC 33695]
 gi|188524309|ref|ZP_03004347.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           12 str. ATCC 33696]
 gi|198273488|ref|ZP_03206024.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           4 str. ATCC 27816]
 gi|225550923|ref|ZP_03771872.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           2 str. ATCC 27814]
 gi|225551062|ref|ZP_03772008.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           8 str. ATCC 27618]
 gi|171903447|gb|EDT49736.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 13
           str. ATCC 33698]
 gi|184209104|gb|EDU06147.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 5
           str. ATCC 27817]
 gi|188019052|gb|EDU57092.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 7
           str. ATCC 27819]
 gi|188997975|gb|EDU67072.1| cytosine-specific methyltransferase NlaX [Ureaplasma urealyticum
           serovar 11 str. ATCC 33695]
 gi|195660089|gb|EDX53469.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           12 str. ATCC 33696]
 gi|198250008|gb|EDY74788.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           4 str. ATCC 27816]
 gi|225378877|gb|EEH01242.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           8 str. ATCC 27618]
 gi|225380077|gb|EEH02439.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           2 str. ATCC 27814]
          Length = 319

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           +   D+G VPQ RER+YI+ FL+      FK+P P+ +   + D+++
Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEAFKYPCPITLTNTIRDVID 192


>gi|328946253|gb|EGG40397.1| modification methylase Sau96I [Streptococcus sanguinis SK1087]
          Length = 333

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RER+ ++     L   + F++P P   KP L DIL
Sbjct: 151 LNAWDYGVAQKRERMIMVGIRNDLTDKITFEYPEPHDYKPVLKDIL 196


>gi|254303554|ref|ZP_04970912.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148323746|gb|EDK88996.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 492

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + + D+G+PQ RER++++ F   L    +F+FP P  ++  + D L +++  K  +  K
Sbjct: 265 LNSKDYGIPQNRERVFVVGFRKDLKLKKKFEFPRPFLLEKTMQDFLLDNVAGKYYLQEK 323


>gi|260866454|ref|YP_003232856.1| putative DNA modification methylase [Escherichia coli O111:H- str.
           11128]
 gi|257762810|dbj|BAI34305.1| predicted DNA modification methylase [Escherichia coli O111:H- str.
           11128]
          Length = 356

 Score = 37.4 bits (85), Expect = 0.63,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 8/71 (11%)

Query: 3   ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           A D+GVPQ R R+ ++      S  F++P+   I P +GD L +       +S   WEG 
Sbjct: 155 ASDYGVPQLRPRVLLVALRGKYSAHFRWPSETLIPPTVGDALFD------LMSQGGWEGA 208

Query: 62  QK-RKENNKIA 71
           +  RK  N IA
Sbjct: 209 EAWRKAANNIA 219


>gi|6272296|gb|AAF06073.1|AF072715_4 putative methylase [Mycoplasma mycoides subsp. capri]
          Length = 390

 Score = 37.4 bits (85), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK 50
           + + D+G  Q RER++ I +L+    F FP PL  K  +  I++   D K
Sbjct: 229 VNSTDYGSCQNRERVFCISYLDKQKNFTFPKPLITKKEIDSIIKNDDDMK 278


>gi|210610944|ref|ZP_03288669.1| hypothetical protein CLONEX_00859 [Clostridium nexile DSM 1787]
 gi|210152244|gb|EEA83251.1| hypothetical protein CLONEX_00859 [Clostridium nexile DSM 1787]
          Length = 278

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ+RERL  I    D +N  ++F FP     KP L D+L
Sbjct: 95  LNAWDYGVPQKRERLITIGIRNDLVN-RIKFHFPEAHDYKPVLRDVL 140


>gi|77409601|ref|ZP_00786278.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae COH1]
 gi|77171795|gb|EAO74987.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae COH1]
          Length = 333

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RER+ ++   N  V    F++P P   KP L DIL
Sbjct: 151 LNAWDYGVAQKRERMIMVGIRNDLVNMTSFEYPKPHDYKPVLRDIL 196


>gi|270686639|ref|ZP_06222860.1| modification methylase DsaV [Haemophilus influenzae HK1212]
 gi|270316163|gb|EFA28145.1| modification methylase DsaV [Haemophilus influenzae HK1212]
          Length = 225

 Score = 37.4 bits (85), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHID 48
          +KA D+G+PQ R R ++I F +  V   F FP P+ +K  + D+ +   D
Sbjct: 18 LKASDYGLPQLRPRAFMIGFRDDHVLGNFSFPEPIPLKFTMSDVWKGKCD 67


>gi|289167263|ref|YP_003445530.1| type II DNA modification enzyme (methyltransferase
           cytosine-specific) [Streptococcus mitis B6]
 gi|288906828|emb|CBJ21662.1| type II DNA modification enzyme (methyltransferase
           cytosine-specific) [Streptococcus mitis B6]
          Length = 387

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 17/81 (20%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFP------TPLGIKPRLGDI--------L 43
           + A D+GVPQ RER+++I     LN   E+ FP       P  ++  +GD+         
Sbjct: 169 LNAKDYGVPQNRERVFLIGVRNDLNIEFEWSFPEKCTSENPFNLRDAIGDLPSLGNNDRA 228

Query: 44  EEHIDDKSTISNKLWEGHQKR 64
           +++++D  T    L  G+Q +
Sbjct: 229 DQYVEDPQTDYQILMRGNQDQ 249


>gi|119484300|ref|ZP_01618917.1| modification methylase NlaIV [Lyngbya sp. PCC 8106]
 gi|119457774|gb|EAW38897.1| modification methylase NlaIV [Lyngbya sp. PCC 8106]
          Length = 449

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 21/93 (22%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-------------------PRLGD 41
           + + +FG+PQ R R+Y+I  LN S +F   + LG K                   P++ D
Sbjct: 146 LNSVNFGLPQNRVRVYMIGVLNASPQFNLISDLGPKDSHSYNAVQLNLFSLQHFPPKVKD 205

Query: 42  ILEEHIDDKSTISNKLWEGHQKRKEN--NKIAG 72
           ILEE+ D     S +  +   K  +   NK+ G
Sbjct: 206 ILEENPDSSFDCSPEFSQALNKVVQGDLNKLHG 238


>gi|290343528|ref|YP_003494895.1| hypothetical protein OTV1_055 [Ostreococcus tauri virus 1]
 gi|260160943|emb|CAY39643.1| hypothetical protein OTV1_055 [Ostreococcus tauri virus 1]
          Length = 351

 Score = 37.4 bits (85), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE 44
           +KA + GVPQ+RERL+I+   +    F FP P      L DIL+
Sbjct: 154 LKAHEHGVPQKRERLFIVGSRDVDFTFDFPEPSANDVGLKDILK 197


>gi|154173655|ref|YP_001409100.1| cytosine-specific methyltransferase NlaX [Campylobacter curvus
           525.92]
 gi|112802981|gb|EAU00325.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Campylobacter
           curvus 525.92]
          Length = 352

 Score = 37.0 bits (84), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 12/80 (15%)

Query: 5   DFGVPQRRERLYIIDFL--NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-------- 54
           D+G+ Q RER+YI+ FL  +  + F F   + +   + D L++ +D+K  ++        
Sbjct: 156 DYGIAQNRERIYIVGFLDFDEYLNFDFAPRVPLTTAIRDYLDDEVDEKYYLNENAILSMV 215

Query: 55  --NKLWEGHQKRKENNKIAG 72
             N  + G    KE ++ AG
Sbjct: 216 DPNACFNGKFDPKETDECAG 235


>gi|239812977|ref|YP_002941924.1| DNA-cytosine methyltransferase [Geobacillus sp. WCH70]
 gi|239809042|gb|ACS26105.1| DNA-cytosine methyltransferase [Geobacillus sp. WCH70]
          Length = 370

 Score = 37.0 bits (84), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 25/33 (75%), Gaps = 1/33 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32
           + A D+GVPQ+RER++II   N  +++++FP P
Sbjct: 172 INAADYGVPQKRERVFIIGVRNDLNIQYEFPEP 204


>gi|309380076|emb|CBX21487.1| putative DNA cytosine methyltransferase [Neisseria lactamica
           Y92-1009]
          Length = 377

 Score = 37.0 bits (84), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER+ I+    +  +++KFP     + RL        + +  ++ + WE
Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKETHSEDRL--------NWEKYVTGEYWE 221

Query: 60  GHQKRKENNKIAGKGFG--YGLF 80
            H + K  NK   +     YG+F
Sbjct: 222 KHNEPKRFNKDIAEKLQKKYGIF 244


>gi|238025826|ref|YP_002910057.1| DNA cytosine methyltransferase M.NgoMIII [Burkholderia glumae BGR1]
 gi|237875020|gb|ACR27353.1| DNA cytosine methyltransferase M.NgoMIII [Burkholderia glumae BGR1]
          Length = 407

 Score = 37.0 bits (84), Expect = 0.85,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32
           + A D+GVPQ+RER++I+ F +   V++ FP P
Sbjct: 182 VNAADYGVPQKRERVFIVGFRSDLDVDWSFPRP 214


>gi|166163613|gb|ABY83631.1| DNA methyltransferase Cfr42I [Citrobacter freundii]
          Length = 402

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32
           + A D+G+PQ+RER++I+ F +   +E+ FP P
Sbjct: 181 VNAADYGIPQKRERVFIVGFRDDLEIEWSFPKP 213


>gi|168335325|ref|ZP_02693422.1| DNA-cytosine methyltransferase [Epulopiscium sp. 'N.t. morphotype
           B']
          Length = 324

 Score = 37.0 bits (84), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDD 49
           + A D+GV Q R+R++ I F  + +++F+FP P   KP L DIL +  D+
Sbjct: 143 LNANDYGVAQDRKRVFYIGFRKDLNIKFEFPKPQEYKPVLRDILWDLKDN 192


>gi|209554428|ref|YP_002284952.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 10
           str. ATCC 33699]
 gi|209541929|gb|ACI60158.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 10
           str. ATCC 33699]
          Length = 319

 Score = 37.0 bits (84), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           +   D+G VPQ RER+YI+ FL+      FK+P P+ +   + D+++
Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEVFKYPCPITLTNTIRDVID 192


>gi|313668596|ref|YP_004048880.1| DNA cytosine methyltransferase [Neisseria lactamica ST-640]
 gi|313006058|emb|CBN87519.1| DNA cytosine methyltransferase [Neisseria lactamica 020-06]
          Length = 393

 Score = 37.0 bits (84), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER+ I+    +  +++KFP     + RL        + +  ++ + WE
Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKETHSEDRL--------NWEKYVTGEYWE 221

Query: 60  GHQKRKENNKIAGKGFG--YGLF 80
            H + K  NK   +     YG+F
Sbjct: 222 KHNEPKRFNKDIAEKLQKKYGIF 244


>gi|328947436|ref|YP_004364773.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
 gi|328447760|gb|AEB13476.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
          Length = 439

 Score = 37.0 bits (84), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + + DF +PQ+RER Y + FL+ + +F FP    I   L DI++    D+S
Sbjct: 240 LSSLDFELPQKRERWYCVGFLSKT-DFVFPAGTKIHKNLRDIIDLDNQDES 289


>gi|309789600|ref|ZP_07684181.1| BsaWI methylase [Oscillochloris trichoides DG6]
 gi|308228336|gb|EFO81983.1| BsaWI methylase [Oscillochloris trichoides DG6]
          Length = 436

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32
           + A ++GVPQ RERL+II   + S+   FPTP
Sbjct: 173 LNAANYGVPQFRERLFIIATSDSSLPIIFPTP 204


>gi|325270473|ref|ZP_08137075.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
 gi|324987196|gb|EGC19177.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
          Length = 365

 Score = 36.6 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR---LGDILEEH--IDDKSTIS 54
           +KA ++G+PQRRER+ I+   +  +  +++P P+  +     L  +++E    D K   S
Sbjct: 158 LKAVEYGIPQRRERVIIVGIRDDLTFNYEYPAPVCTEAEATPLSAVIDELAITDSKYYFS 217

Query: 55  NKLWEGHQKRKENNK 69
            +  +G +K K N K
Sbjct: 218 ERAVQGVKKAKNNMK 232


>gi|161870123|ref|YP_001599293.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
 gi|225075874|ref|ZP_03719073.1| hypothetical protein NEIFLAOT_00897 [Neisseria flavescens
           NRL30031/H210]
 gi|296313674|ref|ZP_06863615.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC
           43768]
 gi|161595676|gb|ABX73336.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
 gi|224952820|gb|EEG34029.1| hypothetical protein NEIFLAOT_00897 [Neisseria flavescens
           NRL30031/H210]
 gi|296839734|gb|EFH23672.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC
           43768]
          Length = 423

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T L   P+L +ILE  +  +S+
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLPTESS 207


>gi|15676920|ref|NP_274067.1| modification methylase NlaIV [Neisseria meningitidis MC58]
 gi|7226272|gb|AAF41432.1| modification methylase NlaIV [Neisseria meningitidis MC58]
 gi|325136241|gb|EGC58849.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579]
 gi|325202033|gb|ADY97487.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149]
 gi|325208214|gb|ADZ03666.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis
           NZ-05/33]
          Length = 423

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T L   P+L +ILE  +  +S+
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLPTESS 207


>gi|325130383|gb|EGC53149.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304]
          Length = 425

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T L   P+L +ILE  +  +S+
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLPTESS 207


>gi|197302809|ref|ZP_03167861.1| hypothetical protein RUMLAC_01538 [Ruminococcus lactaris ATCC
           29176]
 gi|197298046|gb|EDY32594.1| hypothetical protein RUMLAC_01538 [Ruminococcus lactaris ATCC
           29176]
          Length = 333

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+G+PQ+RER+Y++ F N      F +P P  +   + + L   +DD+  + +   
Sbjct: 152 LNAVDYGIPQKRERIYMVCFRNDLGITGFSYPKPFKLTRHVENFL---LDDEEMVKDLYV 208

Query: 59  E 59
           E
Sbjct: 209 E 209


>gi|313667088|gb|ADR72987.1| M2.BsmFI [Geobacillus stearothermophilus]
          Length = 365

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 15/82 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-------------LGIKPRLGDILEEHI 47
           + A D+GVPQRR+R++I+      V+F FP P             + ++  LGD+   + 
Sbjct: 146 LNAADYGVPQRRKRIFIVG-TREGVKFNFPLPTHNEKGDDGKLKWISVEEALGDLPSPNT 204

Query: 48  DDKSTISNKLWEGHQ-KRKENN 68
           D     S +    +Q K +ENN
Sbjct: 205 DGIVKYSKEPLTPYQLKMRENN 226


>gi|59801568|ref|YP_208280.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae FA
           1090]
 gi|194097887|ref|YP_002000932.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998362|ref|ZP_04718286.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           35/02]
 gi|240113683|ref|ZP_04728173.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           MS11]
 gi|240116425|ref|ZP_04730487.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           PID18]
 gi|240117164|ref|ZP_04731226.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           PID1]
 gi|240125114|ref|ZP_04738000.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           SK-92-679]
 gi|254494438|ref|ZP_05107609.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae 1291]
 gi|260441646|ref|ZP_05795462.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           DGI2]
 gi|268594223|ref|ZP_06128390.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           35/02]
 gi|268599750|ref|ZP_06133917.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae MS11]
 gi|268602094|ref|ZP_06136261.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID18]
 gi|268602852|ref|ZP_06137019.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID1]
 gi|268683710|ref|ZP_06150572.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae
           SK-92-679]
 gi|291045024|ref|ZP_06570732.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           DGI2]
 gi|10444408|gb|AAG17898.1|AF297971_2 DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae]
 gi|59718463|gb|AAW89868.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae FA
           1090]
 gi|193933177|gb|ACF29001.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           NCCP11945]
 gi|226513478|gb|EEH62823.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae 1291]
 gi|268547612|gb|EEZ43030.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           35/02]
 gi|268583881|gb|EEZ48557.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae MS11]
 gi|268586225|gb|EEZ50901.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID18]
 gi|268586983|gb|EEZ51659.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID1]
 gi|268623994|gb|EEZ56394.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae
           SK-92-679]
 gi|291011027|gb|EFE03024.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           DGI2]
 gi|317163651|gb|ADV07192.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 377

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER+ I+    +  +++KFP     + RL        + +  ++ + WE
Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKRTHSEDRL--------NWEKYVTGEYWE 221

Query: 60  GHQKRKENNKIAGKGFG--YGLF 80
            H + K  NK   +     YG+F
Sbjct: 222 KHNEPKRFNKDIAEKLQKKYGIF 244


>gi|326571776|gb|EGE21785.1| DNA-cytosine methyltransferase [Moraxella catarrhalis BC7]
          Length = 458

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + + D+GVPQ RER Y +     S    F+FP       +L DI+E   +DKS I +K 
Sbjct: 261 LNSYDYGVPQFRERWYCVAIRKDSDNGRFEFPKNRDRTTKLRDIIESDNNDKSLILSKF 319


>gi|172038109|ref|YP_001804610.1| putative modification methylase [Cyanothece sp. ATCC 51142]
 gi|171699563|gb|ACB52544.1| putative modification methylase [Cyanothece sp. ATCC 51142]
          Length = 344

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FG+PQ+RER++I+ F +P + F +  P  +   L +I+E+ + +    S ++   
Sbjct: 167 LNALNFGLPQKRERVFIVGFRDP-LAFIWKQPNILMKPLSEIIEKSVSEFYYASEQIQRN 225

Query: 61  HQKRKENN 68
              + + N
Sbjct: 226 RLAKYQGN 233


>gi|5420107|emb|CAB46561.1| cytosine-specific methyltransferase [Streptococcus thermophilus]
          Length = 316

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           M A D+G +PQ RER+YI+ F +     +F  P  + ++  + D+    ID  S + +K 
Sbjct: 145 MNAADYGNIPQNRERIYIVAFRDKEDYADFDLPKSIPLETSIKDV----IDFDSKVDDKF 200

Query: 58  WEGHQKRK 65
           +   +K K
Sbjct: 201 YYTAEKNK 208


>gi|296114087|ref|YP_003628025.1| cytosine-specific methyltransferase [Moraxella catarrhalis RH4]
 gi|295921781|gb|ADG62132.1| cytosine-specific methyltransferase [Moraxella catarrhalis RH4]
 gi|326560672|gb|EGE11040.1| cytosine-specific methyltransferase [Moraxella catarrhalis 46P47B1]
          Length = 318

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 8   VPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKR 64
           +PQ RER++II F   +  S+ F+FP  + +   + DIL+    D+S   +K  + HQK 
Sbjct: 155 IPQNRERIFIIAFDKNIFKSINFEFPNKIPLTKTIHDILDNKKQDESFYYHK-SKYHQKL 213

Query: 65  K 65
           K
Sbjct: 214 K 214


>gi|53804329|ref|YP_114062.1| C-5 cytosine-specific DNA methylase family protein [Methylococcus
           capsulatus str. Bath]
 gi|53758090|gb|AAU92381.1| C-5 cytosine-specific DNA methylase family protein [Methylococcus
           capsulatus str. Bath]
          Length = 345

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 8/82 (9%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-----NKL 57
           A D+GVPQ RER+ I+  L     F+ P P+ I P      ++ IDD + +      N +
Sbjct: 196 AADYGVPQTRERVLIVGTLPGVKPFEPPKPI-ISPSRYITAKQAIDDLAALDEDEEINHV 254

Query: 58  WE--GHQKRKENNKIAGKGFGY 77
           W   G    + N ++     GY
Sbjct: 255 WSRAGKSPEQGNRRLIADRPGY 276


>gi|327399867|ref|YP_004346898.1| cytosine-specific methyltransferase [Lactobacillus amylovorus GRL
           1112]
 gi|327182537|gb|AEA32972.1| cytosine-specific methyltransferase [Lactobacillus amylovorus GRL
           1112]
          Length = 401

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 5   DFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46
           D+G +PQ RER+Y++ F N      F FP P+ +   L DI++ H
Sbjct: 157 DYGNIPQNRERIYVVGFDNKEDYDRFDFPAPIKLTKTLHDIIDFH 201


>gi|257062089|ref|YP_003139977.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|256592255|gb|ACV03142.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 456

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILE 44
           + + DFG+ Q R+R++I+     +  + +F FP PL + P+L + +E
Sbjct: 173 LNSYDFGLSQDRDRVFIVGIHQQIENAAQFSFPEPLNLSPKLYEFIE 219


>gi|218249004|ref|YP_002374375.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|218169482|gb|ACK68219.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
          Length = 456

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILE 44
           + + DFG+ Q R+R++I+     +  + +F FP PL + P+L + +E
Sbjct: 173 LNSYDFGLSQDRDRVFIVGIHQQIENAAQFSFPEPLNLSPKLYEFIE 219


>gi|257870038|ref|ZP_05649691.1| DNA methylase [Enterococcus gallinarum EG2]
 gi|257804202|gb|EEV33024.1| DNA methylase [Enterococcus gallinarum EG2]
          Length = 401

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           +   D+G VPQ RER+Y++ F N      F FP+ + +  +L D+++
Sbjct: 156 LNGKDYGNVPQNRERIYVVGFRNQQAFDNFHFPSKVELTTKLSDVID 202


>gi|269122857|ref|YP_003305434.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM
           12112]
 gi|268314183|gb|ACZ00557.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM
           12112]
          Length = 329

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 4/46 (8%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43
           + + DFG+PQ+RER+Y++ F   LN    F FP P  +   + D+L
Sbjct: 152 LNSLDFGIPQKRERIYMVCFRKDLNIK-NFIFPKPFKLSTFVEDLL 196


>gi|254825117|ref|ZP_05230118.1| DNA-cytosine methyltransferase [Listeria monocytogenes FSL J1-194]
 gi|293594360|gb|EFG02121.1| DNA-cytosine methyltransferase [Listeria monocytogenes FSL J1-194]
          Length = 326

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53
           +   DFG+PQ+RER+Y +  L+ P  +F       ++P + + LE  +DD  TI
Sbjct: 149 LNPMDFGIPQKRERIYTVSVLSGPQFDFSKLKKEPMRP-INEFLETDVDDIYTI 201


>gi|9622224|gb|AAF89681.1| cytosine-specific methyltransferase [Bacillus sp. LU11]
          Length = 365

 Score = 36.2 bits (82), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 15/82 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-------------LGIKPRLGDILEEHI 47
           + A D+GVPQRR+R++I+      ++F FP P             + ++  LGD+   + 
Sbjct: 146 LNAADYGVPQRRKRIFIVG-TREGIKFNFPLPTHNEKGNDGKLKWISVEEALGDLPSPNT 204

Query: 48  DDKSTISNKLWEGHQ-KRKENN 68
           D     S +    +Q K +ENN
Sbjct: 205 DGIVKYSTEPLNPYQLKMRENN 226


>gi|85703012|ref|ZP_01034116.1| DNA cytosine methyltransferase M.NgoMIII [Roseovarius sp. 217]
 gi|85671940|gb|EAQ26797.1| DNA cytosine methyltransferase M.NgoMIII [Roseovarius sp. 217]
          Length = 387

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTP 32
           + + ++GVPQRRER++++ F  +  +E+ FP P
Sbjct: 180 LNSANYGVPQRRERVFLVGFRADTGIEWHFPKP 212


>gi|229824483|ref|ZP_04450552.1| hypothetical protein GCWU000282_01806 [Catonella morbi ATCC 51271]
 gi|229786084|gb|EEP22198.1| hypothetical protein GCWU000282_01806 [Catonella morbi ATCC 51271]
          Length = 406

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 8   VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKS 51
           +PQ RER+YI+ F +      F+FP  + +  +L D+++ HI + +
Sbjct: 164 IPQNRERIYIVGFRDKQAFDAFQFPESVDLTTKLDDVIDFHIAENA 209


>gi|254411906|ref|ZP_05025682.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196181628|gb|EDX76616.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 456

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDIL 43
           + + DFG+PQ R+R++I+   N    S  F FP PLG   +L D++
Sbjct: 173 LNSYDFGLPQDRDRVFIVGIRNDIEKSKSFDFPKPLGKPIKLYDVI 218


>gi|223937258|ref|ZP_03629164.1| DNA-cytosine methyltransferase [bacterium Ellin514]
 gi|223894043|gb|EEF60498.1| DNA-cytosine methyltransferase [bacterium Ellin514]
          Length = 408

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 8/54 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-------LGIKPRLGDILEEH 46
           + A D+GVPQ RER++I+ F +   +E+ FP P       +  K   GD  E+H
Sbjct: 186 LNAADYGVPQFRERVFIVGFRHDLGIEWSFPKPTHSYDALVKAKWVTGDYWEQH 239


>gi|315604954|ref|ZP_07880010.1| modification methylase [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315313349|gb|EFU61410.1| modification methylase [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 322

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 2/74 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPL-GIKPRLGDILEEHIDDKSTISNKLW 58
           + A DFGVPQ R R+  + F + +   F++P+P     P +G+ L + + ++       W
Sbjct: 147 LNASDFGVPQLRPRVIAVGFRHDTAPSFEYPSPFQNAAPTVGETLADLMAERGWEGASAW 206

Query: 59  EGHQKRKENNKIAG 72
                R     + G
Sbjct: 207 AAQANRIAPTLVGG 220


>gi|308185228|ref|YP_003929361.1| DNA-cytosine methyltransferase [Helicobacter pylori SJM180]
 gi|308061148|gb|ADO03044.1| DNA-cytosine methyltransferase [Helicobacter pylori SJM180]
          Length = 368

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A ++G+PQ R RL+++ F        F FP+P  +   + D+L+++I + + +S
Sbjct: 187 LDARNYGIPQGRRRLFLVGFKEQEKCANFTFPSPKELTITMQDLLQDNIKEGNLLS 242


>gi|302873652|ref|YP_003842285.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
 gi|307686624|ref|ZP_07629070.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
 gi|302576509|gb|ADL50521.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
          Length = 445

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 12/80 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-------LGIKPRLGDILEEHIDDKSTI 53
           M A ++GVPQRR R+  I + +  V  ++P P       L I+  + D++ E       +
Sbjct: 182 MDAANYGVPQRRNRVIFIAYRDDVVAPQYPEPTVTEETKLTIEDAITDLIRER-----RV 236

Query: 54  SNKLWEGHQKRKENNKIAGK 73
            N+++ G   + + + I G+
Sbjct: 237 RNRIFNGRLSQFQQDSINGR 256


>gi|10954474|ref|NP_039765.1| DNA cytosine-5 methylase subunit A [Methanothermobacter
           thermautotrophicus]
 gi|266583|sp|P29567|MTHT_METTF RecName: Full=Modification methylase MthTI; Short=M.MthTI; AltName:
           Full=Cytosine-specific methyltransferase MthTI
 gi|44641|emb|CAA48436.1| TIM [Methanothermobacter thermautotrophicus]
 gi|149743|gb|AAA73370.1| TIM [Methanothermobacter thermautotrophicus]
          Length = 330

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 6/93 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ R+R++I+ +  + +++F+FP PL  K  L D + +  + K  +     E
Sbjct: 144 LNAKDYGVPQDRKRVFIVGYREDLNLKFEFPKPLNKKVTLRDAIGDLPEPKPAL-----E 198

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            ++   EN ++    +  G F     + N + +
Sbjct: 199 KNRSNGENLEVPNHEYMTGTFSSRYMSRNRVRS 231


>gi|323487872|ref|ZP_08093130.1| cytosine-specific methyltransferase [Planococcus donghaensis
           MPA1U2]
 gi|323398606|gb|EGA91394.1| cytosine-specific methyltransferase [Planococcus donghaensis
           MPA1U2]
          Length = 367

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 20/26 (76%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE 26
           + + DFGVPQ+RER++ I FLN  ++
Sbjct: 149 LNSADFGVPQKRERVFFIGFLNKDID 174


>gi|57506196|ref|ZP_00372116.1| C-5 cytosine-specific DNA methylase [Campylobacter upsaliensis
           RM3195]
 gi|57015523|gb|EAL52317.1| C-5 cytosine-specific DNA methylase [Campylobacter upsaliensis
           RM3195]
          Length = 315

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 8   VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHID 48
           +PQ RER+YII FL+      F FP  + +  ++  +LE+ +D
Sbjct: 150 IPQNRERIYIIGFLDFHTYESFHFPAKIKLTQKIQHLLEKGVD 192


>gi|313677762|ref|YP_004055758.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
 gi|312944460|gb|ADR23650.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
          Length = 378

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 3   ACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGI---KPRLGDILEEHI--DDKSTISN 55
           A ++GVPQ+RER++II F N      F FP P  +   K +L +++++    D+K   S 
Sbjct: 167 ASEYGVPQKRERVFIIGFKNYEDFAYFNFPQPTTLNDSKVKLKEVIDKKANKDEKWFFSQ 226

Query: 56  KLWEGHQK-RKENNK 69
           +  +G  + +K+ NK
Sbjct: 227 RAVDGMMRVQKKMNK 241


>gi|303231468|ref|ZP_07318199.1| modification methylase HhaI family protein [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513905|gb|EFL55916.1| modification methylase HhaI family protein [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 411

 Score = 35.8 bits (81), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           +   D+G +PQ RER+YI+ FL  S    F FP  + +   L DI++
Sbjct: 154 LNGKDYGNIPQNRERIYIVGFLEKSAYDAFIFPDEIPLTTSLSDIID 200


>gi|157265308|ref|YP_001467867.1| C5 cytosine-specific DNA methylase [Thermus phage P23-45]
 gi|157265426|ref|YP_001467984.1| C5 cytosine-specific DNA methylase [Thermus phage P74-26]
 gi|156905203|gb|ABU96847.1| C5 cytosine-specific DNA methylase [Thermus phage P23-45]
 gi|156905321|gb|ABU96964.1| C5 cytosine-specific DNA methylase [Thermus phage P74-26]
          Length = 368

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLG 40
           + A D+GVPQ+RER++I+   +  P  +F FP P    P++ 
Sbjct: 162 LNAADYGVPQKRERVFIVGVRSDLPG-DFAFPLPTHANPQVA 202


>gi|296393765|ref|YP_003658649.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985]
 gi|296180912|gb|ADG97818.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985]
          Length = 393

 Score = 35.8 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 3   ACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRL----GDILEEH 46
           A D+GVPQRR R++I+ F   +     F  PT  G   RL    GD  E H
Sbjct: 183 AADYGVPQRRHRVFIVGFRSDVRAGWAFPSPTHSGEALRLAQVRGDYFERH 233


>gi|325912423|ref|ZP_08174818.1| modification methylase HhaI [Lactobacillus iners UPII 143-D]
 gi|325475765|gb|EGC78936.1| modification methylase HhaI [Lactobacillus iners UPII 143-D]
          Length = 314

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   D+GVPQ+RER+Y++ F   +N  V F FP P  +   + D L    +  S I ++
Sbjct: 131 LNPVDYGVPQKRERIYMLCFRNDINREV-FTFPRPFKLNKFVEDFLISDYEVNSLIVDR 188


>gi|251811836|ref|ZP_04826309.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875124|ref|ZP_06283997.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis
           SK135]
 gi|251804633|gb|EES57290.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281295889|gb|EFA88410.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis
           SK135]
          Length = 329

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNK 56
           ++  D+ +PQ+R+R++I+ + N  +EF +P  L     IK  + D+      +KS I N 
Sbjct: 153 LQTSDYNIPQKRQRVFIVGYKN--IEFNYPEKLKRKVTIKEAISDLPPLKNGEKSKIPNH 210

Query: 57  LWEGHQK 63
               H +
Sbjct: 211 FAMNHSQ 217


>gi|256822924|ref|YP_003146887.1| DNA-cytosine methyltransferase [Kangiella koreensis DSM 16069]
 gi|256796463|gb|ACV27119.1| DNA-cytosine methyltransferase [Kangiella koreensis DSM 16069]
          Length = 419

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 12/61 (19%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP-----------SVEFKFPTPLGIKPRLGDILEEHID 48
           + + DFG VPQ RER+YII F +            + EF +P P+ +   + D+L++ + 
Sbjct: 239 LNSMDFGDVPQNRERIYIIGFKDEANWQNNKGATRTSEFSWPEPIRLSKSVRDLLDKQVS 298

Query: 49  D 49
           +
Sbjct: 299 E 299


>gi|254671396|emb|CBA08870.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
          alpha153]
          Length = 157

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
          + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +  +S+
Sbjct: 42 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 91


>gi|312902257|ref|ZP_07761465.1| helix-turn-helix protein [Enterococcus faecalis TX0635]
 gi|283466064|emb|CBG92839.1| hypothetical protein [Enterococcus casseliflavus]
 gi|310634316|gb|EFQ17599.1| helix-turn-helix protein [Enterococcus faecalis TX0635]
          Length = 470

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEE 45
           + A ++GV Q+RER+ II   N   E     FKFP     +P L D+L++
Sbjct: 286 LNAWNYGVAQKRERIVIIGIRNDLFEQQQYSFKFPKEYTYQPVLRDVLKD 335


>gi|254442311|ref|ZP_05055787.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
 gi|198256619|gb|EDY80927.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
          Length = 338

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 4/34 (11%)

Query: 1   MKACDFGVPQRRERLYII----DFLNPSVEFKFP 30
           + + DFGVPQ RER+Y +    D +N + +F FP
Sbjct: 154 VSSVDFGVPQMRERVYFVGVRKDLVNSNFDFTFP 187


>gi|257867246|ref|ZP_05646899.1| DNA methyltransferase [Enterococcus casseliflavus EC30]
 gi|257873580|ref|ZP_05653233.1| DNA methyltransferase [Enterococcus casseliflavus EC10]
 gi|257801302|gb|EEV30232.1| DNA methyltransferase [Enterococcus casseliflavus EC30]
 gi|257807744|gb|EEV36566.1| DNA methyltransferase [Enterococcus casseliflavus EC10]
          Length = 470

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEE 45
           + A ++GV Q+RER+ II   N   E     FKFP     +P L D+L++
Sbjct: 286 LNAWNYGVAQKRERIVIIGIRNDLFEQQQYSFKFPKEYTYQPVLRDVLKD 335


>gi|119512301|ref|ZP_01631388.1| DNA modification methylase [Nodularia spumigena CCY9414]
 gi|119463081|gb|EAW44031.1| DNA modification methylase [Nodularia spumigena CCY9414]
          Length = 502

 Score = 35.4 bits (80), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 6/56 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDIL----EEHIDDK 50
           + + D+GVPQ R R+YII F       +F  P     K +LGDIL    E+ ID++
Sbjct: 147 INSFDYGVPQNRIRVYIIGFHKQEYLEKFALPKQTDKKRKLGDILGITSEQKIDNQ 202


>gi|316984658|gb|EFV63622.1| modification methylase NlaIV [Neisseria meningitidis H44/76]
          Length = 171

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +  +S+
Sbjct: 56  LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 105


>gi|289167787|ref|YP_003446056.1| site-specific DNA methylase [Streptococcus mitis B6]
 gi|288907354|emb|CBJ22191.1| site-specific DNA methylase [Streptococcus mitis B6]
          Length = 346

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 22/105 (20%)

Query: 3   ACDFGVPQRRERLYIIDFL-NPSVEFKFP----------TPLGIKPRLGDILEEHIDDKS 51
           A  +GVPQ+RER++I+    + +  F+FP          TPL +      IL++ ID+K 
Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNVEDYTPLKV------ILQQDIDEKY 214

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
             S +  +G    K     +GK    G   +    +NT+S+   K
Sbjct: 215 YFSERAVQGMLNSK-----SGKKMNKGRAQDIEQPSNTVSSHLAK 254


>gi|331677320|ref|ZP_08377999.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
 gi|331075055|gb|EGI46371.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
          Length = 415

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
           +   +FGVPQ R R+YII  L   V    P  LG K
Sbjct: 146 LNTSNFGVPQNRVRIYIIASLEKEVTLTIPNDLGAK 181


>gi|197303495|ref|ZP_03168534.1| hypothetical protein RUMLAC_02217 [Ruminococcus lactaris ATCC
           29176]
 gi|197297493|gb|EDY32054.1| hypothetical protein RUMLAC_02217 [Ruminococcus lactaris ATCC
           29176]
          Length = 496

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 9/82 (10%)

Query: 5   DFGVPQRRERLYIIDFL-----NPSVEFKFPTPLG----IKPRLGDILEEHIDDKSTISN 55
           +FG+PQ R R+YI+ F      N         P+     I   + ++L+ ++DDK  ++ 
Sbjct: 168 EFGLPQNRPRVYIMAFSKKIYGNAIKLLNAQLPISRDETIFRDVTEVLDTNVDDKYYMAE 227

Query: 56  KLWEGHQKRKENNKIAGKGFGY 77
              E  ++ K   K  G GFGY
Sbjct: 228 GYLETLKRHKARQKKNGYGFGY 249


>gi|148988377|ref|ZP_01819824.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pneumoniae
           SP6-BS73]
 gi|147926058|gb|EDK77132.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pneumoniae
           SP6-BS73]
          Length = 343

 Score = 35.4 bits (80), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 22/105 (20%)

Query: 3   ACDFGVPQRRERLYIIDFL-NPSVEFKFP----------TPLGIKPRLGDILEEHIDDKS 51
           A  +GVPQ+RER++I+    + +  F+FP          TPL +      IL++ ID+K 
Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNVEDYTPLKV------ILQQDIDEKY 214

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
             S +  +G    K     +GK    G   +    +NT+S+   K
Sbjct: 215 YFSERAVQGMLNSK-----SGKKMNKGRAQDIEQPSNTVSSHLAK 254


>gi|328912201|gb|AEB63797.1| Modification methylase Rho11sI [Bacillus amyloliquefaciens LL3]
          Length = 503

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 37/130 (28%)

Query: 6   FGVPQRRERLYII-------------------DFLNP-----------SVEFKFPTPLGI 35
           F VPQ RER+YII                   D L+            S  FK+     +
Sbjct: 154 FNVPQNRERIYIIGVREDLIENDEWVLEKGRNDVLSKGKKRLKELNIKSFNFKWSAQDIV 213

Query: 36  KPRLGDILEEHIDDKSTIS----NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
             RL +ILEE++D+K  +S    +KL E  +K KE + +   G   G  + N+  T    
Sbjct: 214 GQRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEKDVVFVGGINVGKRWLNNGKT---Y 270

Query: 92  ARYYKDGSEI 101
           +R +K G+ +
Sbjct: 271 SRNFKQGNRV 280


>gi|331270912|ref|YP_004385623.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
 gi|329127304|gb|AEB77248.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
          Length = 349

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 1   MKACDFGVPQRRERLYII---DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FG+PQ RER+++I   ++++   + KF        RL DIL+  +D++  I N
Sbjct: 149 LNAKNFGIPQNRERIFVIGIREYIDNK-QMKFNEGKDYGYRLKDILQNQVDERFYIDN 205


>gi|901818|gb|AAA69959.1| 5C-DNA methyltransferase [Bacillus phage H2]
          Length = 503

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 37/130 (28%)

Query: 6   FGVPQRRERLYII-------------------DFLNP-----------SVEFKFPTPLGI 35
           F VPQ RER+YII                   D L+            S  FK+     +
Sbjct: 154 FNVPQNRERIYIIGVREDLIENDEWIVEKGRYDVLSKGKKRLKELNIKSFNFKWSAQDIV 213

Query: 36  KPRLGDILEEHIDDKSTIS----NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
             RL +ILEE++D+K  +S    +KL E  +K KE + +   G   G  + N+  T    
Sbjct: 214 GKRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEKDVVFVGGINVGKRWLNNGKT---Y 270

Query: 92  ARYYKDGSEI 101
           +R +K G+ +
Sbjct: 271 SRNFKQGNRV 280


>gi|328553026|gb|AEB23518.1| SP-beta prophage DNA (cytosine-5-)-methyltransferase [Bacillus
           amyloliquefaciens TA208]
          Length = 503

 Score = 35.0 bits (79), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 37/130 (28%)

Query: 6   FGVPQRRERLYII-------------------DFLNP-----------SVEFKFPTPLGI 35
           F VPQ RER+YII                   D L+            S  FK+     +
Sbjct: 154 FNVPQNRERIYIIGVREDLIENDEWIVEKGRNDVLSKGKKRLKELNIKSFNFKWSAQDIV 213

Query: 36  KPRLGDILEEHIDDKSTIS----NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
             RL +ILEE++D+K  +S    +KL E  +K KE + +   G   G  + N+  T    
Sbjct: 214 GKRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEKDVVFVGGINVGKRWLNNGKT---Y 270

Query: 92  ARYYKDGSEI 101
           +R +K G+ +
Sbjct: 271 SRNFKQGNRV 280


>gi|91215328|ref|ZP_01252299.1| modification methylase (Eco47II, Sau96I) [Psychroflexus torquis
           ATCC 700755]
 gi|91186280|gb|EAS72652.1| modification methylase (Eco47II, Sau96I) [Psychroflexus torquis
           ATCC 700755]
          Length = 412

 Score = 35.0 bits (79), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKL 57
           +KA ++ VPQ+RERL ++    +  +E+ +P+P      L D L+  E  D K  IS   
Sbjct: 221 LKAINYNVPQKRERLILVGVRKDIDLEYVYPSPYEKVYNLSDALKKGELYDSKVPISKGT 280

Query: 58  WEGHQKRKENNKIAGKGF 75
                K+K  + I  KG+
Sbjct: 281 QYPENKKKVLDLIPPKGY 298


>gi|309789605|ref|ZP_07684186.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6]
 gi|308228341|gb|EFO81988.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6]
          Length = 342

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI 47
           + A  +GVPQ RERL ++        F FP PL  K  +G+ L E +
Sbjct: 157 LNAVHYGVPQNRERLIVVGHKG---GFSFPKPLSTKVTVGEALGEMV 200


>gi|227874220|ref|ZP_03992420.1| DNA (cytosine-5-)-methyltransferase [Oribacterium sinus F0268]
 gi|227839928|gb|EEJ50358.1| DNA (cytosine-5-)-methyltransferase [Oribacterium sinus F0268]
          Length = 336

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RERL  I     L   ++++FP     KP L DIL
Sbjct: 152 LNAWDYGVAQKRERLITIGIRKDLEDKIKYEFPKVYEYKPLLKDIL 197


>gi|1171044|sp|P43420|MTB6_BACSF RecName: Full=Modification methylase Bsp6I; Short=M.Bsp6I; AltName:
           Full=Cytosine-specific methyltransferase Bsp6I
 gi|547481|emb|CAA57293.1| site-specific DNA-methyltransferase (cytosine-specific) [Bacillus
           sp.]
 gi|1098125|prf||2115268B methyltransferase Bsp6IM
          Length = 315

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDI--LEEHIDDK 50
           + A DFG +PQ RER+YI+ F N      F FP P  +   + D+  L + +DD+
Sbjct: 145 LNAKDFGNIPQNRERIYIVGFRNIEHYKNFNFPMPQPLTLTIKDMINLSDKLDDR 199


>gi|303236368|ref|ZP_07322958.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN]
 gi|302483426|gb|EFL46431.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN]
          Length = 357

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33
           A D+GVPQ R+RL  +   N   +F+FP PL
Sbjct: 157 AADYGVPQIRKRLVFVGLKNNKEKFEFPEPL 187


>gi|332970702|gb|EGK09683.1| DNA (cytosine-5-)-methyltransferase [Kingella kingae ATCC 23330]
          Length = 197

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32
           + A +FGVPQ+RER++I+ F +    FKF  P
Sbjct: 144 LNASEFGVPQKRERVFIVGFRDDEDFFKFQFP 175


>gi|313677760|ref|YP_004055756.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
 gi|312944458|gb|ADR23648.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
          Length = 346

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49
           + A DF VPQ R R + +   N S+EF+FP P+    ++    EE I D
Sbjct: 152 LLASDFAVPQNRRRAFFVGLKN-SLEFEFPKPITTDNKITS--EEAISD 197


>gi|163938820|ref|YP_001643704.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4]
 gi|163861017|gb|ABY42076.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4]
          Length = 350

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL 43
           + + ++G VPQ RER+YI+ FL    + +F FP P+ +   L  ++
Sbjct: 153 LNSMEYGNVPQNRERIYIVGFLENELTAKFDFPAPIPLTNTLNTVI 198


>gi|311064356|ref|YP_003971081.1| cytosine methyl transferase Dcm [Bifidobacterium bifidum PRL2010]
 gi|310866675|gb|ADP36044.1| Dcm Cytosine methyl transferase [Bifidobacterium bifidum PRL2010]
          Length = 326

 Score = 35.0 bits (79), Expect = 3.6,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36
           + A D+GVPQ R+R+ I+   N   VEF +P P   K
Sbjct: 154 LNAADYGVPQTRQRVIIVGVRNDLDVEFTYPQPTNSK 190


>gi|225571452|ref|ZP_03780448.1| hypothetical protein CLOHYLEM_07550 [Clostridium hylemonae DSM
           15053]
 gi|225159928|gb|EEG72547.1| hypothetical protein CLOHYLEM_07550 [Clostridium hylemonae DSM
           15053]
          Length = 377

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFG+PQ+RER+ II    P +   +   +  K  L DILE+ ID K   S ++
Sbjct: 222 LNALDFGLPQKRERIIIIGSKKPFL-MDWTFNVEKKKTLDDILEKDIDKKHYASPEI 277


>gi|328766176|gb|EGF76234.1| hypothetical protein BATDEDRAFT_28720 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 373

 Score = 34.7 bits (78), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32
           + A D+GVPQ+RER++II   N    E+ FP P
Sbjct: 181 VNARDYGVPQQRERVFIIGIRNDIEFEYDFPAP 213


>gi|18700048|gb|AAL03949.1| DNA methyltransferase Bse634IM [Geobacillus stearothermophilus]
          Length = 387

 Score = 34.7 bits (78), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 9/42 (21%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---------FKFPTPL 33
           + A +FG+PQ R R++II F N  +E         F++PTP+
Sbjct: 172 LNALEFGIPQDRARVFIIGFKNSIIETLQENYMDAFQWPTPI 213


>gi|169823657|ref|YP_001691160.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328]
 gi|167832277|dbj|BAG09192.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328]
          Length = 332

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           + A +FG +PQ RER+YI+ F + +    F+FP P+ +   + D ++
Sbjct: 147 LNATEFGNIPQNRERIYIVAFRDKNCLDNFEFPKPIELTTTIRDFID 193


>gi|317483873|ref|ZP_07942812.1| C-5 cytosine-specific DNA methylase [Bilophila wadsworthia 3_1_6]
 gi|316924890|gb|EFV46037.1| C-5 cytosine-specific DNA methylase [Bilophila wadsworthia 3_1_6]
          Length = 401

 Score = 34.7 bits (78), Expect = 4.1,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFP 30
           + A D+G+PQRRER++I+ F +   V + FP
Sbjct: 178 VNAADYGIPQRRERVFIVGFRHDLGVRWSFP 208


>gi|291618717|ref|YP_003521459.1| HsdRM [Pantoea ananatis LMG 20103]
 gi|291153747|gb|ADD78331.1| HsdRM [Pantoea ananatis LMG 20103]
          Length = 313

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTP 32
           + A D+GVPQ R+R++I+    N +VE+ FP P
Sbjct: 141 LNAMDYGVPQERKRIFIVGIKDNINVEYSFPEP 173


>gi|325979448|ref|YP_004289164.1| DNA (cytosine-5-)-methyltransferase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|325179376|emb|CBZ49420.1| DNA (cytosine-5-)-methyltransferase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 333

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A DFGV Q+RER+ ++   N       F++P     KP L D+L
Sbjct: 151 LNAWDFGVAQKRERMIMVGIRNDLANKTSFEYPEAHAYKPVLRDVL 196


>gi|218902126|ref|YP_002449960.1| cytosine-specific methyltransferase NlaX [Bacillus cereus AH820]
 gi|218538919|gb|ACK91317.1| cytosine-specific methyltransferase NlaX [Bacillus cereus AH820]
          Length = 350

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL 43
           + + ++G VPQ RER+YI+ FL    + +F FP P+ +   L  ++
Sbjct: 153 LNSMEYGNVPQNRERIYIVGFLENELTAKFDFPAPIPLTNTLNTVI 198


>gi|319639604|ref|ZP_07994351.1| cytosine-specific methyltransferase [Neisseria mucosa C102]
 gi|317399175|gb|EFV79849.1| cytosine-specific methyltransferase [Neisseria mucosa C102]
          Length = 348

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 6/54 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-----LGIKPRLGDILEEHIDD 49
           + A D+GVPQ R+R + + F N ++ F+FP       + +K  + D+ +  +DD
Sbjct: 155 LMASDYGVPQNRKRAFFVGFKNGTI-FEFPKQTVNQYVTVKQAISDLPDYSVDD 207


>gi|113477918|ref|YP_723979.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101]
 gi|110168966|gb|ABG53506.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101]
          Length = 337

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45
           +   DFGVPQ R+R+ +I       EF FP  L  K  +G+ LEE
Sbjct: 155 LNTVDFGVPQNRQRVIVIGHKG---EFTFPQVLDKKVTVGEALEE 196


>gi|237742048|ref|ZP_04572529.1| site-specific DNA-methyltransferase [Fusobacterium sp. 4_1_13]
 gi|229429696|gb|EEO39908.1| site-specific DNA-methyltransferase [Fusobacterium sp. 4_1_13]
          Length = 440

 Score = 34.7 bits (78), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFP----TPLGIKPRLGDILEEHIDDK 50
           + A ++GVPQ R RL +I F N   E K+P      + ++  L D+    +D+K
Sbjct: 189 LNASNYGVPQNRHRLILIGFRNDMKEPKYPKEFKQKVTLREALSDLTNYELDNK 242


>gi|254673505|emb|CBA08927.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha275]
          Length = 273

 Score = 34.7 bits (78), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +  +S+
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 207


>gi|304387455|ref|ZP_07369646.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|304338548|gb|EFM04667.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
          Length = 273

 Score = 34.3 bits (77), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +  +S+
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 207


>gi|261840146|gb|ACX99911.1| cytosine-specific methyltransferase [Helicobacter pylori 52]
          Length = 343

 Score = 34.3 bits (77), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 27/46 (58%), Gaps = 5/46 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDIL 43
           + A + GV Q+RERL+I+     LN S  F FP PL  K  L DIL
Sbjct: 151 LNASNHGVAQKRERLFIVGIRKDLNRS--FNFPKPLKNKKVLKDIL 194


>gi|321310707|ref|YP_004193036.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
 gi|319802551|emb|CBY93197.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
          Length = 340

 Score = 34.3 bits (77), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 1   MKACDFGVPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDILEE 45
           + + D+GV Q+RERL +I    DF    + FK+P     KP L D+L +
Sbjct: 156 LNSWDYGVAQKRERLILIGIRSDF-REKISFKYPKKHRYKPVLSDVLND 203


>gi|281491831|ref|YP_003353811.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
 gi|281375542|gb|ADA65048.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
          Length = 347

 Score = 34.3 bits (77), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDI--LEEHI-DDKSTISN 55
           + A DFGVPQ+R R+  +   N   +F FP    +  +  L D+  LE+ +  ++S  SN
Sbjct: 153 LVASDFGVPQKRRRIVFVGLQNDVFDFNFPEFGMVTTEMALSDLPSLEDELGTEESEYSN 212

Query: 56  KLWEGHQK 63
           K    +QK
Sbjct: 213 KPQNSYQK 220


>gi|270293678|ref|ZP_06199880.1| cytosine-specific methyltransferase [Bacteroides sp. D20]
 gi|270275145|gb|EFA21005.1| cytosine-specific methyltransferase [Bacteroides sp. D20]
          Length = 361

 Score = 34.3 bits (77), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           A ++GVPQRR R++++   N  ++F+FP P   K      +EE I D   + N
Sbjct: 154 ADEYGVPQRRMRMFMVGN-NQGIDFEFPKPFDYKVS----VEEAIGDLPVLHN 201


>gi|149060302|gb|EDM11016.1| coproporphyrinogen oxidase [Rattus norvegicus]
          Length = 233

 Score = 34.3 bits (77), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 13/104 (12%)

Query: 2   KACD--FGVPQRRER-----LYIIDFLNPSVE--FKFPTPLG--IKPRLGDILEEHIDDK 50
           K CD  F +  R ER     ++  D  +PS E  F+F       + P    I+++H DD 
Sbjct: 96  KWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEAFRFVKTCAEAVVPSYVPIVKKHCDDS 155

Query: 51  STISNKLWEGHQKRK--ENNKIAGKGFGYGLFFENSATTNTLSA 92
            T  +KLW+  ++ +  E N +  +G  +GLF   S   + L +
Sbjct: 156 YTPQDKLWQQLRRGRYVEFNLVYDRGTKFGLFTPGSRIESILMS 199


>gi|240128365|ref|ZP_04741026.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268686763|ref|ZP_06153625.1| DNA modification methylase [Neisseria gonorrhoeae SK-93-1035]
 gi|268627047|gb|EEZ59447.1| DNA modification methylase [Neisseria gonorrhoeae SK-93-1035]
          Length = 423

 Score = 34.3 bits (77), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +  +S+
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 207


>gi|59801103|ref|YP_207815.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA 1090]
 gi|121634967|ref|YP_975212.1| DNA modification methylase [Neisseria meningitidis FAM18]
 gi|194098793|ref|YP_002001855.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           NCCP11945]
 gi|239999085|ref|ZP_04719009.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           35/02]
 gi|240014008|ref|ZP_04720921.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           DGI18]
 gi|240016449|ref|ZP_04722989.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA6140]
 gi|240080568|ref|ZP_04725111.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA19]
 gi|240113063|ref|ZP_04727553.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           MS11]
 gi|240115818|ref|ZP_04729880.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID18]
 gi|240118116|ref|ZP_04732178.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID1]
 gi|240121574|ref|ZP_04734536.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID24-1]
 gi|240123666|ref|ZP_04736622.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID332]
 gi|240125856|ref|ZP_04738742.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           SK-92-679]
 gi|254493863|ref|ZP_05107034.1| DNA modification methylase [Neisseria gonorrhoeae 1291]
 gi|260440365|ref|ZP_05794181.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           DGI2]
 gi|268594923|ref|ZP_06129090.1| DNA modification methylase [Neisseria gonorrhoeae 35/02]
 gi|268596698|ref|ZP_06130865.1| DNA modification methylase [Neisseria gonorrhoeae FA19]
 gi|268599147|ref|ZP_06133314.1| DNA modification methylase [Neisseria gonorrhoeae MS11]
 gi|268601493|ref|ZP_06135660.1| DNA modification methylase [Neisseria gonorrhoeae PID18]
 gi|268603831|ref|ZP_06137998.1| DNA modification methylase [Neisseria gonorrhoeae PID1]
 gi|268682295|ref|ZP_06149157.1| DNA modification methylase [Neisseria gonorrhoeae PID332]
 gi|268684453|ref|ZP_06151315.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679]
 gi|291043662|ref|ZP_06569378.1| DNA modification methylase [Neisseria gonorrhoeae DGI2]
 gi|293398965|ref|ZP_06643130.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|59717998|gb|AAW89403.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA 1090]
 gi|120866673|emb|CAM10425.1| DNA modification methylase [Neisseria meningitidis FAM18]
 gi|193934083|gb|ACF29907.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           NCCP11945]
 gi|226512903|gb|EEH62248.1| DNA modification methylase [Neisseria gonorrhoeae 1291]
 gi|268548312|gb|EEZ43730.1| DNA modification methylase [Neisseria gonorrhoeae 35/02]
 gi|268550486|gb|EEZ45505.1| DNA modification methylase [Neisseria gonorrhoeae FA19]
 gi|268583278|gb|EEZ47954.1| DNA modification methylase [Neisseria gonorrhoeae MS11]
 gi|268585624|gb|EEZ50300.1| DNA modification methylase [Neisseria gonorrhoeae PID18]
 gi|268587962|gb|EEZ52638.1| DNA modification methylase [Neisseria gonorrhoeae PID1]
 gi|268622579|gb|EEZ54979.1| DNA modification methylase [Neisseria gonorrhoeae PID332]
 gi|268624737|gb|EEZ57137.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679]
 gi|291012125|gb|EFE04114.1| DNA modification methylase [Neisseria gonorrhoeae DGI2]
 gi|291610379|gb|EFF39489.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|317164377|gb|ADV07918.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 423

 Score = 34.3 bits (77), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +  +S+
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 207


>gi|218768275|ref|YP_002342787.1| DNA modification methylase [Neisseria meningitidis Z2491]
 gi|121052283|emb|CAM08611.1| DNA modification methylase [Neisseria meningitidis Z2491]
          Length = 423

 Score = 33.9 bits (76), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +  +S+
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--SPSPKLKNILESGLPTESS 207


>gi|126658057|ref|ZP_01729209.1| DNA cytosine methylase [Cyanothece sp. CCY0110]
 gi|126620695|gb|EAZ91412.1| DNA cytosine methylase [Cyanothece sp. CCY0110]
          Length = 358

 Score = 33.9 bits (76), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYII----DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A  F +PQ RER+YI+    D+L   VEF FP        +   +E +++  S IS  
Sbjct: 181 LDAALFNLPQVRERIYIVGFCRDYLKERVEFNFPVGRKNNVFIDQFIETNVEGYS-ISKH 239

Query: 57  LWEGHQKRKENNK 69
           L + +  +K++ +
Sbjct: 240 LQKTYLFKKDDGR 252


>gi|314055098|ref|YP_004063436.1| cytosine-specific methyltransferase [Ostreococcus tauri virus 2]
 gi|313574989|emb|CBI70002.1| cytosine-specific methyltransferase [Ostreococcus tauri virus 2]
          Length = 315

 Score = 33.9 bits (76), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 8   VPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           VPQ RER+YI+ F +  +   F F    G K  L D +E  + DK   S+K
Sbjct: 153 VPQHRERIYIVGFRDKELHDNFNFDFVEGDKGNLCDFMESCVPDKYYYSDK 203


>gi|79749365|ref|NP_001032172.1| coproporphyrinogen-III oxidase, mitochondrial precursor [Rattus
           norvegicus]
 gi|123780327|sp|Q3B7D0|HEM6_RAT RecName: Full=Coproporphyrinogen-III oxidase, mitochondrial;
           Short=COX; Short=Coprogen oxidase;
           Short=Coproporphyrinogenase; Flags: Precursor
 gi|78070754|gb|AAI07665.1| Coproporphyrinogen oxidase [Rattus norvegicus]
          Length = 443

 Score = 33.9 bits (76), Expect = 7.6,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 13/102 (12%)

Query: 2   KACD--FGVPQRRER-----LYIIDFLNPSVE--FKFPTPLG--IKPRLGDILEEHIDDK 50
           K CD  F +  R ER     ++  D  +PS E  F+F       + P    I+++H DD 
Sbjct: 306 KWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEAFRFVKTCAEAVVPSYVPIVKKHCDDS 365

Query: 51  STISNKLWEGHQKRK--ENNKIAGKGFGYGLFFENSATTNTL 90
            T  +KLW+  ++ +  E N +  +G  +GLF   S   + L
Sbjct: 366 YTPQDKLWQQLRRGRYVEFNLVYDRGTKFGLFTPGSRIESIL 407


>gi|326567346|gb|EGE17461.1| type II DNA modification enzyme [Moraxella catarrhalis BC1]
          Length = 327

 Score = 33.9 bits (76), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 6   FGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           +GVPQ R+R+Y +        + FKFP P+  KP + D L +  D +  ++N  ++ +  
Sbjct: 149 YGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTFQKYLA 207

Query: 64  RKEN 67
            K N
Sbjct: 208 SKYN 211


>gi|297621903|ref|YP_003710040.1| C-5 cytosine-specific DNA methylase [Waddlia chondrophila WSU
           86-1044]
 gi|297377204|gb|ADI39034.1| C-5 cytosine-specific DNA methylase [Waddlia chondrophila WSU
           86-1044]
          Length = 410

 Score = 33.9 bits (76), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEE 45
           +K+  + VPQ+RERL+I+   N  V   +FK+P+P      L D L++
Sbjct: 220 LKSIFYQVPQKRERLFIVGVRNDLVKKAKFKWPSPFKKVLTLKDALKQ 267


>gi|326560963|gb|EGE11328.1| type II DNA modification enzyme [Moraxella catarrhalis 7169]
 gi|326575187|gb|EGE25115.1| type II DNA modification enzyme [Moraxella catarrhalis CO72]
          Length = 322

 Score = 33.9 bits (76), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 6   FGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           +GVPQ R+R+Y +        + FKFP P+  KP + D L +  D +  ++N  ++ +  
Sbjct: 144 YGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTFQKYLA 202

Query: 64  RKEN 67
            K N
Sbjct: 203 SKYN 206


>gi|261400634|ref|ZP_05986759.1| DNA (cytosine-5-)-methyltransferase [Neisseria lactamica ATCC
           23970]
 gi|313668389|ref|YP_004048673.1| DNA modification methylase [Neisseria lactamica ST-640]
 gi|1709164|sp|P50182|MTN4_NEILA RecName: Full=Modification methylase NlaIV; Short=M.NlaIV; AltName:
           Full=Cytosine-specific methyltransferase NlaIV
 gi|476227|gb|AAA53237.1| M.NlaIV [Neisseria lactamica]
 gi|269209540|gb|EEZ75995.1| DNA (cytosine-5-)-methyltransferase [Neisseria lactamica ATCC
           23970]
 gi|313005851|emb|CBN87307.1| DNA modification methylase [Neisseria lactamica 020-06]
          Length = 423

 Score = 33.9 bits (76), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +  +S+
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTPS--PKLKNILESGLPTESS 207


>gi|268610192|ref|ZP_06143919.1| cytosine-specific DNA methylase [Ruminococcus flavefaciens FD-1]
          Length = 475

 Score = 33.9 bits (76), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 54/123 (43%), Gaps = 31/123 (25%)

Query: 1   MKACDFGVPQRRERLYII----DFLNPSV---EFKFPTPLGI-----KPRLGD---ILEE 45
           +   DFG+PQ RER+YI+    D  N  +    F     L +     K ++GD   ILE+
Sbjct: 204 LSPSDFGIPQIRERVYILGIRRDIRNQQILTNGFIHIEDLQLDKHFKKCKMGDAWSILED 263

Query: 46  HIDDKSTISNK------LWEGHQKRKENNKIAG-----KGFGYGLFFENSATTNTLSARY 94
            +DD   IS +       WE  +K   N K+ G       FG G    N  T +  S++ 
Sbjct: 264 EVDDSYIISEEKEQMILAWEEFRK-ATNIKVIGFPIWIDSFGVG----NDDTDDVYSSQG 318

Query: 95  YKD 97
           Y D
Sbjct: 319 YDD 321


>gi|326563801|gb|EGE14052.1| type II DNA modification enzyme [Moraxella catarrhalis 46P47B1]
 gi|326566814|gb|EGE16953.1| type II DNA modification enzyme [Moraxella catarrhalis 103P14B1]
 gi|326576727|gb|EGE26634.1| type II DNA modification enzyme [Moraxella catarrhalis 101P30B1]
          Length = 327

 Score = 33.5 bits (75), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 6   FGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           +GVPQ R+R+Y +        + FKFP P+  KP + D L +  D +  ++N  ++ +  
Sbjct: 149 YGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTFQKYLA 207

Query: 64  RKEN 67
            K N
Sbjct: 208 SKYN 211


>gi|309378580|emb|CBX22758.1| DNA cytosine methyltransferase M.NlaIV [Neisseria lactamica
           Y92-1009]
          Length = 380

 Score = 33.5 bits (75), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +  +S+
Sbjct: 115 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFET--TPSPKLKNILESGLPTESS 164


>gi|317181803|dbj|BAJ59587.1| Type II DNA modification enzyme [Helicobacter pylori F57]
          Length = 351

 Score = 33.5 bits (75), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDI 42
           + A D+GVPQ RER+ ++  L     +F FP P+     +K  LGD+
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDALGDL 191


Searching..................................................done


Results from round 2




>gi|78777762|ref|YP_394077.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM
           1251]
 gi|78498302|gb|ABB44842.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM
           1251]
          Length = 328

 Score =  190 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 78/101 (77%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ RER+YI+ FL+  VEF+FP P+    ++GDILE+ +D+K TIS+KLW G
Sbjct: 163 LNAKDYGVPQNRERIYIVGFLDNEVEFEFPKPIEKYVKVGDILEDKVDEKYTISDKLWAG 222

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  +K  G GFGY +F ENS  T+T+SARYYKDGSEI
Sbjct: 223 HQRRKIEHKAKGNGFGYSMFNENSIYTSTISARYYKDGSEI 263


>gi|313667524|ref|YP_004047808.1| cytosine-specific methyltransferase [Neisseria lactamica ST-640]
 gi|309378245|emb|CBX23130.1| DNA cytosine methyltransferase M.NlaX [Neisseria lactamica
           Y92-1009]
 gi|313004986|emb|CBN86414.1| cytosine-specific methyltransferase [Neisseria lactamica 020-06]
          Length = 313

 Score =  190 bits (483), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFG+PQ RER+Y++ FLN  V+F+FP P+G    +GDILE + D+K TIS+KLW+G
Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  N+ AGKGFGYGLF   SA TNT+SARYYKDGSEI
Sbjct: 205 HQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245


>gi|127471|sp|P24581|MTNX_NEILA RecName: Full=Cytosine-specific methyltransferase NlaX;
           Short=M.NlaX
 gi|45004|emb|CAA38357.1| cytosine-specific methyltransferase of NlaIII [Neisseria lactamica]
          Length = 313

 Score =  187 bits (477), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFG+PQ RER+Y++ FLN  V+F+FP P+G    +GDILE + D+K TIS+KLW+G
Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +Q+RK  N+ AGKGFGYGLF   SA TNT+SARYYKDGSEI
Sbjct: 205 YQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245


>gi|315637499|ref|ZP_07892709.1| modification methylase EcoRII [Arcobacter butzleri JV22]
 gi|315478217|gb|EFU68940.1| modification methylase EcoRII [Arcobacter butzleri JV22]
          Length = 326

 Score =  187 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ RER+YII FL+ S++FK+P PL  K RLGDIL++++DDK TIS+KLW G
Sbjct: 163 LNAKDFGVPQNRERIYIIAFLDHSIDFKYPKPLNKKNRLGDILDDNVDDKYTISDKLWAG 222

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK+ +K  G GFGY LF  NS  T+T+SARYYKDGSEI
Sbjct: 223 HQRRKKEHKEKGNGFGYSLFTHNSEYTSTISARYYKDGSEI 263


>gi|261400948|ref|ZP_05987073.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
 gi|269209191|gb|EEZ75646.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
          Length = 313

 Score =  187 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFG+PQ RER+Y++ FLN  V+F+FP P+G    +GDILE + D+K TIS+KLW+G
Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +Q+RK  N+ AGKGFGYGLF   SA TNT+SARYYKDGSEI
Sbjct: 205 YQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245


>gi|150026187|ref|YP_001297013.1| type II modification methyltransferase [Flavobacterium
           psychrophilum JIP02/86]
 gi|149772728|emb|CAL44211.1| Probable type II modification methyltransferase [Flavobacterium
           psychrophilum JIP02/86]
          Length = 335

 Score =  186 bits (474), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 63/101 (62%), Positives = 83/101 (82%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA +FG+PQ RER+YI+ FL+ S++FKFPTP  +  ++GDILE+ +D+K TIS++LWEG
Sbjct: 152 LKAKEFGLPQNRERIYIVGFLDNSIKFKFPTPTKLPTKVGDILEQKVDEKYTISDRLWEG 211

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  NK  GKGFG+G+  ENS  TNT+SARYYKDGSEI
Sbjct: 212 HQRRKIANKEKGKGFGFGIVNENSEYTNTISARYYKDGSEI 252


>gi|319407456|emb|CBI81106.1| Cytosine-specific methyltransferase NlaX [Bartonella sp. 1-1C]
          Length = 307

 Score =  183 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 68/101 (67%), Positives = 80/101 (79%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFGVPQ RER+YI+ FL+ S  FKFP+P+ IK R+GDIL+  +D+K TISN LW G
Sbjct: 147 LKARDFGVPQNRERIYIVGFLDHSTNFKFPSPMNIKTRVGDILDNDVDEKYTISNTLWHG 206

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  NK+ GKGFGYGLF   S  TNTLSARYYKDGSEI
Sbjct: 207 HQRRKAQNKLNGKGFGYGLFNMESPYTNTLSARYYKDGSEI 247


>gi|119026301|ref|YP_910146.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC
           15703]
 gi|118765885|dbj|BAF40064.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC
           15703]
          Length = 383

 Score =  183 bits (467), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 66/105 (62%), Positives = 79/105 (75%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A DFGVPQ RER+YI+ F    V    +FK+P P  I  RLGDILE+++DDK TIS+ 
Sbjct: 214 LAAKDFGVPQNRERIYIVGFDKEQVPNWADFKYPEPPCIPTRLGDILEKNVDDKYTISDA 273

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW GHQ+RK+ NK AGKGFGYGLF E+S   NT+SARYYKDGSEI
Sbjct: 274 LWAGHQRRKQENKKAGKGFGYGLFDEDSPYANTISARYYKDGSEI 318


>gi|50914506|ref|YP_060478.1| Type II restriction-modification system methylation subunit
           [Streptococcus pyogenes MGAS10394]
 gi|40218542|gb|AAR83196.1| type II modification methylase [Streptococcus pyogenes]
 gi|50261587|gb|AAT72355.1| methylase [Streptococcus pyogenes]
 gi|50903580|gb|AAT87295.1| Type II restriction-modification system methylation subunit
           [Streptococcus pyogenes MGAS10394]
 gi|114386439|gb|ABI74454.1| DNA methyltransferase [Streptococcus pyogenes]
          Length = 408

 Score =  183 bits (466), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 62/104 (59%), Positives = 76/104 (73%), Gaps = 4/104 (3%)

Query: 2   KACDFGVPQRRERLYIIDFL----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           KA DFGVPQ RER+YI+ F     N   EF+FP P  ++ +LG+IL+  +D+K TIS+KL
Sbjct: 243 KARDFGVPQNRERIYIVGFDKTCVNNFSEFRFPEPFHLETKLGNILQTDVDEKYTISDKL 302

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           WEGHQ+RK  +K  G GFGY LF  +S  TNTLSARYYKDGSEI
Sbjct: 303 WEGHQRRKAEHKTKGNGFGYSLFNADSPYTNTLSARYYKDGSEI 346


>gi|224418923|ref|ZP_03656929.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|253827874|ref|ZP_04870759.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|313142438|ref|ZP_07804631.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|253511280|gb|EES89939.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|313131469|gb|EFR49086.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
          Length = 328

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 73/101 (72%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ RER+ I+ F + +V F FP P     +LGDILE+  D+K TISN+LWE 
Sbjct: 164 LNARDYGVPQNRERIIIVGFKDHNVHFDFPKPYNYSVKLGDILEKTPDEKYTISNRLWES 223

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RKE  K  G GFGY LF ENS  T+T+SARYYKDGSEI
Sbjct: 224 HQQRKELQKAKGNGFGYRLFDENSPYTSTISARYYKDGSEI 264


>gi|283471715|emb|CAQ50926.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 397

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 73/105 (69%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           ++A DFG PQ RER+YI+ F    +     F FP PL I+  LG ILE +++DK TIS++
Sbjct: 227 LRARDFGCPQNRERIYIVGFDKQQIKNAENFSFPEPLPIETSLGSILESNVNDKYTISDR 286

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW GHQ+RK  +K  G GFGY +F E S  TNTLSARYYKDGSEI
Sbjct: 287 LWYGHQRRKREHKAKGNGFGYSIFNETSPYTNTLSARYYKDGSEI 331


>gi|157737722|ref|YP_001490405.1| DNA (cytosine-5-)-methyltransferase [Arcobacter butzleri RM4018]
 gi|157699576|gb|ABV67736.1| DNA (Cytosine-5-)-methyltransferase [Arcobacter butzleri RM4018]
          Length = 326

 Score =  180 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 62/101 (61%), Positives = 78/101 (77%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FGVPQ RER+YII FL+ S++FK+P  L  K RLGDIL+ ++DDK TIS+KLW G
Sbjct: 163 LNARNFGVPQNRERIYIIAFLDHSIDFKYPKSLNKKNRLGDILDNNVDDKYTISDKLWAG 222

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK+ +K  G GFGY LF   S  T+T+SARYYKDGSEI
Sbjct: 223 HQRRKKEHKEKGNGFGYSLFTHESEYTSTISARYYKDGSEI 263


>gi|1657420|gb|AAC45971.1| DNA cytosine methyltransferase M.SenPI [Salmonella enterica subsp.
           enterica serovar Enteritidis]
          Length = 379

 Score =  178 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317


>gi|1871451|dbj|BAA11167.1| C5-cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|3421011|emb|CAA76526.1| M.Ecl18kI (DNA-methyltransferase) [Enterobacter cloacae]
          Length = 379

 Score =  178 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317


>gi|32470131|ref|NP_863573.1| DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae]
 gi|462656|sp|P34879|MTS2_SHISO RecName: Full=Modification methylase SsoII; Short=M.SsoII; AltName:
           Full=Cytosine-specific methyltransferase SsoII
 gi|11559818|gb|AAG38101.1|AF300473_2 DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae]
 gi|294244|gb|AAA98279.1| C5-cytosine methylase [Plasmid P4]
          Length = 379

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317


>gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254547855|gb|ACT56990.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 101

 Score =  177 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG
Sbjct: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI
Sbjct: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101


>gi|255066464|ref|ZP_05318319.1| modification methylase EcoRII [Neisseria sicca ATCC 29256]
 gi|298369378|ref|ZP_06980696.1| modification methylase EcoRII [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|255049344|gb|EET44808.1| modification methylase EcoRII [Neisseria sicca ATCC 29256]
 gi|298283381|gb|EFI24868.1| modification methylase EcoRII [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 357

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 57/103 (55%), Positives = 71/103 (68%), Gaps = 2/103 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFL--NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           M A DF +PQ RER+YI+ F     + +F+FP PL    ++GDILE   D K TIS++LW
Sbjct: 190 MAAKDFNLPQNRERIYIVGFRSAKDAAQFEFPHPLPKTVKVGDILESFPDAKYTISDRLW 249

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +GH +RK  +K  G GFGYGLF   S  TNT+SARYYKDGSEI
Sbjct: 250 QGHLRRKAEHKQKGNGFGYGLFNAQSEYTNTISARYYKDGSEI 292


>gi|323968851|gb|EGB64187.1| DNA-cytosine methyltransferase [Escherichia coli TA007]
          Length = 282

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 118 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 177

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 178 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 220


>gi|256760956|ref|ZP_05501536.1| type II restriction-modification system methylation subunit
           [Enterococcus faecalis T3]
 gi|256682207|gb|EEU21902.1| type II restriction-modification system methylation subunit
           [Enterococcus faecalis T3]
          Length = 405

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 58/104 (55%), Positives = 74/104 (71%), Gaps = 4/104 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           KA DFG PQ RER+YI+ F   S++    F+FPT    K  +GDILE+ +D+K TIS+ L
Sbjct: 237 KARDFGAPQNRERIYIVGFDKLSLKNIDLFEFPTAPKPKTCVGDILEDSVDEKYTISDTL 296

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           WEGH++RK  +K  G GFG+ LF  +S  TNT+SARYYKDGSEI
Sbjct: 297 WEGHKRRKLEHKEKGNGFGFSLFNSSSPYTNTISARYYKDGSEI 340


>gi|299536257|ref|ZP_07049570.1| DNA-methyltransferase MKpn2kI [Lysinibacillus fusiformis ZC1]
 gi|298728243|gb|EFI68805.1| DNA-methyltransferase MKpn2kI [Lysinibacillus fusiformis ZC1]
          Length = 403

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS----VEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           ++A DFGVPQ RER++++ F        V FKFP PL     LGDIL + +D+K TIS+K
Sbjct: 212 LRAADFGVPQNRERVFMVGFNKRIGGELVPFKFPKPLSTPTNLGDILFKKVDEKYTISDK 271

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           L+EGH +RKE +K  G GFG+ LF ENS+ TNTLSARYYKDGSEI
Sbjct: 272 LYEGHLRRKEMHKQKGNGFGFSLFDENSSYTNTLSARYYKDGSEI 316


>gi|1709152|sp|P50185|MTD5_DACSA RecName: Full=Modification methylase DsaV; Short=M.DsaV; AltName:
           Full=Cytosine-specific methyltransferase DsaV
 gi|505694|gb|AAA86046.1| DsaV methyltransferase [Dactylococcopsis salina]
          Length = 351

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 76/104 (73%), Gaps = 3/104 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DF +PQ+RER++I+ F + + +   F FP P+ +  ++GD+LE+ +D+K TI++++
Sbjct: 146 ISATDFNLPQKRERIFIVGFQDKNNKNLIFDFPKPIELTAKVGDLLEKEVDEKYTITDRM 205

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           WEGHQ RK+ ++  G GFG+ L   NS+ T T+SARYYKDGSE+
Sbjct: 206 WEGHQNRKKAHRKRGNGFGFSLVNRNSSYTRTISARYYKDGSEV 249


>gi|462657|sp|P34877|MTSA_LACLC RecName: Full=Modification methylase ScrFIA; Short=M.ScrFI-A;
           Short=M.ScrFIA; AltName: Full=Cytosine-specific
           methyltransferase ScrFIA
 gi|149493|gb|AAA25220.1| SCRFI methylase [Lactococcus lactis]
 gi|2327034|gb|AAB66696.1| 5-methyl-cytosine methyltransferase [Lactococcus lactis subsp.
           cremoris]
          Length = 389

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 65/104 (62%), Positives = 79/104 (75%), Gaps = 4/104 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           KA DFG+PQ RER+YI+ F   S+    +F+ PTPL  K R+G+ILE  +DDK TIS+KL
Sbjct: 221 KARDFGLPQNRERIYIVGFDRKSISNYSDFQMPTPLQEKTRVGNILESVVDDKYTISDKL 280

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           W+GHQ+RK  NK  GKGFGY LF ++S  TNTLSARYYKDGSEI
Sbjct: 281 WDGHQRRKTENKKNGKGFGYTLFNQDSEYTNTLSARYYKDGSEI 324


>gi|319893523|ref|YP_004150398.1| DNA-cytosine methyltransferase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317163219|gb|ADV06762.1| DNA-cytosine methyltransferase [Staphylococcus pseudintermedius
           HKU10-03]
          Length = 394

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 73/105 (69%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +KA DFGVPQ RER+YI+ F    +    ++  P P   +  LG ILE+++D+K TIS+K
Sbjct: 227 LKAKDFGVPQNRERIYIVGFDKRRIKKWRDYIPPKPPKSQTLLGKILEKNVDEKYTISDK 286

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW GH++RK  +K+ G GFG+ L+   S  TNTLSARYYKDGSEI
Sbjct: 287 LWSGHKRRKAEHKLKGNGFGFTLYNGESPYTNTLSARYYKDGSEI 331


>gi|321310755|ref|YP_004193084.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
 gi|319802599|emb|CBY93245.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
          Length = 362

 Score =  172 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 71/105 (67%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           ++A DFGVPQ RER+YI+ F   +V     FKFP        LGDILE  +DDK TISN 
Sbjct: 196 LRARDFGVPQNRERIYIVGFDKDAVQGYRNFKFPEATHKNTCLGDILESEVDDKYTISNT 255

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LWEGH++RK  NK  GKGFGY LF   S   NTLSARYYKDGSE+
Sbjct: 256 LWEGHKRRKVENKKKGKGFGYSLFNFESPYANTLSARYYKDGSEV 300


>gi|325989685|ref|YP_004249384.1| cytosine-specific methyltransferase [Mycoplasma suis KI3806]
 gi|323574770|emb|CBZ40430.1| Cytosine-specific methyltransferase [Mycoplasma suis]
          Length = 326

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +K+ DFG+PQ RER+YI+ F    VE    F  P+P      +GDILE+ +++K TIS+ 
Sbjct: 160 LKSRDFGIPQNRERIYIVGFNKDLVESYENFSMPSPTLKATCVGDILEKEVNNKYTISDL 219

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LWEGH++RKE +K+ G+GFG+ LF ENS+ TNT+SARYYKDGSEI
Sbjct: 220 LWEGHKRRKEEHKLKGRGFGFSLFSENSSYTNTISARYYKDGSEI 264


>gi|325973250|ref|YP_004250314.1| cytosine-specific DNA modification methylase, HpaII-like protein
           [Mycoplasma suis str. Illinois]
 gi|323651852|gb|ADX97934.1| cytosine-specific DNA modification methylase, HpaII-like protein
           [Mycoplasma suis str. Illinois]
          Length = 326

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 58/105 (55%), Positives = 78/105 (74%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +K+ DFG+PQ RER+YI+ F    VE    F  P+P      +GDILE+ +++K TIS+ 
Sbjct: 160 LKSRDFGIPQNRERIYIVGFNKDLVESYENFSMPSPTLKATCVGDILEKEVNNKYTISDL 219

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LWEGH++RKE +K+ G+GFG+ LF ENS+ TNT+SARYYKDGSEI
Sbjct: 220 LWEGHKRRKEEHKLKGRGFGFSLFSENSSYTNTISARYYKDGSEI 264


>gi|262402975|ref|ZP_06079535.1| DNA-methyltransferase MKpn2kI [Vibrio sp. RC586]
 gi|262350474|gb|EEY99607.1| DNA-methyltransferase MKpn2kI [Vibrio sp. RC586]
          Length = 410

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 72/118 (61%), Gaps = 17/118 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFL-------NPSVEFKFPTPLGIKPRLGDILEEH------- 46
           ++A DFGVPQ RER++I+ F        N    F +P       R+GDILE         
Sbjct: 216 LRAADFGVPQNRERIFIVGFDKNYFRGVNFDSLFSWPEAPKTPTRVGDILEPQHVLDEEK 275

Query: 47  ---IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                D+ TIS+KLW+GH+KRKE +KI G GFGY LF  +S  TNT+SARYYKDGSEI
Sbjct: 276 QALGKDRYTISDKLWDGHKKRKEEHKIKGNGFGYSLFNADSEYTNTISARYYKDGSEI 333


>gi|315931535|gb|EFV10502.1| DNA (cytosine-5) methyltransferase [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 284

 Score =  169 bits (430), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 58/106 (54%), Positives = 76/106 (71%), Gaps = 5/106 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKF--PTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FG+PQ RER+YI+ FL     ++ F F     + IK +LGDILE+++D+K TIS+
Sbjct: 151 LNARNFGIPQNRERIYIVAFLKNKFKNISFNFNELKNIEIKSKLGDILEKNVDEKYTISD 210

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW GHQ+RK  +K  G GFGY LF  NS  T+T+SARYYKDGSEI
Sbjct: 211 KLWAGHQRRKLEHKKKGNGFGYSLFNHNSDYTSTISARYYKDGSEI 256


>gi|157414453|ref|YP_001481709.1| hypothetical protein C8J_0133 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|283955585|ref|ZP_06373079.1| hypothetical protein C1336_000030018 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|157385417|gb|ABV51732.1| hypothetical protein C8J_0133 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|283792928|gb|EFC31703.1| hypothetical protein C1336_000030018 [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 321

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 58/106 (54%), Positives = 76/106 (71%), Gaps = 5/106 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKF--PTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FG+PQ RER+YI+ FL     ++ F F     + IK +LGDILE+++D+K TIS+
Sbjct: 151 LNARNFGIPQNRERIYIVAFLKNKFKNISFNFNELKNIEIKSKLGDILEKNVDEKYTISD 210

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW GHQ+RK  +K  G GFGY LF  NS  T+T+SARYYKDGSEI
Sbjct: 211 KLWAGHQRRKLEHKKKGNGFGYSLFNHNSDYTSTISARYYKDGSEI 256


>gi|15677157|ref|NP_274310.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis MC58]
 gi|161870164|ref|YP_001599334.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis 053442]
 gi|218768314|ref|YP_002342826.1| putative modification methylase [Neisseria meningitidis Z2491]
 gi|7226530|gb|AAF41666.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis MC58]
 gi|121052322|emb|CAM08652.1| putative modification methylase [Neisseria meningitidis Z2491]
 gi|161595717|gb|ABX73377.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis 053442]
 gi|254670478|emb|CBA06174.1| putative DNA modification methylase [Neisseria meningitidis
           alpha153]
 gi|308389411|gb|ADO31731.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis
           alpha710]
 gi|316984080|gb|EFV63058.1| modification methylase SsoII [Neisseria meningitidis H44/76]
 gi|319410559|emb|CBY90927.1| putative type II restriction-modification system enzyme Mod
           [Neisseria meningitidis WUE 2594]
 gi|325134466|gb|EGC57111.1| modification methylase EcoRII [Neisseria meningitidis M13399]
 gi|325136204|gb|EGC58812.1| modification methylase EcoRII [Neisseria meningitidis M0579]
 gi|325140483|gb|EGC63004.1| modification methylase EcoRII [Neisseria meningitidis CU385]
 gi|325144567|gb|EGC66866.1| modification methylase EcoRII [Neisseria meningitidis M01-240013]
 gi|325200082|gb|ADY95537.1| modification methylase EcoRII [Neisseria meningitidis H44/76]
 gi|325201996|gb|ADY97450.1| modification methylase EcoRII [Neisseria meningitidis M01-240149]
 gi|325205934|gb|ADZ01387.1| modification methylase EcoRII [Neisseria meningitidis M04-240196]
 gi|325208252|gb|ADZ03704.1| modification methylase EcoRII [Neisseria meningitidis NZ-05/33]
          Length = 337

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 63/105 (60%), Gaps = 6/105 (5%)

Query: 1   MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M A  + VPQ RER++I+ F     N  + F FP+P   +P+L  ILE+ +D+  T+S+ 
Sbjct: 171 MNAKYY-VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDN 229

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW   Q   + +K  G GFG+GL       + TLSARYYKDGSEI
Sbjct: 230 LWLYLQNYAKKHKAKGNGFGFGLVD-LDGISRTLSARYYKDGSEI 273


>gi|325130344|gb|EGC53110.1| modification methylase EcoRII [Neisseria meningitidis OX99.30304]
          Length = 337

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 63/105 (60%), Gaps = 6/105 (5%)

Query: 1   MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M A  + VPQ RER++I+ F     N  + F FP+P   +P+L  ILE+ +D+  T+S+ 
Sbjct: 171 MNAKYY-VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDN 229

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW   Q   + +K  G GFG+GL       + TLSARYYKDGSEI
Sbjct: 230 LWLYLQNYAKKHKAKGNGFGFGLVD-LDGISRTLSARYYKDGSEI 273


>gi|304387412|ref|ZP_07369603.1| modification methylase EcoRII [Neisseria meningitidis ATCC 13091]
 gi|304338505|gb|EFM04624.1| modification methylase EcoRII [Neisseria meningitidis ATCC 13091]
          Length = 336

 Score =  167 bits (423), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 63/105 (60%), Gaps = 6/105 (5%)

Query: 1   MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M A  + VPQ RER++I+ F     N  + F FP+P   +P+L  ILE+ +D+  T+S+ 
Sbjct: 171 MNAKYY-VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDN 229

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW   Q   + +K  G GFG+GL       + TLSARYYKDGSEI
Sbjct: 230 LWLYLQNYAKKHKAKGNGFGFGLVD-LDGISRTLSARYYKDGSEI 273


>gi|260554958|ref|ZP_05827179.1| DNA-methyltransferase MKpn2kI [Acinetobacter baumannii ATCC 19606]
 gi|260411500|gb|EEX04797.1| DNA-methyltransferase MKpn2kI [Acinetobacter baumannii ATCC 19606]
          Length = 413

 Score =  166 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 74/114 (64%), Gaps = 13/114 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFL--------NPSVEFKFPTPLGIKPRLGDILEE-----HI 47
           ++A DFGVPQ RER++++ F         N    F +P P   + RLGDILE+       
Sbjct: 222 LRAADFGVPQNRERIFLVGFDKNYFGEECNFDQLFSWPVPPKKQTRLGDILEDVSKLKKS 281

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +D  TIS++LW+GHQ+RKE + I G GFGY L+  +S  TNTLSARYYKDGSEI
Sbjct: 282 EDVYTISDRLWQGHQRRKEEHGIKGNGFGYTLYTGDSPYTNTLSARYYKDGSEI 335


>gi|294788070|ref|ZP_06753314.1| modification methylase EcoRII [Simonsiella muelleri ATCC 29453]
 gi|294484363|gb|EFG32046.1| modification methylase EcoRII [Simonsiella muelleri ATCC 29453]
          Length = 355

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 69/106 (65%), Gaps = 5/106 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-----SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FGVPQ RER+YI+   N      +++F       +  ++GDIL+  +D+K TIS+
Sbjct: 184 LNAKNFGVPQNRERIYIVAIRNDFNPTFNLDFDKLKNTKVNCQVGDILQNQVDEKYTISD 243

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW GHQ+RK  +   G GFGY LF   S  T+T+SARYYKDGSEI
Sbjct: 244 KLWAGHQRRKAEHIEKGNGFGYSLFNAQSPYTSTISARYYKDGSEI 289


>gi|323495143|ref|ZP_08100228.1| DNA-methyltransferase MKpn2kI [Vibrio brasiliensis LMG 20546]
 gi|323310583|gb|EGA63762.1| DNA-methyltransferase MKpn2kI [Vibrio brasiliensis LMG 20546]
          Length = 443

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 70/118 (59%), Gaps = 17/118 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-------SVEFKFPTPLGIKPRLGDILEEHID----- 48
           ++A DFGVPQ RER++II F             F +P P     ++GDIL+   +     
Sbjct: 248 LRAADFGVPQNRERIFIIGFDKDYYTGVDFDQVFNWPEPPKTPTKVGDILQSDQELEAEA 307

Query: 49  -----DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                D  TIS++LWEGHQKRKE +K  G GFGY L+   S  TNT+SARYYKDGSEI
Sbjct: 308 KVIGKDCYTISDRLWEGHQKRKEGHKTKGNGFGYTLYNAESEYTNTISARYYKDGSEI 365


>gi|152998369|ref|YP_001343204.1| DNA-cytosine methyltransferase [Marinomonas sp. MWYL1]
 gi|150839293|gb|ABR73269.1| DNA-cytosine methyltransferase [Marinomonas sp. MWYL1]
          Length = 417

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 79/102 (77%), Gaps = 1/102 (0%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +K+ DFGVPQ R+R+YI+ + +  ++ F +P  +G+  R+GDILE + + K TIS++LWE
Sbjct: 255 LKSVDFGVPQNRQRIYIVLWKDGEIDKFDYPESMGLDTRVGDILEANPNPKLTISDRLWE 314

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           GHQ+RK  NKI GKGFGYG+  E+S  TNT+SARYYKDGSE+
Sbjct: 315 GHQRRKMQNKINGKGFGYGIVTEDSPYTNTISARYYKDGSEV 356


>gi|170729237|ref|YP_001763263.1| DNA-cytosine methyltransferase [Shewanella woodyi ATCC 51908]
 gi|169814584|gb|ACA89168.1| DNA-cytosine methyltransferase [Shewanella woodyi ATCC 51908]
          Length = 416

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 73/102 (71%), Gaps = 1/102 (0%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M++ DFGVPQ R+R+YII + +  +E F++P P G   ++ DILE    +K TIS+KLW 
Sbjct: 255 MRSVDFGVPQNRQRIYIILWKDGLIEQFQYPKPSGKDTKVADILESEPCEKLTISDKLWA 314

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           GH++RK  NK  GKGFGYGL    S  TNT+SARYYKDGSEI
Sbjct: 315 GHKRRKIENKAKGKGFGYGLVSPESEYTNTISARYYKDGSEI 356


>gi|166368844|ref|YP_001661117.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
 gi|166091217|dbj|BAG05925.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
          Length = 338

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 46/94 (48%), Positives = 59/94 (62%), Gaps = 2/94 (2%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67
           VPQ R+R++I+ F  PS  F FP    I P++ DILE  +D K T+++ LW+  QK  + 
Sbjct: 158 VPQNRKRIFIVGFEKPS-RFMFPEIPDIHPKIKDILEGEVDSKYTLTDHLWDYLQKYADK 216

Query: 68  NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +K  G GFGYGL         TLSARYYKDGSEI
Sbjct: 217 HKEKGNGFGYGLVNLE-GIARTLSARYYKDGSEI 249


>gi|124024750|ref|YP_001013866.1| site-specific DNA methylase [Prochlorococcus marinus str. NATL1A]
 gi|123959818|gb|ABM74601.1| Site-specific DNA methylase [Prochlorococcus marinus str. NATL1A]
          Length = 305

 Score =  161 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 50/101 (49%), Positives = 76/101 (75%), Gaps = 1/101 (0%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ RER++I  +++  + F+FP P  ++ ++GDIL++++ DK T+S+K+W  
Sbjct: 146 LNAKDFGVPQNRERIFIFGYID-FIFFEFPEPSKVQTKVGDILDDNVPDKFTLSDKMWTN 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             +RKENN+  G GFG+ LF ++S  T+T+SARYYKDGSEI
Sbjct: 205 AIRRKENNRKRGYGFGFSLFDKDSEYTSTISARYYKDGSEI 245


>gi|296103580|ref|YP_003613726.1| DNA cytosine methylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058039|gb|ADF62777.1| DNA cytosine methylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 471

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 9/105 (8%)

Query: 6   FGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNKLW 58
           + +PQ RER+ ++ F    N   +F       +    +P + D+LE  +D K  ++  LW
Sbjct: 269 YFLPQHRERIVLVGFRRDLNLKGDFTLRDIPSLYPARRPSVADLLEPAVDAKFILTPVLW 328

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +   +  + ++  G GFG+GL   N     T TLSARYYKDG+EI
Sbjct: 329 KYLYRYAKKHQAKGNGFGFGLVNPNDPHCVTRTLSARYYKDGAEI 373


>gi|229530048|ref|ZP_04419438.1| type II restriction-modification system methylation subunit [Vibrio
           cholerae 12129(1)]
 gi|229333822|gb|EEN99308.1| type II restriction-modification system methylation subunit [Vibrio
           cholerae 12129(1)]
          Length = 270

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 69/118 (58%), Gaps = 17/118 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-------FKFPTPLGIKPRLGDILEE-------- 45
           ++A DFG PQ RER++II F             F +P       R+GDIL+         
Sbjct: 76  LRAADFGSPQNRERIFIIGFNKDEFPNIDFDKLFSWPKAPKTPTRVGDILQTQQELELDK 135

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             H  D+ TIS+KLWEGHQKRK  +K  G GFGY LF  +S  TNT+SARYYKDGSEI
Sbjct: 136 KLHGKDRFTISDKLWEGHQKRKAEHKTKGNGFGYSLFNADSEYTNTISARYYKDGSEI 193


>gi|37524351|ref|NP_927695.1| DNA cytosine methylase [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|36783775|emb|CAE12633.1| DNA-cytosine methyltransferase [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 478

 Score =  160 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 9/105 (8%)

Query: 6   FGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58
           + +PQ RER+ ++ F    N    F            +P L D+LE  +D K  ++  LW
Sbjct: 279 YFLPQHRERIVLVGFRKDLNIHQGFTLRDISRYFPKERPTLADLLEPEVDSKYILTPNLW 338

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           +        ++  G GFG+GL   N   + T TLSARY+KDGSEI
Sbjct: 339 KYLYNYARKHQAKGNGFGFGLIDPNNKDSVTRTLSARYHKDGSEI 383


>gi|17863973|gb|AAL46998.1|AF448250_2 putative C-5 cytosine-specific DNA methylase [Bacteroides coprosuis
           DSM 18011]
          Length = 401

 Score =  160 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 67/110 (60%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--------FKFPTPLGIKPRLGDILEEHI--DDK 50
           + A DFG PQ RER+YI+ F              F+FP P   K  + D+LE+    D  
Sbjct: 237 LNAKDFGSPQNRERIYIVGFNKNHFTKIDDFNEIFQFPEPSKEKVSVKDVLEKIPANDTI 296

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
            TIS ++W+GHQKRK  ++  G GFG+ LF ENS  TNT+SARYYKDGSE
Sbjct: 297 YTISERIWQGHQKRKLKHQNKGNGFGFSLFNENSEYTNTISARYYKDGSE 346


>gi|317497297|ref|ZP_07955620.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316895366|gb|EFV17525.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 385

 Score =  160 bits (405), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 6/106 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-----SVEFKFPT-PLGIKPRLGDILEEHIDDKSTIS 54
           + A  FG+PQ RER+ I+ F          +FK+P   +  K  +GDILE+ + ++ TIS
Sbjct: 213 LNAYHFGIPQNRERIIIVGFNKDYLPKKFKDFKYPVGKIDKKVCVGDILEKEVGERFTIS 272

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           +KLWEGHQ RK  +K  G GFG+ LF ++S  T+T+SARYYKDGSE
Sbjct: 273 DKLWEGHQARKRMHKKKGNGFGFCLFNKDSKYTSTISARYYKDGSE 318


>gi|238922589|ref|YP_002936102.1| modification methylase [Eubacterium rectale ATCC 33656]
 gi|238874261|gb|ACR73968.1| modification methylase [Eubacterium rectale ATCC 33656]
          Length = 392

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 7/106 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF----LNPSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISN 55
           +   +F VPQ RER+ I+ F        +EF F  TP+  KP + DILE+ +DDK T+S+
Sbjct: 214 LDGQNF-VPQHRERIIIVGFDMERYGDDIEFDFDITPVNPKPVMRDILEKKVDDKYTLSD 272

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            LW   Q     ++ AG GFGYG+       + T+SARY+KDGSEI
Sbjct: 273 NLWTYLQNYAAKHRAAGNGFGYGI-APLDGVSRTISARYHKDGSEI 317


>gi|237713924|ref|ZP_04544405.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. D1]
 gi|262409168|ref|ZP_06085712.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. 2_1_22]
 gi|229446080|gb|EEO51871.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. D1]
 gi|262352915|gb|EEZ02011.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. 2_1_22]
          Length = 361

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 44/98 (44%), Positives = 55/98 (56%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+ I+ F          F FP        + +ILE  IDDK T+S+KLW   Q 
Sbjct: 186 VPQHRERIMIVGFNREIFHGEEQFCFPEQKQSTRGIREILESDIDDKYTLSDKLWSYLQN 245

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             E ++  G GFG+G+   N   + TLSARYYKDGSEI
Sbjct: 246 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 282


>gi|294646710|ref|ZP_06724334.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a]
 gi|294807186|ref|ZP_06766001.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD
           CC 1b]
 gi|292637950|gb|EFF56344.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a]
 gi|294445609|gb|EFG14261.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD
           CC 1b]
          Length = 445

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 44/98 (44%), Positives = 55/98 (56%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+ I+ F          F FP        + +ILE  IDDK T+S+KLW   Q 
Sbjct: 270 VPQHRERIMIVGFNREIFHGEEQFCFPEQKQSTRGIREILESDIDDKYTLSDKLWSYLQN 329

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             E ++  G GFG+G+   N   + TLSARYYKDGSEI
Sbjct: 330 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 366


>gi|312898460|ref|ZP_07757850.1| DNA (cytosine-5-)-methyltransferase [Megasphaera micronuciformis
           F0359]
 gi|310620379|gb|EFQ03949.1| DNA (cytosine-5-)-methyltransferase [Megasphaera micronuciformis
           F0359]
          Length = 400

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 59/99 (59%), Gaps = 6/99 (6%)

Query: 8   VPQRRERLYIIDFLN----PSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62
           VPQ RER+ I+ F        + F+F   P+  KP +  ILE  +DDK T+++KLW   Q
Sbjct: 208 VPQHRERILIVGFDRKRYGRDIGFRFSIAPVNPKPAIKAILETKVDDKYTLTDKLWTYLQ 267

Query: 63  KRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                ++ AG GFGYG+   N   + TLSARYYKDGSEI
Sbjct: 268 NYAAKHRAAGNGFGYGIADPN-GVSRTLSARYYKDGSEI 305


>gi|313158099|gb|EFR57504.1| putative DNA (cytosine-5-)-methyltransferase [Alistipes sp. HGB5]
          Length = 431

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 58/100 (58%), Gaps = 5/100 (5%)

Query: 6   FGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           + VPQ RER+ I+ F N        FKFP    +  ++ +ILE  +D K T+++KLW   
Sbjct: 265 YFVPQHRERIMIVGFRNNLFHGVEKFKFPELKDVSHKIRNILEPEVDPKYTLTDKLWVYL 324

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q   + ++ +G GFG+GL         TLSARYYKDGSEI
Sbjct: 325 QNYAKKHQDSGNGFGFGLVD-LDGIARTLSARYYKDGSEI 363


>gi|238783073|ref|ZP_04627100.1| Modification methylase EcoRII [Yersinia bercovieri ATCC 43970]
 gi|238716074|gb|EEQ08059.1| Modification methylase EcoRII [Yersinia bercovieri ATCC 43970]
          Length = 475

 Score =  158 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
            +F +PQ RER+ ++ F    N   +F            +P  G++LE  +DDK  ++  
Sbjct: 278 KNF-LPQHRERIVLVGFRKDLNIDKDFTLKDIHKFFPEKRPTFGELLEPVVDDKYILTPH 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           LW+      + ++  G GFG+GL     + +   TLSARY+KDGSEI
Sbjct: 337 LWKYLYNYAKKHQAKGNGFGFGLVDPTNSDSVARTLSARYHKDGSEI 383


>gi|261340425|ref|ZP_05968283.1| DNA (cytosine-5-)-methyltransferase [Enterobacter cancerogenus ATCC
           35316]
 gi|288317516|gb|EFC56454.1| DNA (cytosine-5-)-methyltransferase [Enterobacter cancerogenus ATCC
           35316]
          Length = 477

 Score =  157 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F       +    +P + D+LE  +D K  ++  
Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLMGDFTLRNLPALYPARRPTIADLLEPAVDAKFILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFG+G+   N     T TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYAKKHQAKGNGFGFGMVNPNDPHSVTRTLSARYYKDGAEI 379


>gi|295098276|emb|CBK87366.1| DNA-methyltransferase (dcm) [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 477

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F       +    +P + D+LE  +D K  ++  
Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKGDFTLRDLPSLYPARRPTVADLLEPAVDAKFILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFG+G+       + T TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYAKKHQAKGNGFGFGMVNPLNPDSVTRTLSARYYKDGAEI 379


>gi|308126237|ref|ZP_05908633.2| DNA (cytosine-5-)-methyltransferase [Vibrio parahaemolyticus
           AQ4037]
 gi|308107574|gb|EFO45114.1| DNA (cytosine-5-)-methyltransferase [Vibrio parahaemolyticus
           AQ4037]
          Length = 426

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 8/108 (7%)

Query: 1   MKACDFGVPQRRERLYIIDF-------LNPSVEFKFPTPLGIKPRLGDILE-EHIDDKST 52
           ++A DFG PQ RER+Y++ F       L+ +  F+FP P     ++GDILE     D  T
Sbjct: 248 LRAADFGAPQNRERIYLVGFDKDYFGDLDFNSIFQFPEPTMKPTKVGDILETSDYVDSFT 307

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           IS+K+W  HQKRK  +K  G GFG+ L    +  TNT+SARYYKDGSE
Sbjct: 308 ISDKIWASHQKRKAGHKNKGNGFGFTLVNSETKYTNTISARYYKDGSE 355


>gi|133756232|ref|YP_001096382.1| DNA cytosine methylase [Escherichia coli]
 gi|110084067|gb|ABG49221.1| hypothetical protein [Escherichia coli]
          Length = 566

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 367 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 425

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 426 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 472


>gi|53714966|ref|YP_100958.1| C-5 cytosine-specific DNA-methylase [Bacteroides fragilis YCH46]
 gi|52217831|dbj|BAD50424.1| C-5 cytosine-specific DNA-methylase [Bacteroides fragilis YCH46]
          Length = 431

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 55/98 (56%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+ I+ F         +F FP        + +IL+  ID K T+S+KLW   Q 
Sbjct: 270 VPQHRERIMIVGFNQDVFHGKEQFAFPEQKQSTRSIKEILDPDIDGKYTLSDKLWSYLQN 329

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             E ++  G GFG+G+   N   + TLSARYYKDGSEI
Sbjct: 330 YAEKHRAKGNGFGFGMVDLN-GISRTLSARYYKDGSEI 366


>gi|311279100|ref|YP_003941331.1| DNA-cytosine methyltransferase [Enterobacter cloacae SCF1]
 gi|308748295|gb|ADO48047.1| DNA-cytosine methyltransferase [Enterobacter cloacae SCF1]
          Length = 492

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F      G+    +P  G++LE  +D K  ++  
Sbjct: 290 RHF-LPQHRERIVLVGFRRDLNLHQGFSLRALPGLYPAQRPTFGELLEPTVDAKFILTPV 348

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYGL       +   TLSARYYKDG+EI
Sbjct: 349 LWKYLYRYAKKHQARGNGFGYGLVDPTNPDSVARTLSARYYKDGAEI 395


>gi|297622183|ref|YP_003675732.1| EcoRII cytosine-methyltransferase [Klebsiella oxytoca KOX105]
 gi|296492002|gb|ADH29504.1| EcoRII cytosine-methyltransferase [Klebsiella oxytoca KOX105]
          Length = 491

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 292 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 350

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 351 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397


>gi|165938005|ref|ZP_02226565.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165914028|gb|EDR32645.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Yersinia pestis biovar Orientalis
           str. IP275]
          Length = 282

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 83  KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 141

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 142 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 188


>gi|323486195|ref|ZP_08091524.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14163]
 gi|323400521|gb|EGA92890.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14163]
          Length = 382

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 7/106 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP----SVEFKFP-TPLGIKPRLGDILEEHIDDKSTISN 55
           +   +F VPQ RER+ I+ F        ++F F  TP   KP + DIL++ +D+K T+S+
Sbjct: 204 LDGQNF-VPQHRERIIIVGFDRERYGQDIKFDFEITPAIPKPVMKDILDKKVDEKYTLSD 262

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW   Q     +K AG GFGYG+       + T+SARYYKDGSEI
Sbjct: 263 KLWIYLQSYAAKHKAAGNGFGYGI-APLDGVSRTISARYYKDGSEI 307


>gi|296538000|gb|ADH30019.1| EcoRII cytosine methylase [Escherichia coli O25b:H4 str. EC958]
          Length = 477

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|160431610|ref|YP_001551777.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Dublin]
 gi|298206539|ref|YP_003717476.1| EcoRII modification enzyme [Escherichia coli]
 gi|159885479|dbj|BAF93082.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Dublin]
 gi|296537944|gb|ADH29964.1| EcoRII modification enzyme [Escherichia coli O25b:H4 str. EC958]
          Length = 477

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|113706802|ref|YP_724464.1| DNA cytosine methylase [Escherichia coli]
 gi|190576899|ref|YP_001966231.1| M.EcoRII DNA methylase [Klebsiella pneumoniae]
 gi|194433606|ref|ZP_03065883.1| modification methylase EcoRII [Shigella dysenteriae 1012]
 gi|209901141|ref|YP_002286923.1| DNA cytosine methylase [Klebsiella pneumoniae]
 gi|209901236|ref|YP_002287017.1| DNA cytosine methylase [Klebsiella pneumoniae]
 gi|215528089|ref|YP_002332862.1| EcoRII cytosine methylase [Klebsiella pneumoniae]
 gi|302141639|ref|YP_003813098.1| EcoRII methylase [Klebsiella pneumoniae]
 gi|127448|sp|P05101|MTE2_ECOLX RecName: Full=Modification methylase EcoRII; Short=M.EcoRII;
           AltName: Full=Cytosine-specific methyltransferase EcoRII
 gi|41317|emb|CAA28725.1| unnamed protein product [Escherichia coli HB101]
 gi|109390538|gb|ABG33840.1| EcoRII modification enzyme [Escherichia coli]
 gi|110264483|gb|ABG56846.1| M.EcoRII DNA methylase [Klebsiella pneumoniae]
 gi|165928612|gb|ABY74380.1| EcoRII cytosine methylase [Klebsiella pneumoniae]
 gi|194418198|gb|EDX34290.1| modification methylase EcoRII [Shigella dysenteriae 1012]
 gi|197092209|gb|ACH42172.1| EcoRII cytosine methylase [Klebsiella pneumoniae]
 gi|209574187|gb|ACI63075.1| modification methylase [Klebsiella pneumoniae]
 gi|209574298|gb|ACI63184.1| modification methylase [Klebsiella pneumoniae]
 gi|296033904|gb|ADG84867.1| EcoRII methylase [Klebsiella pneumoniae]
          Length = 477

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|283785730|ref|YP_003365595.1| DNA-cytosine methyltransferase [Citrobacter rodentium ICC168]
 gi|282949184|emb|CBG88792.1| DNA-cytosine methyltransferase [Citrobacter rodentium ICC168]
          Length = 477

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 9/105 (8%)

Query: 6   FGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58
           + +PQ RER+ ++ F    N   +F            +  L ++LE  ++ K  ++  LW
Sbjct: 275 YFLPQHRERIVLVGFRRDLNLKGDFTLRDISTRYPQRRTTLAELLEPVVEAKYVLTPVLW 334

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +   +  + ++  G GFGYG+   +     T TLSARYYKDG+EI
Sbjct: 335 KYLYRYAKKHQAKGNGFGYGMVSPSDPNSVTRTLSARYYKDGAEI 379


>gi|134044844|ref|YP_001102126.1| cytosine-specific methyltransferase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|133905378|gb|ABO42140.1| cytosine-specific methyltransferase [Yersinia pestis biovar
           Orientalis str. IP275]
          Length = 274

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 75  KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 133

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 134 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 180


>gi|62180565|ref|YP_216982.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62128198|gb|AAX65901.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322715041|gb|EFZ06612.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 476

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|218695565|ref|YP_002403232.1| DNA cytosine methylase [Escherichia coli 55989]
 gi|256022383|ref|ZP_05436248.1| DNA cytosine methylase [Escherichia sp. 4_1_40B]
 gi|218352297|emb|CAU98056.1| DNA cytosine methylase [Escherichia coli 55989]
 gi|323972739|gb|EGB67939.1| DNA-cytosine methyltransferase [Escherichia coli TA007]
 gi|332343686|gb|AEE57020.1| DNA-cytosine methyltransferase [Escherichia coli UMNK88]
          Length = 472

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F      G  P     L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|238787820|ref|ZP_04631617.1| Modification methylase EcoRII [Yersinia frederiksenii ATCC 33641]
 gi|238724163|gb|EEQ15806.1| Modification methylase EcoRII [Yersinia frederiksenii ATCC 33641]
          Length = 475

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
            +F +PQ RER+ ++ F    N   +F            +P  G++LE  + DK  ++  
Sbjct: 278 KNF-LPQHRERIVLVGFRKDLNIDKDFTLKDINKFFPEKRPEFGELLESVVADKYILTPH 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LW+      + ++  G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 337 LWKYLYNYAKKHQAKGNGFGFGLVDPTNSESVARTLSARYHKDGSEI 383


>gi|301029418|ref|ZP_07192512.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1]
 gi|299877722|gb|EFI85933.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F      G  P     L  +L+  ++ K  ++  
Sbjct: 273 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 331

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 332 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378


>gi|161505003|ref|YP_001572115.1| DNA cytosine methylase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160866350|gb|ABX22973.1| hypothetical protein SARI_03133 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 474

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
            +F +PQ RER+ ++ F    N    F            +P  G +L+  +D K  +S K
Sbjct: 278 KNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIHKFYPEKRPTFGQLLDPAVDSKYILSPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|168462467|ref|ZP_02696398.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194443436|ref|YP_002041256.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|238912436|ref|ZP_04656273.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|194402099|gb|ACF62321.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|195634356|gb|EDX52708.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|200390041|ref|ZP_03216652.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199602486|gb|EDZ01032.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|168239231|ref|ZP_02664289.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194734985|ref|YP_002115026.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|204931362|ref|ZP_03222061.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|194710487|gb|ACF89708.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288080|gb|EDY27467.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|204319845|gb|EDZ05054.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|167552776|ref|ZP_02346527.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205322616|gb|EDZ10455.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|322616984|gb|EFY13892.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322618223|gb|EFY15115.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322625894|gb|EFY22713.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626346|gb|EFY23156.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322632761|gb|EFY29506.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322639103|gb|EFY35796.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322640419|gb|EFY37075.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322647220|gb|EFY43719.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322648528|gb|EFY44979.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655540|gb|EFY51848.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322660318|gb|EFY56556.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662999|gb|EFY59206.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322668184|gb|EFY64343.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322674057|gb|EFY70151.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675591|gb|EFY71665.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682998|gb|EFY79014.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686692|gb|EFY82670.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323195420|gb|EFZ80600.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323198052|gb|EFZ83169.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323204476|gb|EFZ89482.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207566|gb|EFZ92514.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323210995|gb|EFZ95855.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323217551|gb|EGA02270.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323226697|gb|EGA10894.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231573|gb|EGA15686.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323236016|gb|EGA20095.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240586|gb|EGA24629.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245478|gb|EGA29478.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323247596|gb|EGA31547.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323254424|gb|EGA38240.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257764|gb|EGA41444.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323262129|gb|EGA45692.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323266252|gb|EGA49742.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323270729|gb|EGA54168.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPGSVARTLSARYYKDGAEI 378


>gi|161613440|ref|YP_001587405.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|205352316|ref|YP_002226117.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207856496|ref|YP_002243147.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|161362804|gb|ABX66572.1| hypothetical protein SPAB_01156 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205272097|emb|CAR36949.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206708299|emb|CAR32602.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326627365|gb|EGE33708.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|168259722|ref|ZP_02681695.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|205351069|gb|EDZ37700.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNISRCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|198242597|ref|YP_002215094.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|197937113|gb|ACH74446.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326622842|gb|EGE29187.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNISRCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|259909642|ref|YP_002649998.1| DNA cytosine methylase [Erwinia pyrifoliae Ep1/96]
 gi|224965264|emb|CAX56796.1| Cytosine-specific methyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|261863687|gb|ACY01298.1| unknown [Erwinia pyrifoliae]
 gi|283479721|emb|CAY75637.1| DNA cytosine methylase [Erwinia pyrifoliae DSM 12163]
          Length = 473

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
            +F +PQ RER+ ++ F    N    F            +P  G +LE+ +D K  ++ +
Sbjct: 278 KNF-LPQHRERIVLVGFRRDLNIHQNFTLSNISRYFPDKRPEFGSLLEKTVDSKYILTPR 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPTNSGSVARTLSARYHKDGSEI 383


>gi|197251440|ref|YP_002146032.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197215143|gb|ACH52540.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|157147667|ref|YP_001454986.1| DNA cytosine methylase [Citrobacter koseri ATCC BAA-895]
 gi|157084872|gb|ABV14550.1| hypothetical protein CKO_03470 [Citrobacter koseri ATCC BAA-895]
          Length = 474

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
            +F +PQ RER+ ++ F    N    F            +P  G +L+  +D K  +S K
Sbjct: 278 KNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIHKFYPEKRPTFGQLLDPAVDSKYILSPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|167035739|ref|YP_001670970.1| DNA cytosine methylase [Pseudomonas putida GB-1]
 gi|166862227|gb|ABZ00635.1| DNA-cytosine methyltransferase [Pseudomonas putida GB-1]
          Length = 447

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/103 (40%), Positives = 56/103 (54%), Gaps = 8/103 (7%)

Query: 6   FGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58
           +  PQ RER+ ++ F         F            +P LGDIL+E +DDK  ++ KLW
Sbjct: 259 YFTPQHRERIVLVGFRKDLGVHSGFTLKDIAELFPKKRPALGDILDEKVDDKYILTPKLW 318

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +        +K  G GFG+GL  + S+ T TLSARYYKDGSEI
Sbjct: 319 QYLFNYAIKHKAKGNGFGFGLVGK-SSVTRTLSARYYKDGSEI 360


>gi|56413096|ref|YP_150171.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197362022|ref|YP_002141659.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56127353|gb|AAV76859.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197093499|emb|CAR58960.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|16765328|ref|NP_460943.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167993566|ref|ZP_02574660.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|16420526|gb|AAL20902.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|205328427|gb|EDZ15191.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261247157|emb|CBG24980.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993981|gb|ACY88866.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301158505|emb|CBW18015.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912981|dbj|BAJ36955.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321224636|gb|EFX49699.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323130270|gb|ADX17700.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332988880|gb|AEF07863.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|82776352|ref|YP_402701.1| DNA cytosine methylase [Shigella dysenteriae Sd197]
 gi|309789422|ref|ZP_07684012.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1617]
 gi|81240500|gb|ABB61210.1| DNA cytosine methylase [Shigella dysenteriae Sd197]
 gi|308922816|gb|EFP68333.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1617]
          Length = 472

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F      G  P     L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|224583511|ref|YP_002637309.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224468038|gb|ACN45868.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 476

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|118614638|ref|YP_908421.1| DNA methyltrasferase [Photobacterium damselae subsp. piscicida]
 gi|118596729|dbj|BAF38033.1| DNA methyltrasferase [Photobacterium damselae subsp. piscicida]
          Length = 266

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 67  KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 125

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 126 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 172


>gi|168244842|ref|ZP_02669774.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194449372|ref|YP_002046042.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194407676|gb|ACF67895.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205336375|gb|EDZ23139.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 476

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|168234164|ref|ZP_02659222.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168821682|ref|ZP_02833682.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194470868|ref|ZP_03076852.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197263635|ref|ZP_03163709.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|194457232|gb|EDX46071.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197241890|gb|EDY24510.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205331847|gb|EDZ18611.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205341769|gb|EDZ28533.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320085391|emb|CBY95172.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 476

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|16760934|ref|NP_456551.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29141374|ref|NP_804716.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|213424982|ref|ZP_03357732.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|289829483|ref|ZP_06547095.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|25286126|pir||AH0754 site-specific DNA-methyltransferase (cytosine-specific) (EC
           2.1.1.73) - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16503231|emb|CAD05739.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137001|gb|AAO68565.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 476

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|193071315|ref|ZP_03052233.1| DNA-cytosine methyltransferase [Escherichia coli E110019]
 gi|331683510|ref|ZP_08384111.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299]
 gi|192955357|gb|EDV85842.1| DNA-cytosine methyltransferase [Escherichia coli E110019]
 gi|331079725|gb|EGI50922.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299]
          Length = 472

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F      G  P     L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|188494720|ref|ZP_03001990.1| DNA-cytosine methyltransferase [Escherichia coli 53638]
 gi|188489919|gb|EDU65022.1| DNA-cytosine methyltransferase [Escherichia coli 53638]
          Length = 472

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F      G  P     L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDINLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300899219|ref|ZP_07117494.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1]
 gi|300357175|gb|EFJ73045.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1]
          Length = 477

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F      G  P     L  +L+  ++ K  ++  
Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|323186716|gb|EFZ72038.1| DNA-cytosine methyltransferase [Escherichia coli RN587/1]
          Length = 472

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|215487159|ref|YP_002329590.1| DNA cytosine methylase [Escherichia coli O127:H6 str. E2348/69]
 gi|312967158|ref|ZP_07781376.1| DNA-cytosine methyltransferase [Escherichia coli 2362-75]
 gi|215265231|emb|CAS09622.1| DNA cytosine methylase [Escherichia coli O127:H6 str. E2348/69]
 gi|312288622|gb|EFR16524.1| DNA-cytosine methyltransferase [Escherichia coli 2362-75]
          Length = 472

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|152970972|ref|YP_001336081.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150955821|gb|ABR77851.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 477

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F         F           ++P  G++LE  +D K  ++  
Sbjct: 274 RHF-LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYPAVRPTFGELLEPTVDSKFILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379


>gi|331643338|ref|ZP_08344469.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli H736]
 gi|331036809|gb|EGI09033.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli H736]
          Length = 491

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 292 KHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYILTPK 350

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 351 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397


>gi|288934555|ref|YP_003438614.1| DNA-cytosine methyltransferase [Klebsiella variicola At-22]
 gi|288889264|gb|ADC57582.1| DNA-cytosine methyltransferase [Klebsiella variicola At-22]
          Length = 466

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F         F           ++P  G++LE  +D K  ++  
Sbjct: 263 RHF-LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTVDAKFILTPV 321

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 322 LWKYLYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 368


>gi|218701133|ref|YP_002408762.1| DNA cytosine methylase [Escherichia coli IAI39]
 gi|218371119|emb|CAR18947.1| Modification methylase EcoRII (M.EcoRII) (Cytosine-specific
           methyltransferase EcoRII) [Escherichia coli IAI39]
          Length = 491

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 292 KHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYILTPK 350

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 351 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397


>gi|206577074|ref|YP_002237693.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342]
 gi|206566132|gb|ACI07908.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342]
          Length = 477

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F         F           ++P  G++LE  +D K  ++  
Sbjct: 274 RHF-LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTVDAKFILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 379


>gi|194430436|ref|ZP_03062919.1| DNA-cytosine methyltransferase [Escherichia coli B171]
 gi|194411515|gb|EDX27854.1| DNA-cytosine methyltransferase [Escherichia coli B171]
          Length = 472

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQCVTRTLSARYYKDGAEI 374


>gi|238895488|ref|YP_002920223.1| DNA cytosine methylase [Klebsiella pneumoniae NTUH-K2044]
 gi|330000908|ref|ZP_08303852.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. MS 92-3]
 gi|238547805|dbj|BAH64156.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|328537840|gb|EGF64032.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. MS 92-3]
          Length = 477

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F         F           ++P  G++LE  +D K  ++  
Sbjct: 274 RHF-LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYPAVRPTFGELLEPTVDAKFILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379


>gi|323977859|gb|EGB72945.1| DNA-cytosine methyltransferase [Escherichia coli TW10509]
          Length = 472

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLREISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323968376|gb|EGB63783.1| DNA-cytosine methyltransferase [Escherichia coli M863]
 gi|327253092|gb|EGE64746.1| DNA-cytosine methyltransferase [Escherichia coli STEC_7v]
          Length = 472

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLREISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300931174|ref|ZP_07146520.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1]
 gi|300461007|gb|EFK24500.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1]
          Length = 477

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|301018179|ref|ZP_07182696.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1]
 gi|300399832|gb|EFJ83370.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1]
          Length = 472

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|309795932|ref|ZP_07690345.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7]
 gi|308120382|gb|EFO57644.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7]
          Length = 472

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|168234623|ref|ZP_02659681.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194736513|ref|YP_002117411.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|194712015|gb|ACF91236.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197291717|gb|EDY31067.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 474

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
            +F +PQ RER+ ++ F    N    F            +P  G +L+  +D K  +S K
Sbjct: 278 KNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIDKFYPEKRPTFGQLLDSVVDSKYILSPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|161617789|ref|YP_001591754.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|161367153|gb|ABX70921.1| hypothetical protein SPAB_05653 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 474

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
            +F +PQ RER+ ++ F    N    F            +P  G +L+  +D K  +S K
Sbjct: 278 KNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIDKFYPEKRPTFGQLLDSVVDSKYILSPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|323960520|gb|EGB56149.1| DNA-cytosine methyltransferase [Escherichia coli H489]
          Length = 477

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYILTPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|307139342|ref|ZP_07498698.1| DNA cytosine methylase [Escherichia coli H736]
          Length = 477

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYILTPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|291283137|ref|YP_003499955.1| DNA-cytosine methyltransferase [Escherichia coli O55:H7 str.
           CB9615]
 gi|209766674|gb|ACI81649.1| DNA cytosine methylase [Escherichia coli]
 gi|290763010|gb|ADD56971.1| DNA-cytosine methyltransferase [Escherichia coli O55:H7 str.
           CB9615]
          Length = 472

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300994233|ref|ZP_07180788.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1]
 gi|300304943|gb|EFJ59463.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1]
          Length = 477

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|74312499|ref|YP_310918.1| DNA cytosine methylase [Shigella sonnei Ss046]
 gi|73855976|gb|AAZ88683.1| DNA cytosine methylase [Shigella sonnei Ss046]
 gi|323168918|gb|EFZ54598.1| DNA-cytosine methyltransferase [Shigella sonnei 53G]
          Length = 472

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|260855934|ref|YP_003229825.1| DNA cytosine methylase [Escherichia coli O26:H11 str. 11368]
 gi|300822269|ref|ZP_07102410.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7]
 gi|257754583|dbj|BAI26085.1| DNA cytosine methylase [Escherichia coli O26:H11 str. 11368]
 gi|300525152|gb|EFK46221.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7]
 gi|309702249|emb|CBJ01566.1| DNA-cytosine methyltransferase [Escherichia coli ETEC H10407]
 gi|323937230|gb|EGB33510.1| DNA-cytosine methyltransferase [Escherichia coli E1520]
          Length = 472

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|24113334|ref|NP_707844.1| DNA cytosine methylase [Shigella flexneri 2a str. 301]
 gi|30063396|ref|NP_837567.1| DNA cytosine methylase [Shigella flexneri 2a str. 2457T]
 gi|110805927|ref|YP_689447.1| DNA cytosine methylase [Shigella flexneri 5 str. 8401]
 gi|24052347|gb|AAN43551.1| DNA cytosine methylase [Shigella flexneri 2a str. 301]
 gi|30041648|gb|AAP17376.1| DNA cytosine methylase [Shigella flexneri 2a str. 2457T]
 gi|110615475|gb|ABF04142.1| DNA cytosine methylase [Shigella flexneri 5 str. 8401]
 gi|281601397|gb|ADA74381.1| Cytosine-specific methyltransferase [Shigella flexneri 2002017]
 gi|313650184|gb|EFS14597.1| DNA-cytosine methyltransferase [Shigella flexneri 2a str. 2457T]
 gi|332756118|gb|EGJ86471.1| DNA-cytosine methyltransferase [Shigella flexneri 4343-70]
 gi|332757312|gb|EGJ87649.1| DNA-cytosine methyltransferase [Shigella flexneri 2747-71]
 gi|332757528|gb|EGJ87863.1| DNA-cytosine methyltransferase [Shigella flexneri K-671]
 gi|332766700|gb|EGJ96904.1| cytosine-specific methyltransferase [Shigella flexneri 2930-71]
 gi|333003060|gb|EGK22614.1| DNA-cytosine methyltransferase [Shigella flexneri VA-6]
 gi|333003307|gb|EGK22853.1| DNA-cytosine methyltransferase [Shigella flexneri K-218]
 gi|333004068|gb|EGK23602.1| DNA-cytosine methyltransferase [Shigella flexneri K-272]
 gi|333017687|gb|EGK36999.1| DNA-cytosine methyltransferase [Shigella flexneri K-304]
 gi|333017841|gb|EGK37148.1| DNA-cytosine methyltransferase [Shigella flexneri K-227]
          Length = 472

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|237732007|ref|ZP_04562488.1| DNA cytosine methylase [Citrobacter sp. 30_2]
 gi|226907546|gb|EEH93464.1| DNA cytosine methylase [Citrobacter sp. 30_2]
          Length = 476

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +  L ++LE  +D K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKSDFTLRDIVTRYPQRRTTLAELLEPTVDAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ +     + T TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPGNPDSVTRTLSARYYKDGAEI 378


>gi|330911766|gb|EGH40276.1| DNA-cytosine methyltransferase [Escherichia coli AA86]
          Length = 472

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|320641809|gb|EFX11197.1| DNA cytosine methylase [Escherichia coli O157:H7 str. G5101]
          Length = 472

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|91211180|ref|YP_541166.1| DNA cytosine methylase [Escherichia coli UTI89]
 gi|117624099|ref|YP_853012.1| DNA cytosine methylase [Escherichia coli APEC O1]
 gi|218558817|ref|YP_002391730.1| DNA cytosine methylase [Escherichia coli S88]
 gi|91072754|gb|ABE07635.1| DNA cytosine methylase [Escherichia coli UTI89]
 gi|115513223|gb|ABJ01298.1| DNA cytosine methylase [Escherichia coli APEC O1]
 gi|218365586|emb|CAR03313.1| DNA cytosine methylase [Escherichia coli S88]
 gi|294492656|gb|ADE91412.1| DNA-cytosine methyltransferase [Escherichia coli IHE3034]
 gi|307626564|gb|ADN70868.1| DNA cytosine methylase [Escherichia coli UM146]
 gi|323952452|gb|EGB48325.1| DNA-cytosine methyltransferase [Escherichia coli H252]
          Length = 472

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|15802395|ref|NP_288421.1| DNA cytosine methylase [Escherichia coli O157:H7 EDL933]
 gi|15831953|ref|NP_310726.1| DNA cytosine methylase [Escherichia coli O157:H7 str. Sakai]
 gi|16129907|ref|NP_416470.1| DNA cytosine methyltransferase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89108792|ref|AP_002572.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. W3110]
 gi|168752207|ref|ZP_02777229.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758275|ref|ZP_02783282.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168771615|ref|ZP_02796622.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777717|ref|ZP_02802724.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783359|ref|ZP_02808366.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789321|ref|ZP_02814328.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC869]
 gi|168801737|ref|ZP_02826744.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC508]
 gi|170081604|ref|YP_001730924.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. DH10B]
 gi|195939267|ref|ZP_03084649.1| DNA cytosine methylase [Escherichia coli O157:H7 str. EC4024]
 gi|208810340|ref|ZP_03252216.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816602|ref|ZP_03257722.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821263|ref|ZP_03261583.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400193|ref|YP_002271076.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209919382|ref|YP_002293466.1| DNA cytosine methylase [Escherichia coli SE11]
 gi|217328629|ref|ZP_03444710.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218689956|ref|YP_002398168.1| DNA cytosine methylase [Escherichia coli ED1a]
 gi|238901165|ref|YP_002926961.1| DNA cytosine methylase [Escherichia coli BW2952]
 gi|253773091|ref|YP_003035922.1| DNA cytosine methylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254793611|ref|YP_003078448.1| DNA cytosine methylase [Escherichia coli O157:H7 str. TW14359]
 gi|256017846|ref|ZP_05431711.1| DNA cytosine methylase [Shigella sp. D9]
 gi|261227545|ref|ZP_05941826.1| DNA cytosine methylase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254631|ref|ZP_05947164.1| DNA cytosine methylase [Escherichia coli O157:H7 str. FRIK966]
 gi|293415271|ref|ZP_06657914.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli B185]
 gi|300818618|ref|ZP_07098826.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1]
 gi|300920181|ref|ZP_07136630.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1]
 gi|301327749|ref|ZP_07220953.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1]
 gi|301644580|ref|ZP_07244570.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1]
 gi|307312454|ref|ZP_07592088.1| DNA-cytosine methyltransferase [Escherichia coli W]
 gi|312973821|ref|ZP_07787993.1| DNA-cytosine methyltransferase [Escherichia coli 1827-70]
 gi|332278872|ref|ZP_08391285.1| DNA cytosine methylase [Shigella sp. D9]
 gi|83305674|sp|P0AEE0|DCM_ECO57 RecName: Full=DNA-cytosine methyltransferase
 gi|83305675|sp|P0AED9|DCM_ECOLI RecName: Full=DNA-cytosine methyltransferase; AltName:
           Full=M.EcoDcm
 gi|12516070|gb|AAG56975.1|AE005418_3 DNA cytosine methylase [Escherichia coli O157:H7 str. EDL933]
 gi|41239|emb|CAA31705.1| unnamed protein product [Escherichia coli K-12]
 gi|145719|gb|AAA03723.1| DNA cytosine methylase [Escherichia coli]
 gi|1736630|dbj|BAA15788.1| DNA cytosine methylase [Escherichia coli str. K12 substr. W3110]
 gi|1788271|gb|AAC75027.1| DNA cytosine methyltransferase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13362167|dbj|BAB36122.1| DNA cytosine methylase [Escherichia coli O157:H7 str. Sakai]
 gi|169889439|gb|ACB03146.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. DH10B]
 gi|187767102|gb|EDU30946.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188013903|gb|EDU52025.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999305|gb|EDU68291.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354901|gb|EDU73320.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359668|gb|EDU78087.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189371047|gb|EDU89463.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC869]
 gi|189376137|gb|EDU94553.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC508]
 gi|208724856|gb|EDZ74563.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208730945|gb|EDZ79634.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741386|gb|EDZ89068.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161593|gb|ACI39026.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209766668|gb|ACI81646.1| DNA cytosine methylase [Escherichia coli]
 gi|209766670|gb|ACI81647.1| DNA cytosine methylase [Escherichia coli]
 gi|209766672|gb|ACI81648.1| DNA cytosine methylase [Escherichia coli]
 gi|209766676|gb|ACI81650.1| DNA cytosine methylase [Escherichia coli]
 gi|209912641|dbj|BAG77715.1| DNA cytosine methylase [Escherichia coli SE11]
 gi|217317976|gb|EEC26403.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218427520|emb|CAR08415.2| DNA cytosine methylase [Escherichia coli ED1a]
 gi|238860813|gb|ACR62811.1| DNA cytosine methylase [Escherichia coli BW2952]
 gi|253324135|gb|ACT28737.1| DNA-cytosine methyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254593011|gb|ACT72372.1| DNA cytosine methylase [Escherichia coli O157:H7 str. TW14359]
 gi|260448927|gb|ACX39349.1| DNA-cytosine methyltransferase [Escherichia coli DH1]
 gi|291432919|gb|EFF05898.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli B185]
 gi|300412803|gb|EFJ96113.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1]
 gi|300528790|gb|EFK49852.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1]
 gi|300845711|gb|EFK73471.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1]
 gi|301077088|gb|EFK91894.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1]
 gi|306907625|gb|EFN38128.1| DNA-cytosine methyltransferase [Escherichia coli W]
 gi|310332416|gb|EFP99651.1| DNA-cytosine methyltransferase [Escherichia coli 1827-70]
 gi|315061260|gb|ADT75587.1| DNA cytosine methylase [Escherichia coli W]
 gi|315136597|dbj|BAJ43756.1| DNA cytosine methylase [Escherichia coli DH1]
 gi|320191934|gb|EFW66581.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320198651|gb|EFW73251.1| DNA-cytosine methyltransferase [Escherichia coli EC4100B]
 gi|320647167|gb|EFX16000.1| DNA cytosine methylase [Escherichia coli O157:H- str. 493-89]
 gi|320652452|gb|EFX20750.1| DNA cytosine methylase [Escherichia coli O157:H- str. H 2687]
 gi|320658054|gb|EFX25816.1| DNA cytosine methylase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320658625|gb|EFX26319.1| DNA cytosine methylase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668523|gb|EFX35350.1| DNA cytosine methylase [Escherichia coli O157:H7 str. LSU-61]
 gi|323174657|gb|EFZ60277.1| DNA-cytosine methyltransferase [Escherichia coli LT-68]
 gi|323183944|gb|EFZ69331.1| DNA-cytosine methyltransferase [Escherichia coli 1357]
 gi|323378163|gb|ADX50431.1| DNA-cytosine methyltransferase [Escherichia coli KO11]
 gi|323948336|gb|EGB44323.1| DNA-cytosine methyltransferase [Escherichia coli H120]
 gi|326342371|gb|EGD66152.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. 1044]
 gi|326344875|gb|EGD68622.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. 1125]
 gi|332101224|gb|EGJ04570.1| DNA cytosine methylase [Shigella sp. D9]
          Length = 472

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|110642066|ref|YP_669796.1| DNA cytosine methylase [Escherichia coli 536]
 gi|191173268|ref|ZP_03034798.1| DNA-cytosine methyltransferase [Escherichia coli F11]
 gi|110343658|gb|ABG69895.1| DNA-cytosine methyltransferase [Escherichia coli 536]
 gi|190906385|gb|EDV65994.1| DNA-cytosine methyltransferase [Escherichia coli F11]
 gi|222033699|emb|CAP76440.1| DNA-cytosine methyltransferase [Escherichia coli LF82]
 gi|312946553|gb|ADR27380.1| DNA cytosine methylase [Escherichia coli O83:H1 str. NRG 857C]
 gi|324013473|gb|EGB82692.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 60-1]
          Length = 472

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|325499566|gb|EGC97425.1| DNA cytosine methylase [Escherichia fergusonii ECD227]
          Length = 473

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G +LE  +D K  +S K
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQRPLFGQLLESSVDSKYILSPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           LW+      + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 337 LWQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 383


>gi|324112381|gb|EGC06359.1| DNA-cytosine methyltransferase [Escherichia fergusonii B253]
          Length = 473

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G +LE  +D K  +S K
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQRPLFGQLLESSVDSKYILSPK 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           LW+      + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 337 LWQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 383


>gi|315296465|gb|EFU55762.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 16-3]
          Length = 476

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 273 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 331

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 332 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378


>gi|315286667|gb|EFU46100.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 110-3]
          Length = 475

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 272 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 330

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 331 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 377


>gi|170681403|ref|YP_001743285.1| DNA cytosine methylase [Escherichia coli SMS-3-5]
 gi|170519121|gb|ACB17299.1| DNA-cytosine methyltransferase [Escherichia coli SMS-3-5]
 gi|324119009|gb|EGC12898.1| DNA-cytosine methyltransferase [Escherichia coli E1167]
          Length = 472

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|191169235|ref|ZP_03030988.1| DNA-cytosine methyltransferase [Escherichia coli B7A]
 gi|190900713|gb|EDV60509.1| DNA-cytosine methyltransferase [Escherichia coli B7A]
          Length = 472

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|331668651|ref|ZP_08369499.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271]
 gi|331063845|gb|EGI35756.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271]
          Length = 458

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 255 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 313

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 314 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 360


>gi|300975476|ref|ZP_07173024.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1]
 gi|300410366|gb|EFJ93904.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1]
          Length = 472

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|315290247|gb|EFU49625.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 153-1]
          Length = 478

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 275 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 333

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 334 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 380


>gi|300940416|ref|ZP_07155001.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1]
 gi|300454810|gb|EFK18303.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1]
          Length = 476

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 273 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 331

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 332 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378


>gi|300923873|ref|ZP_07139889.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1]
 gi|300419870|gb|EFK03181.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1]
          Length = 477

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|26248232|ref|NP_754272.1| DNA cytosine methylase [Escherichia coli CFT073]
 gi|227885611|ref|ZP_04003416.1| DNA cytosine methylase [Escherichia coli 83972]
 gi|237705920|ref|ZP_04536401.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|331647554|ref|ZP_08348646.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605]
 gi|26108636|gb|AAN80839.1|AE016762_92 DNA-cytosine methyltransferase [Escherichia coli CFT073]
 gi|226900677|gb|EEH86936.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|227837184|gb|EEJ47650.1| DNA cytosine methylase [Escherichia coli 83972]
 gi|281179022|dbj|BAI55352.1| DNA cytosine methylase [Escherichia coli SE15]
 gi|307553973|gb|ADN46748.1| DNA cytosine methylase [Escherichia coli ABU 83972]
 gi|320194327|gb|EFW68958.1| DNA-cytosine methyltransferase [Escherichia coli WV_060327]
 gi|323956356|gb|EGB52099.1| DNA-cytosine methyltransferase [Escherichia coli H263]
 gi|324005878|gb|EGB75097.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 57-2]
 gi|331043278|gb|EGI15416.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323962004|gb|EGB57603.1| DNA-cytosine methyltransferase [Escherichia coli H489]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|284921868|emb|CBG34943.1| DNA-cytosine methyltransferase [Escherichia coli 042]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323191533|gb|EFZ76794.1| modification methylase EcoRII [Escherichia coli RN587/1]
          Length = 474

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +P  G++L+ ++DDK  ++ +
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHNVDDKYILTPR 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL       +   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|331663456|ref|ZP_08364366.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143]
 gi|331059255|gb|EGI31232.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|293410317|ref|ZP_06653893.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291470785|gb|EFF13269.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|218699478|ref|YP_002407107.1| DNA cytosine methylase [Escherichia coli IAI39]
 gi|218369464|emb|CAR17229.1| DNA cytosine methylase [Escherichia coli IAI39]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|218551294|ref|YP_002385086.1| DNA cytosine methylase [Escherichia fergusonii ATCC 35469]
 gi|218358836|emb|CAQ91493.1| DNA modification methylase [Escherichia fergusonii ATCC 35469]
          Length = 485

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G +LE  +D K  +S K
Sbjct: 290 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQRPLFGQLLESSVDSKYILSPK 348

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           LW+      + +   G GFG+GL   N  ++   TLSARY+KDGSEI
Sbjct: 349 LWQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 395


>gi|170019707|ref|YP_001724661.1| DNA cytosine methylase [Escherichia coli ATCC 8739]
 gi|169754635|gb|ACA77334.1| DNA-cytosine methyltransferase [Escherichia coli ATCC 8739]
 gi|323940380|gb|EGB36571.1| DNA-cytosine methyltransferase [Escherichia coli E482]
 gi|332093084|gb|EGI98148.1| DNA-cytosine methyltransferase [Shigella boydii 5216-82]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|331653374|ref|ZP_08354379.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718]
 gi|331049472|gb|EGI21544.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|301050676|ref|ZP_07197538.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1]
 gi|300297633|gb|EFJ54018.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1]
          Length = 477

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|82543581|ref|YP_407528.1| DNA cytosine methylase [Shigella boydii Sb227]
 gi|81244992|gb|ABB65700.1| DNA cytosine methylase [Shigella boydii Sb227]
 gi|332096894|gb|EGJ01883.1| DNA-cytosine methyltransferase [Shigella boydii 3594-74]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|187732725|ref|YP_001879611.1| DNA cytosine methylase [Shigella boydii CDC 3083-94]
 gi|293446340|ref|ZP_06662762.1| DNA-cytosine methyltransferase [Escherichia coli B088]
 gi|187429717|gb|ACD08991.1| DNA-cytosine methyltransferase [Shigella boydii CDC 3083-94]
 gi|291323170|gb|EFE62598.1| DNA-cytosine methyltransferase [Escherichia coli B088]
 gi|320175451|gb|EFW50550.1| DNA-cytosine methyltransferase [Shigella dysenteriae CDC 74-1112]
 gi|320184499|gb|EFW59303.1| DNA-cytosine methyltransferase [Shigella flexneri CDC 796-83]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|331671799|ref|ZP_08372595.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli TA280]
 gi|331070788|gb|EGI42147.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli TA280]
          Length = 474

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +P  G++L+  +DDK  ++ +
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHDVDDKYILTPR 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL       +   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|324018843|gb|EGB88062.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 117-3]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|307138628|ref|ZP_07497984.1| DNA cytosine methylase [Escherichia coli H736]
 gi|331642581|ref|ZP_08343716.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736]
 gi|331039379|gb|EGI11599.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300956520|ref|ZP_07168803.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1]
 gi|300316661|gb|EFJ66445.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1]
          Length = 477

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 274 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|218554541|ref|YP_002387454.1| DNA cytosine methylase [Escherichia coli IAI1]
 gi|260868553|ref|YP_003234955.1| DNA cytosine methylase [Escherichia coli O111:H- str. 11128]
 gi|218361309|emb|CAQ98893.1| DNA cytosine methylase [Escherichia coli IAI1]
 gi|257764909|dbj|BAI36404.1| DNA cytosine methylase [Escherichia coli O111:H- str. 11128]
 gi|323180787|gb|EFZ66327.1| DNA-cytosine methyltransferase [Escherichia coli 1180]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|193066646|ref|ZP_03047681.1| DNA-cytosine methyltransferase [Escherichia coli E22]
 gi|260844359|ref|YP_003222137.1| DNA cytosine methylase [Escherichia coli O103:H2 str. 12009]
 gi|192925721|gb|EDV80380.1| DNA-cytosine methyltransferase [Escherichia coli E22]
 gi|257759506|dbj|BAI31003.1| DNA cytosine methylase [Escherichia coli O103:H2 str. 12009]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|320182772|gb|EFW57655.1| DNA-cytosine methyltransferase [Shigella boydii ATCC 9905]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|218705454|ref|YP_002412973.1| DNA cytosine methylase [Escherichia coli UMN026]
 gi|293405443|ref|ZP_06649435.1| DNA cytosine methylase [Escherichia coli FVEC1412]
 gi|298381087|ref|ZP_06990686.1| DNA cytosine methylase [Escherichia coli FVEC1302]
 gi|218432551|emb|CAR13444.1| DNA cytosine methylase [Escherichia coli UMN026]
 gi|291427651|gb|EFF00678.1| DNA cytosine methylase [Escherichia coli FVEC1412]
 gi|298278529|gb|EFI20043.1| DNA cytosine methylase [Escherichia coli FVEC1302]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323158561|gb|EFZ44575.1| DNA-cytosine methyltransferase [Escherichia coli E128010]
          Length = 472

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F         P     L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVMLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQCVTRTLSARYYKDGAEI 374


>gi|331645413|ref|ZP_08346517.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli M605]
 gi|331045575|gb|EGI17701.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli M605]
          Length = 474

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +P  G++L+ ++DDK  ++ +
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHNVDDKYILTPR 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL       +   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|300951590|ref|ZP_07165422.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1]
 gi|300449174|gb|EFK12794.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1]
          Length = 478

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 275 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 333

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 334 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 380


>gi|194433657|ref|ZP_03065933.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1012]
 gi|194418086|gb|EDX34179.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1012]
 gi|332095525|gb|EGJ00541.1| DNA-cytosine methyltransferase [Shigella dysenteriae 155-74]
          Length = 472

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDFNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|146312197|ref|YP_001177271.1| DNA cytosine methylase [Enterobacter sp. 638]
 gi|145319073|gb|ABP61220.1| DNA-cytosine methyltransferase [Enterobacter sp. 638]
          Length = 471

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F       +    +P + ++LE   D K  ++  
Sbjct: 268 KHF-LPQHRERIVLVGFRRDLNLKGDFTLRDIPSLYPAHRPSVAELLEPAFDAKFILTPV 326

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFG+G+    +    T TLSARYYKDG+EI
Sbjct: 327 LWKYLYRYAKKHQAKGNGFGFGMVDPRNPHSVTRTLSARYYKDGAEI 373


>gi|157158517|ref|YP_001463262.1| DNA cytosine methylase [Escherichia coli E24377A]
 gi|157080547|gb|ABV20255.1| DNA-cytosine methyltransferase [Escherichia coli E24377A]
          Length = 472

 Score =  153 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDSMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|213581465|ref|ZP_03363291.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
          Length = 295

 Score =  153 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 108 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 167

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 168 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 210


>gi|327254549|gb|EGE66165.1| modification methylase EcoRII [Escherichia coli STEC_7v]
          Length = 474

 Score =  153 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +P  G++L+  +DDK  ++ +
Sbjct: 278 KHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHDVDDKYILTPR 336

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL       +   TLSARY+KDGSEI
Sbjct: 337 LWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|48093754|gb|AAT40239.1| Eco128I DNA methylase [Escherichia coli]
          Length = 332

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++LE  +D K  ++ K
Sbjct: 197 KHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYILTPK 255

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 256 LWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 302


>gi|291085206|ref|ZP_06352388.2| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC
           29220]
 gi|291072321|gb|EFE10430.1| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC
           29220]
          Length = 476

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F         PR    L D+LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLQLKSDFTLRNIATCYPRRRTTLADLLEPTVEAKYVLTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ +       T TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPGNPDCVTRTLSARYYKDGAEI 378


>gi|94501925|ref|ZP_01308434.1| DNA-cytosine methyltransferase [Oceanobacter sp. RED65]
 gi|94425919|gb|EAT10918.1| DNA-cytosine methyltransferase [Oceanobacter sp. RED65]
          Length = 287

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 60/106 (56%), Gaps = 10/106 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKF---PTPLGIKPRLGDILEEHIDDKSTISNKL 57
            +F +PQ RER+ ++ F    N +  F     P P  + P L  +LE+ +D+K  ++ +L
Sbjct: 91  ANF-LPQHRERIVLVGFRKDLNLTNRFTLTNLPKPREV-PSLSSLLEKSVDEKYVLTPRL 148

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           WE   +  + ++  G GFGYGL      SA   TLSARY+KDGSEI
Sbjct: 149 WEYLYEYAKKHQAKGNGFGYGLVDPKNSSAVCRTLSARYHKDGSEI 194


>gi|331673470|ref|ZP_08374238.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280]
 gi|331069668|gb|EGI41055.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280]
          Length = 472

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLG----IKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFSAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|306814216|ref|ZP_07448382.1| DNA cytosine methylase [Escherichia coli NC101]
 gi|305852375|gb|EFM52826.1| DNA cytosine methylase [Escherichia coli NC101]
          Length = 472

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISACFPAQRVTLAQLLDPIVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|238919389|ref|YP_002932904.1| DNA cytosine methylase [Edwardsiella ictaluri 93-146]
 gi|238868958|gb|ACR68669.1| modification methylase [Edwardsiella ictaluri 93-146]
          Length = 471

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            KP  G++LE  +D K  +S K
Sbjct: 276 KHF-LPQHRERIVLVGFRRDLNIHHDFTLQKIQQFYPEKKPTFGELLEPAVDSKYILSPK 334

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           LWE      + +   G GFG+GL    +  +   TLSARY+KDGSEI
Sbjct: 335 LWEYLYNYAKKHAEKGNGFGFGLVDPKNKESIARTLSARYHKDGSEI 381


>gi|213622824|ref|ZP_03375607.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-2068]
          Length = 324

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 124 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 183

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 184 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 226


>gi|331658007|ref|ZP_08358969.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206]
 gi|331056255|gb|EGI28264.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206]
          Length = 472

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPIVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|296282358|ref|ZP_06860356.1| DNA-cytosine methyltransferase [Citromicrobium bathyomarinum JL354]
          Length = 439

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 8/100 (8%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLWEGH 61
           VPQ+RER++I+ F   S       + P  +   P+LG ILE H  +D K T++ +LWE  
Sbjct: 250 VPQKRERIFIVGFREKSAFNLAGLEIPA-VADGPKLGSILEPHDQVDPKYTLTPRLWEYL 308

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q+ ++ ++  G GFGY LF        TLSARY+KDGSEI
Sbjct: 309 QEYRKKHEAKGNGFGYSLFGPGD-VARTLSARYHKDGSEI 347


>gi|163732386|ref|ZP_02139832.1| hypothetical protein RLO149_03007 [Roseobacter litoralis Och 149]
 gi|161394684|gb|EDQ19007.1| hypothetical protein RLO149_03007 [Roseobacter litoralis Och 149]
          Length = 410

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 46/121 (38%), Positives = 58/121 (47%), Gaps = 23/121 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEH----------- 46
           + A  F VPQ RER+ I+ F    V F F     P   + R+ DIL              
Sbjct: 216 IDAAHF-VPQHRERIVIVGFR-EDVPFSFDDVILPPHRERRMRDILHPENGNENPESHFT 273

Query: 47  ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
                 +  K T+S+KLW+  Q     +K  G GFG+GL   +S    TLSARYYKDGSE
Sbjct: 274 LGNDAAVSGKYTLSDKLWKYLQDYAAKHKAKGNGFGFGLVDGDS-IARTLSARYYKDGSE 332

Query: 101 I 101
           I
Sbjct: 333 I 333


>gi|213650730|ref|ZP_03380783.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
          Length = 405

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 205 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 264

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 265 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 307


>gi|260598469|ref|YP_003211040.1| DNA cytosine methylase [Cronobacter turicensis z3032]
 gi|260217646|emb|CBA31957.1| DNA-cytosine methyltransferase [Cronobacter turicensis z3032]
          Length = 450

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGI----KPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F       +    +P  G++L+  +D +  ++  
Sbjct: 249 KHF-LPQHRERIVLVGFRRDLNLHDGFTLRALPELYPARRPAFGELLDPTVDARYVLTPT 307

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 308 LWKYLYRYAQKHQAKGNGFGYGLVDPQNPASVARTLSARYYKDGAEI 354


>gi|156933419|ref|YP_001437335.1| DNA cytosine methylase [Cronobacter sakazakii ATCC BAA-894]
 gi|156531673|gb|ABU76499.1| hypothetical protein ESA_01237 [Cronobacter sakazakii ATCC BAA-894]
          Length = 481

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLG----IKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +P  G++L+  +D +  ++  
Sbjct: 280 KHF-LPQHRERIVLVGFRRSLNLHDGFTLRALPEFYPARRPAFGELLDPTVDARYVLTPT 338

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 339 LWKYLYRYAQKHQAKGNGFGYGLVDPQNPASVARTLSARYYKDGAEI 385


>gi|300904853|ref|ZP_07122678.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1]
 gi|301304244|ref|ZP_07210359.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1]
 gi|300403236|gb|EFJ86774.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1]
 gi|300840501|gb|EFK68261.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1]
 gi|315257206|gb|EFU37174.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 85-1]
          Length = 472

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + +++ G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQVRGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|262043463|ref|ZP_06016586.1| DNA (cytosine-5-)-methyltransferase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039205|gb|EEW40353.1| DNA (cytosine-5-)-methyltransferase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 477

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 51/107 (47%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F         F           + P  G++LE  +D K  ++  
Sbjct: 274 RHF-LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYPAVWPTFGELLEPTVDAKFILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379


>gi|157161430|ref|YP_001458748.1| DNA cytosine methylase [Escherichia coli HS]
 gi|157067110|gb|ABV06365.1| DNA-cytosine methyltransferase [Escherichia coli HS]
          Length = 472

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQTRGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|157368818|ref|YP_001476807.1| DNA cytosine methylase [Serratia proteamaculans 568]
 gi|157320582|gb|ABV39679.1| DNA-cytosine methyltransferase [Serratia proteamaculans 568]
          Length = 491

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPT----PLGIKPRLGDILEEHIDDKSTISNK 56
            +F +PQ RER+ ++ F    N   +F            +P  G++L E +  K  ++  
Sbjct: 294 KNF-LPQHRERIVLVGFRRDLNIHGDFSLKNLSQFFPKKRPSFGELLLEDVAPKYILTEH 352

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           LW+      + ++  G GFG+GL      S+   TLSARY+KDGSEI
Sbjct: 353 LWKYLYNYAKKHQAKGNGFGFGLVNPKNESSVARTLSARYHKDGSEI 399


>gi|170769440|ref|ZP_02903893.1| DNA-cytosine methyltransferase [Escherichia albertii TW07627]
 gi|170121764|gb|EDS90695.1| DNA-cytosine methyltransferase [Escherichia albertii TW07627]
          Length = 472

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N    F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKASFTLRDINQCFPTQRVTLAQLLDPVVEAKYILTPV 327

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300724477|ref|YP_003713798.1| DNA cytosine methylase [Xenorhabdus nematophila ATCC 19061]
 gi|297631015|emb|CBJ91699.1| DNA cytosine methylase [Xenorhabdus nematophila ATCC 19061]
          Length = 476

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPT----PLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N    F            +P L ++L+ ++D K  ++  LW+ 
Sbjct: 281 LPQHRERIVLVGFRRDLNIHQGFTLRNMNQLFPAQRPTLKELLDSNVDKKYILTPALWKY 340

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
                + ++  G GFG+GL F ++      TLSARY+KDGSEI
Sbjct: 341 LYNYAKKHQAKGNGFGFGLVFPDNPNSVARTLSARYHKDGSEI 383


>gi|290508755|ref|ZP_06548126.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. 1_1_55]
 gi|289778149|gb|EFD86146.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. 1_1_55]
          Length = 477

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 51/107 (47%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F         F           ++P  G++LE   D K  ++  
Sbjct: 274 RHF-LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTADAKFILTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 379


>gi|323222338|gb|EGA06720.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
          Length = 259

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 59  LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 118

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 119 LYRYAKKHQARGNGFGYGMVYPDNPGSVARTLSARYYKDGAEI 161


>gi|331677842|ref|ZP_08378517.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
 gi|331074302|gb|EGI45622.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
          Length = 320

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 117 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPV 175

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 176 LWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 222


>gi|317048624|ref|YP_004116272.1| DNA-cytosine methyltransferase [Pantoea sp. At-9b]
 gi|316950241|gb|ADU69716.1| DNA-cytosine methyltransferase [Pantoea sp. At-9b]
          Length = 467

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPR----LGDILEEHIDDKSTI 53
           + A  F +PQ RER+ ++     +     F       + P+    L  +LE   D K T+
Sbjct: 271 IDARHF-LPQHRERIVLVGIRRDTRLSEGFTLRALAQLYPKKVPTLKSLLEPQPDAKYTL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           S  LW    +  + +K  G GFG+GL    +      TLSARYYKDGSEI
Sbjct: 330 SPVLWNYLYQYAKKHKAKGNGFGFGLNDPRNPSVCVRTLSARYYKDGSEI 379


>gi|56751653|ref|YP_172354.1| hypothetical protein syc1644_d [Synechococcus elongatus PCC 6301]
 gi|81301269|ref|YP_401477.1| DNA-cytosine methyltransferase [Synechococcus elongatus PCC 7942]
 gi|56686612|dbj|BAD79834.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81170150|gb|ABB58490.1| DNA-cytosine methyltransferase [Synechococcus elongatus PCC 7942]
          Length = 424

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 48/121 (39%), Positives = 61/121 (50%), Gaps = 23/121 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEF---KFPTPLGIKPRLGDIL-------------- 43
           + A  F VPQ RER+YI+ F    V F    F  P      + DIL              
Sbjct: 228 IDAKGF-VPQHRERIYIVGFREE-VGFNWDSFSQPPTDTKCMADILHPNDGSEEVEEPYT 285

Query: 44  ---EEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
              E  ++DK T+S+KLW   Q     ++ AG GFG+GL  ++S    TLSARYYKDGSE
Sbjct: 286 VGIEAKVNDKYTLSDKLWNYLQNYANKHRAAGNGFGFGLVNKDS-IARTLSARYYKDGSE 344

Query: 101 I 101
           I
Sbjct: 345 I 345


>gi|294979850|pdb|3ME5|A Chain A, Crystal Structure Of Putative Dna Cytosine Methylase From
           Shigella Flexneri 2a Str. 301
          Length = 482

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 271 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPXVEAKYILTPV 329

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG  + N+    T TLSARYYKDG+EI
Sbjct: 330 LWKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 376


>gi|213853126|ref|ZP_03382658.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
          Length = 219

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F    N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 19  LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 78

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 79  LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 121


>gi|210631776|ref|ZP_03297018.1| hypothetical protein COLSTE_00903 [Collinsella stercoris DSM 13279]
 gi|210159896|gb|EEA90867.1| hypothetical protein COLSTE_00903 [Collinsella stercoris DSM 13279]
          Length = 390

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 42/94 (44%), Positives = 57/94 (60%), Gaps = 4/94 (4%)

Query: 10  QRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67
           Q RER+YI+ F +  V+F +          +  +ILE  +DD+  +S+KLW   +  K  
Sbjct: 231 QHRERIYIVGFRDD-VDFSWDDLDCPQNGQKAAEILETDVDDRYVLSDKLWSYLKAYKAK 289

Query: 68  NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           ++ AG GFGYGL    S TT TLSARY+KDGSEI
Sbjct: 290 HEAAGNGFGYGLITP-SDTTRTLSARYHKDGSEI 322


>gi|255262721|ref|ZP_05342063.1| cytosine-specific methyltransferase NlaX [Thalassiobium sp. R2A62]
 gi|255105056|gb|EET47730.1| cytosine-specific methyltransferase NlaX [Thalassiobium sp. R2A62]
          Length = 421

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 13/114 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE----FKFP-------TPLGIKPRLGDILEEH--I 47
           + A +FGVPQ RER+YI+ F    V        P            + RLGD+LE +  +
Sbjct: 243 LAAKNFGVPQNRERVYIVGFDRDQVSEAEARDLPREILDGLKERKSETRLGDVLETNASV 302

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           D K TIS++L  GH++R   ++  G GFG+ LF   S   NT+SARYYKDGSE+
Sbjct: 303 DPKFTISDRLLAGHERRLRAHRAKGNGFGFSLFNAESPYCNTISARYYKDGSEV 356


>gi|157145245|ref|YP_001452564.1| DNA cytosine methylase [Citrobacter koseri ATCC BAA-895]
 gi|157082450|gb|ABV12128.1| hypothetical protein CKO_00981 [Citrobacter koseri ATCC BAA-895]
          Length = 477

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F         P     L ++LE  ++ +  ++  
Sbjct: 274 RHF-LPQHRERIVLVGFRRDLNLKTDFTLRDIATRYPQQRITLAELLEPAVEARYVLTPV 332

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG+ +  +    T TLSARYYKDG+EI
Sbjct: 333 LWKYLYRYAKKHQARGNGFGYGMVYPANPGSVTRTLSARYYKDGAEI 379


>gi|161502886|ref|YP_001569998.1| DNA cytosine methylase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160864233|gb|ABX20856.1| hypothetical protein SARI_00944 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 476

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++      N   +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGVRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
                + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYCYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|291463698|pdb|3LX6|A Chain A, Structure Of Probable Cytosine-Specific Methyltransferase
           From Shigella Flexneri
 gi|291463699|pdb|3LX6|B Chain B, Structure Of Probable Cytosine-Specific Methyltransferase
           From Shigella Flexneri
          Length = 410

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 209 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPXVEAKYILTPV 267

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW+   +  + ++  G GFGYG  + N+    T TLSARYYKDG+EI
Sbjct: 268 LWKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 314


>gi|86136173|ref|ZP_01054752.1| hypothetical protein MED193_18659 [Roseobacter sp. MED193]
 gi|85827047|gb|EAQ47243.1| hypothetical protein MED193_18659 [Roseobacter sp. MED193]
          Length = 399

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/115 (41%), Positives = 54/115 (46%), Gaps = 22/115 (19%)

Query: 8   VPQRRERLYIIDFLNP-SVEFKFPT---PLGIKPRLGDILEEH----------------- 46
           VPQ RER++I  F       F       P G  PRL DIL                    
Sbjct: 207 VPQHRERIFISGFRRDVPTRFCLDDVVIPPGPNPRLSDILHPENGSEIAEPPYTEGHLAR 266

Query: 47  IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           I DK T+S+KLW   Q     +K AG GFG+GL    S    TLSARYYKDGSEI
Sbjct: 267 IADKYTLSDKLWAYLQNYAAKHKAAGNGFGFGLCTPES-VARTLSARYYKDGSEI 320


>gi|10957343|ref|NP_058367.1| DNA cytosine methylase [Salmonella typhi]
 gi|7800396|gb|AAF69992.1|AF250878_153 EcoRII cytosine methylase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|145849042|emb|CAM91602.1| ecoRII cytosine methylase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 475

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ ++ F         F            +P LG++L+  +D +  +S KLWE  
Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSRRPTLGELLDAEVDSRYILSPKLWEYL 337

Query: 62  QKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
               + ++  G GFG+GL      S    TLSARYY+DGSEI
Sbjct: 338 YNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379


>gi|260752101|ref|YP_003237616.1| putative DNA modification methylase [Escherichia coli O111:H- str.
           11128]
 gi|257767571|dbj|BAI39065.1| putative DNA modification methylase [Escherichia coli O111:H- str.
           11128]
          Length = 475

 Score =  148 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ ++ F         F            +P LG++L+  +D +  +S KLWE  
Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSRRPTLGELLDAEVDSRYILSPKLWEYL 337

Query: 62  QKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
               + ++  G GFG+GL      S    TLSARYY+DGSEI
Sbjct: 338 YNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379


>gi|296114735|ref|ZP_06833385.1| DNA-cytosine methyltransferase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978659|gb|EFG85387.1| DNA-cytosine methyltransferase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 419

 Score =  148 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 55/100 (55%), Gaps = 8/100 (8%)

Query: 8   VPQRRERLYIIDFLNPSVEFKF----PTPLGIKPRLGDIL--EEHIDDKSTISNKLWEGH 61
           VPQ+RER++I+ F     +F        P+   PRLG IL     ++ K T++  LW   
Sbjct: 230 VPQKRERIFIVGFR-EKTDFDLKSLVVPPIEKGPRLGSILLPHAEVEPKYTLTEHLWNYL 288

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q  K  +  AG GFG+GL   +     TLSARY+KDGSEI
Sbjct: 289 QNYKAKHAAAGNGFGFGLCGPDD-VARTLSARYFKDGSEI 327


>gi|18466581|ref|NP_569389.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|160431784|ref|YP_001551898.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis]
 gi|16505897|emb|CAD09776.1| putative DNA modification methylase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|159885325|dbj|BAF92929.1| putative DNA modification methylase [Salmonella enterica subsp.
           enterica serovar Choleraesuis]
          Length = 475

 Score =  148 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ ++ F         F            +P LG++L+  +D +  +S KLWE  
Sbjct: 278 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSRRPTLGELLDAEVDSRYILSPKLWEYL 337

Query: 62  QKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
               + ++  G GFG+GL      S    TLSARYY+DGSEI
Sbjct: 338 YNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379


>gi|313651376|gb|EFS15772.1| modification methylase EcoRII [Shigella flexneri 2a str. 2457T]
          Length = 463

 Score =  148 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ ++ F         F            +P LG++L+  +D +  +S KLWE  
Sbjct: 266 PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPSRRPTLGELLDAEVDSRYILSPKLWEYL 325

Query: 62  QKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
               + ++  G GFG+GL      S    TLSARYY+DGSEI
Sbjct: 326 YNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 367


>gi|304398880|ref|ZP_07380750.1| DNA-cytosine methyltransferase [Pantoea sp. aB]
 gi|304353584|gb|EFM17961.1| DNA-cytosine methyltransferase [Pantoea sp. aB]
          Length = 458

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 52/109 (47%), Gaps = 9/109 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP----LGIKPRLGDILEEHIDDKSTIS 54
           + A  F +PQ RER+ ++         +F             P L  +LE   DDK  +S
Sbjct: 266 IDARHF-LPQHRERIVLVGIRRDLKKQDFTLRDIRRFYPAQVPSLQSLLERAPDDKYILS 324

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             LW    +  + +K  G GFG+GL   ++      TLSARYYKDGSEI
Sbjct: 325 PVLWRYLYQYAKKHKAKGNGFGFGLNDPHNPDCCVRTLSARYYKDGSEI 373


>gi|308187315|ref|YP_003931446.1| DNA cytosine methylase [Pantoea vagans C9-1]
 gi|308057825|gb|ADO09997.1| DNA cytosine methylase [Pantoea vagans C9-1]
          Length = 458

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 52/109 (47%), Gaps = 9/109 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP----LGIKPRLGDILEEHIDDKSTIS 54
           + A  F +PQ RER+ ++         +F             P L  +LE+  DDK  +S
Sbjct: 266 IDARHF-LPQHRERIVLVGIRRDLKKQDFTLRDIRRFYPAQVPSLQSLLEKAPDDKYILS 324

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             LW    +  + +K  G GFG+GL    +      TLSARYYKDGSEI
Sbjct: 325 PVLWRYLYQYAKKHKAKGNGFGFGLNDPRNPDCCVRTLSARYYKDGSEI 373


>gi|315498495|ref|YP_004087299.1| transcriptional regulator, xre family [Asticcacaulis excentricus CB
           48]
 gi|315416507|gb|ADU13148.1| transcriptional regulator, XRE family [Asticcacaulis excentricus CB
           48]
          Length = 410

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 56/121 (46%), Gaps = 23/121 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEH----------- 46
           + A  F VPQ RER+ I+ F    V F +     P     +L  IL              
Sbjct: 218 IDAQHF-VPQHRERIVIVGFR-EDVPFSWDDLNLPPKGSVKLSSILHPENAIEEAEPPYT 275

Query: 47  ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
                 +  K T+++KLW   Q   + +K AG GFG+GL       + TLSARYYKDGSE
Sbjct: 276 TGIRAEVASKYTLTDKLWAYLQNYADKHKAAGNGFGFGLVGPGD-VSRTLSARYYKDGSE 334

Query: 101 I 101
           I
Sbjct: 335 I 335


>gi|212716092|ref|ZP_03324220.1| hypothetical protein BIFCAT_01005 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661459|gb|EEB22034.1| hypothetical protein BIFCAT_01005 [Bifidobacterium catenulatum DSM
           16992]
          Length = 453

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 42/117 (35%), Positives = 58/117 (49%), Gaps = 25/117 (21%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEH------------------- 46
           VPQ RER+YI+ F +   +F +        KP L DIL ++                   
Sbjct: 242 VPQHRERIYIVGFRS-HTDFTWDDLKLPEHKPVLADILHKNDGTEPYLPWDGDRYFDYEH 300

Query: 47  --IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             + DK T++ +LW+  Q  K  ++  G GFGYGL       + TLSARY+KDGSEI
Sbjct: 301 NKVQDKYTLTPRLWQYLQDYKAKHEAMGHGFGYGLVTP-DMVSRTLSARYHKDGSEI 356


>gi|327394286|dbj|BAK11708.1| modification methylase EcoRII [Pantoea ananatis AJ13355]
          Length = 459

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 51/105 (48%), Gaps = 9/105 (8%)

Query: 6   FGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58
           F +PQ RER+ ++        S +F             P L  +LE   DDK  +S  LW
Sbjct: 270 FFLPQHRERIVLVGIRRDIAGSAQFSLRDIRQFFPAQVPSLQSLLEPQPDDKYILSPVLW 329

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101
               +  + +K  G GFG+GL   ++      TLSARYYKDGSEI
Sbjct: 330 RYLYQYAKKHKARGNGFGFGLNDPHNVHCCVRTLSARYYKDGSEI 374


>gi|188533556|ref|YP_001907353.1| DNA cytosine methylase [Erwinia tasmaniensis Et1/99]
 gi|188028598|emb|CAO96460.1| DNA-cytosine methyltransferase [Erwinia tasmaniensis Et1/99]
          Length = 469

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 52/106 (49%), Gaps = 9/106 (8%)

Query: 4   CDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKL 57
             F +PQ RER+ ++ F        F       + PR    L  +L+  +++K  ++  L
Sbjct: 277 KHF-LPQHRERIVLVGFRRDLQLPAFSLSLLPALYPRQRTPLNALLDSQVEEKYILTPTL 335

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           W+      + ++  G GFGYGL      +    TLSARYYKDGSEI
Sbjct: 336 WKYLYHYAKKHQARGNGFGYGLVDPALENGVVRTLSARYYKDGSEI 381


>gi|291617874|ref|YP_003520616.1| EcoRIIM [Pantoea ananatis LMG 20103]
 gi|291152904|gb|ADD77488.1| EcoRIIM [Pantoea ananatis LMG 20103]
          Length = 459

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 51/105 (48%), Gaps = 9/105 (8%)

Query: 6   FGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58
           F +PQ RER+ ++        S +F             P L  +LE   DDK  +S  LW
Sbjct: 270 FFLPQHRERIVLVGIRRDIAGSAQFSLRDIRQFFPAQVPSLQSLLEPQPDDKYILSPVLW 329

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101
               +  + +K  G GFG+GL   ++      TLSARYYKDGSEI
Sbjct: 330 RYLYQYAKKHKARGNGFGFGLNDPHNVHCCVRTLSARYYKDGSEI 374


>gi|148244085|ref|YP_001220322.1| DNA-cytosine methyltransferase [Acidiphilium cryptum JF-5]
 gi|146400648|gb|ABQ29180.1| DNA-cytosine methyltransferase [Acidiphilium cryptum JF-5]
          Length = 487

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 56/116 (48%), Gaps = 24/116 (20%)

Query: 8   VPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRLGDILEEH---------------- 46
           VPQ RER++I  F + + EF F     P P    PRL  IL                   
Sbjct: 291 VPQHRERIFIAGFRDRNAEFTFKTLDIPDP-ASGPRLASILHPEDGTEKPDGHFTEGPLA 349

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            + ++ T+++ LW   Q   E ++ AG GFG+GL         TLSARYYKDGSEI
Sbjct: 350 TVTERYTLTDHLWNYLQNYAEKHRRAGNGFGFGLCGPED-VARTLSARYYKDGSEI 404


>gi|66391578|ref|YP_239103.1| hypothetical protein RB43ORF127c [Enterobacteria phage RB43]
 gi|62288666|gb|AAX78649.1| hypothetical protein RB43ORF127c [Enterobacteria phage RB43]
          Length = 302

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 68/100 (68%), Gaps = 2/100 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQRRER++I+ FL+  V F FP P     R+GDILE+ +DD  T+S+  W+G
Sbjct: 144 LNTKDFGLPQRRERVFIVCFLDD-VFFSFPVPPRTPTRVGDILED-VDDSYTLSDNAWKG 201

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
            ++RKE NK  GKGFGY     +S  T T++A+YYKDG +
Sbjct: 202 FRERKERNKANGKGFGYQAVTADSTHTGTITAQYYKDGVQ 241


>gi|310767946|gb|ADP12896.1| DNA cytosine methylase [Erwinia sp. Ejp617]
          Length = 467

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 52/106 (49%), Gaps = 9/106 (8%)

Query: 4   CDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKL 57
             F +PQ RER+ ++ F        F       + P     L  +L+ H++ K  ++  L
Sbjct: 275 KHF-LPQHRERIILVGFRRDLKLPAFSLSALPALYPLQRTPLKALLDSHVEAKYILTPTL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYGL      +    TLSARYYKDGSEI
Sbjct: 334 WKYLYQYAKKHQARGNGFGYGLVDPVLENGVVRTLSARYYKDGSEI 379


>gi|259908144|ref|YP_002648500.1| DNA cytosine methylase [Erwinia pyrifoliae Ep1/96]
 gi|224963766|emb|CAX55267.1| DNA-cytosine methyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|283478063|emb|CAY73979.1| DNA cytosine methylase [Erwinia pyrifoliae DSM 12163]
          Length = 467

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 52/106 (49%), Gaps = 9/106 (8%)

Query: 4   CDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKL 57
             F +PQ RER+ ++ F        F       + P     L  +L+ H++ K  ++  L
Sbjct: 275 KHF-LPQHRERIILVGFRRDLKLPAFSLSALPALYPLQRTPLKALLDSHVEAKYILTPTL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           W+   +  + ++  G GFGYGL      +    TLSARYYKDGSEI
Sbjct: 334 WKYLYQYAKKHQARGNGFGYGLVDPALENGVVRTLSARYYKDGSEI 379


>gi|300717257|ref|YP_003742060.1| cytosine-specific methyltransferase [Erwinia billingiae Eb661]
 gi|299063093|emb|CAX60213.1| Cytosine-specific methyltransferase [Erwinia billingiae Eb661]
          Length = 466

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 51/106 (48%), Gaps = 9/106 (8%)

Query: 4   CDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPR----LGDILEEHIDDKSTISNKL 57
             F +PQ RER+ ++         EF       + P+    L  ++E  +D K  ++  L
Sbjct: 275 KHF-LPQHRERIVLVGMRRDLKLPEFTLKALSTLYPKQRIPLRALMEPEVDSKYILTPTL 333

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           W+      + ++  G GFGYGL      +    TLSARYYKDGSEI
Sbjct: 334 WKYLYNYAKKHQAKGNGFGYGLVDPQVETGVVRTLSARYYKDGSEI 379


>gi|239621327|ref|ZP_04664358.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|239515788|gb|EEQ55655.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 343

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDIL--EEHIDDKSTISNKL 57
           + A  F VPQ RER YI+ F   +  F F          +G IL     + DK  +S+KL
Sbjct: 179 IDAAGF-VPQHRERTYIVGFREEN-GFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKL 236

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           W   Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 237 WTYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 280


>gi|23466029|ref|NP_696632.1| modification methylase very EcoRII
           (cytosine-specificmethyltransferase [Bifidobacterium
           longum NCC2705]
 gi|23326750|gb|AAN25268.1| modification methylase very similar to EcoRII
           (cytosine-specificmethyltransferase [Bifidobacterium
           longum NCC2705]
          Length = 323

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDIL--EEHIDDKSTISNKL 57
           + A  F VPQ RER YI+ F   +  F F          +G IL     + DK  +S+KL
Sbjct: 159 IDAAGF-VPQHRERTYIVGFREEN-GFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKL 216

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           W   Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 217 WTYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 260


>gi|189439219|ref|YP_001954300.1| site-specific DNA methylase [Bifidobacterium longum DJO10A]
 gi|189427654|gb|ACD97802.1| Site-specific DNA methylase [Bifidobacterium longum DJO10A]
          Length = 323

 Score =  146 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDIL--EEHIDDKSTISNKL 57
           + A  F VPQ RER YI+ F   +  F F          +G IL     + DK  +S+KL
Sbjct: 159 IDAAGF-VPQHRERTYIVGFREEN-GFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKL 216

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           W   Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 217 WTYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 260


>gi|46191283|ref|ZP_00120453.2| COG0270: Site-specific DNA methylase [Bifidobacterium longum
           DJO10A]
          Length = 315

 Score =  146 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDIL--EEHIDDKSTISNKL 57
           + A  F VPQ RER YI+ F   +  F F          +G IL     + DK  +S+KL
Sbjct: 151 IDAAGF-VPQHRERTYIVGFREEN-GFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKL 208

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           W   Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 209 WTYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 252


>gi|157412142|ref|YP_001481483.1| DNA cytosine methylase [Escherichia coli APEC O1]
 gi|99867167|gb|ABF67812.1| cytosine methylase [Escherichia coli APEC O1]
          Length = 489

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ +I F         F            +P L D+L+  +D K  +S KLWE  
Sbjct: 292 PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPKLWEYL 351

Query: 62  QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
               + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 352 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 393


>gi|226807724|ref|YP_002791420.1| Dcm [Enterobacter cloacae]
 gi|226810038|ref|YP_002791733.1| Dcm [Enterobacter cloacae]
 gi|226425951|gb|ACO54044.1| Dcm [Enterobacter cloacae]
 gi|226426265|gb|ACO54357.1| Dcm [Enterobacter cloacae]
          Length = 489

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ +I F         F            +P L D+L+  +D K  +S KLWE  
Sbjct: 292 PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPKLWEYL 351

Query: 62  QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
               + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 352 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 393


>gi|38347986|ref|NP_941235.1| DNA cytosine methylase [Serratia marcescens]
 gi|190410308|ref|YP_001965811.1| dcm [Klebsiella pneumoniae]
 gi|38259463|emb|CAE51691.1| DNA-cytosine methyltransferase [Serratia marcescens]
 gi|146151102|gb|ABQ02868.1| dcm [Klebsiella pneumoniae]
          Length = 475

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ +I F         F            +P L D+L+  +D K  +S KLWE  
Sbjct: 278 PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPKLWEYL 337

Query: 62  QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
               + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 338 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 379


>gi|237725529|ref|ZP_04556010.1| DNA (cytosine-5-)-methyltransferase [Bacteroides sp. D4]
 gi|229436216|gb|EEO46293.1| DNA (cytosine-5-)-methyltransferase [Bacteroides dorei 5_1_36/D4]
          Length = 374

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 73/123 (59%), Gaps = 22/123 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLG-----------------IKPRLG 40
           + A  FGVPQ RERL+I+ +    V+   FKFP  +                  IK ++ 
Sbjct: 166 LNAKYFGVPQNRERLFIVAWYKDIVKATTFKFPYGIAPDGSTIYEKSKDLGDKVIKTKVS 225

Query: 41  DILEEH--IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
           DI E    ID   TIS++LW GHQ+RK+ NK  GKGFGY LF ENS  ++T+SARY+KDG
Sbjct: 226 DIFEPEDSIDSYYTISDRLWIGHQERKKRNKANGKGFGYSLFNENSVYSSTISARYWKDG 285

Query: 99  SEI 101
           SEI
Sbjct: 286 SEI 288


>gi|254251049|ref|ZP_04944367.1| Site-specific DNA methylase [Burkholderia dolosa AUO158]
 gi|124893658|gb|EAY67538.1| Site-specific DNA methylase [Burkholderia dolosa AUO158]
          Length = 530

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 54/118 (45%), Gaps = 28/118 (23%)

Query: 9   PQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEE------------------- 45
           PQ RER+ I+ F  P+       + P   GIK  + DIL +                   
Sbjct: 331 PQHRERIVIVGFREPTPFSWESLQLPEKGGIK--MKDILHKLDGSEPRLEHDGDRYFDHE 388

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              ++DK T++  LW+  Q     +K  G GFGYGL         TLSARYYKDGSEI
Sbjct: 389 KQKVNDKYTLTPNLWKYLQDYAAKHKAKGNGFGYGLVGPED-IARTLSARYYKDGSEI 445


>gi|307729019|ref|YP_003906243.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1003]
 gi|307583554|gb|ADN56952.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1003]
          Length = 428

 Score =  145 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 51/115 (44%), Gaps = 23/115 (20%)

Query: 9   PQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEH--------------------- 46
           PQ RER+ I+ F   +   F         PRL  IL +                      
Sbjct: 235 PQHRERIVIVGFRQETGFSFDDLKLPASGPRLASILHKTDGSEPLLPHDGERFFDPVRRS 294

Query: 47  IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +  K T++  LW   Q   E ++ AG GFG+GL    S  T TLSARY+KDGSEI
Sbjct: 295 VQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGLVTPAS-VTRTLSARYHKDGSEI 348


>gi|328947602|ref|YP_004364939.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
 gi|328447926|gb|AEB13642.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
          Length = 431

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 56/118 (47%), Gaps = 26/118 (22%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEE------------------- 45
           VPQ RER+ I+ F N  V+F       P   + +L  IL +                   
Sbjct: 233 VPQHRERIVIVGFRN-KVDFSLEDMELPPKGEVKLASILHKTDGTEPRLPQDGDKYFDFE 291

Query: 46  --HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              + DK T+++ LW   Q   + ++  G GFGYGL  EN     TLSARYYKDGSEI
Sbjct: 292 NNKVLDKYTLTDNLWAYLQAYAQKHRSMGNGFGYGLVNEND-IARTLSARYYKDGSEI 348


>gi|323525262|ref|YP_004227415.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1001]
 gi|323382264|gb|ADX54355.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1001]
          Length = 428

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 52/116 (44%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE--------------------- 45
           PQ RER+ I+ F   +  F F         PRL  IL +                     
Sbjct: 235 PQHRERIVIVGFREET-GFSFDDLRLPANGPRLASILHKTDGSEPLLPHDGERFFDHVRR 293

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+GL    S  T TLSARY+KDGSEI
Sbjct: 294 KVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGLVTPAS-VTRTLSARYHKDGSEI 348


>gi|294661528|ref|YP_003579981.1| hypothetical protein KP-KP15_gp115 [Klebsiella phage KP15]
 gi|292660689|gb|ADE34937.1| hypothetical protein [Klebsiella phage KP15]
          Length = 308

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 50/100 (50%), Positives = 68/100 (68%), Gaps = 2/100 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           M   DFG+PQRRER++I+ F +P V F FP P     R+GDILE   +D+ TIS++ W+G
Sbjct: 144 MNTKDFGLPQRRERVFIVCFRDP-VFFSFPVPPRTPTRVGDILEPD-NDQYTISDRAWKG 201

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
            ++RKE NK  GKGFGY     +S  T T++A+YYKDG +
Sbjct: 202 FRERKELNKANGKGFGYQAVTVDSVCTGTITAQYYKDGVQ 241


>gi|329298618|ref|ZP_08255954.1| DNA cytosine methylase [Plautia stali symbiont]
          Length = 465

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPR----LGDILEEHIDDKSTI 53
           + A  F +PQ RER+ ++     +     F       + P     L  +LE     K  +
Sbjct: 269 VDARHF-LPQHRERIVLVGIRRDTGLSEGFSLRALAALYPPEVPALHSLLELQPAAKYIL 327

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101
           S  LW    +  + +K  G GFG+GL    +      TLSARYYKDGSEI
Sbjct: 328 SPTLWHYLYQYAKKHKAKGNGFGFGLNDPRNPHCCVRTLSARYYKDGSEI 377


>gi|217980150|ref|YP_002364200.1| DNA-cytosine methyltransferase [Thauera sp. MZ1T]
 gi|217508321|gb|ACK55106.1| DNA-cytosine methyltransferase [Thauera sp. MZ1T]
          Length = 419

 Score =  144 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 53/119 (44%), Gaps = 26/119 (21%)

Query: 8   VPQRRERLYIIDFLNPS-VEFKFPT---PLGIKPRLGDILEEH----------------- 46
           VPQ RER+ I+ F N   + F +     P      + DIL                    
Sbjct: 223 VPQHRERILIVGFRNEDGIRFDWDAVGLPQKGVHVMRDILHRTDGTEPVLPWDGDRFFDH 282

Query: 47  ----IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
               + DK T++ KLW   Q   + ++  G GFG+GL    S    TLSARYYKDGSEI
Sbjct: 283 AGRRVQDKYTLTPKLWRYLQDYADKHRAKGNGFGFGLVHPGS-VARTLSARYYKDGSEI 340


>gi|292488627|ref|YP_003531511.1| DNA cytosine methylase [Erwinia amylovora CFBP1430]
 gi|292899788|ref|YP_003539157.1| modification methylase EcoRII [Erwinia amylovora ATCC 49946]
 gi|291199636|emb|CBJ46755.1| modification methylase EcoRII [Erwinia amylovora ATCC 49946]
 gi|291554058|emb|CBA21160.1| DNA cytosine methylase [Erwinia amylovora CFBP1430]
 gi|312172770|emb|CBX81026.1| DNA cytosine methylase [Erwinia amylovora ATCC BAA-2158]
          Length = 469

 Score =  144 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 15/109 (13%)

Query: 4   CDFGVPQRRERLYIIDFLNPSVEFKFPTP---------LGIKPRLGDILEEHIDDKSTIS 54
             F +PQ RER+ ++ F     + K P              +  L  +L+  ++ K  ++
Sbjct: 277 KHF-LPQHRERIILVGFRR---DLKLPAFSLSALPAWYPQQRTPLHALLDTDVEAKYILT 332

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
             LW+      + ++  G GFGYGL      +    TLSARYYKDGSEI
Sbjct: 333 PTLWKYLYHYAKKHQARGNGFGYGLVDPALENGVVRTLSARYYKDGSEI 381


>gi|304373674|ref|YP_003858419.1| putative DNA-methyltransferase, type II restriction-modification
           system [Enterobacteria phage RB16]
 gi|299829630|gb|ADJ55423.1| putative DNA-methyltransferase, type II restriction-modification
           system [Enterobacteria phage RB16]
          Length = 302

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%), Gaps = 2/100 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQRRER++I+ FL+  V F FP P     R+GDILE+  DD  T+S+  W+G
Sbjct: 144 LNTKDFGLPQRRERVFIVCFLDD-VFFSFPVPPRTPTRVGDILEDA-DDSYTLSDNAWKG 201

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
            ++RKE NK  GKGFGY     +S  T T++A+YYKDG +
Sbjct: 202 FRERKERNKANGKGFGYQAVTADSTHTGTITAQYYKDGVQ 241


>gi|189423370|ref|YP_001950547.1| DNA-cytosine methyltransferase [Geobacter lovleyi SZ]
 gi|189419629|gb|ACD94027.1| DNA-cytosine methyltransferase [Geobacter lovleyi SZ]
          Length = 415

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 52/113 (46%), Gaps = 21/113 (18%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEH-----------------ID 48
           VPQ RER+ I+ F      F F         P+L  IL                    + 
Sbjct: 226 VPQHRERIIIVGFR-EKTGFSFDSLQLPKEGPKLFSILHPEDGTEQEETPFTVGDKAKVH 284

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +K  ++N LW   Q     +K AG GFG+GL  +N  T  TLSARYYKDGSEI
Sbjct: 285 EKYILTNNLWSYLQAYAAKHKAAGNGFGFGLVGKND-TARTLSARYYKDGSEI 336


>gi|170691874|ref|ZP_02883038.1| DNA-cytosine methyltransferase [Burkholderia graminis C4D1M]
 gi|170143158|gb|EDT11322.1| DNA-cytosine methyltransferase [Burkholderia graminis C4D1M]
          Length = 438

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 54/116 (46%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE--------------------- 45
           PQ RER+ II F + + EF F         PRL  IL +                     
Sbjct: 245 PQHRERIVIIGFRSDT-EFSFDDLRLPATGPRLASILHKTDGSEPLLPHDGERFFDHVQR 303

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   + ++ AG GFG+GL    S  T TLSARY+KDGSEI
Sbjct: 304 KVQPKYTLTPNLWAYLQAYADKHRAAGNGFGFGLVTPAS-VTRTLSARYHKDGSEI 358


>gi|7636053|emb|CAB88410.1| putative methyltransferase [Serratia marcescens]
          Length = 290

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ +I F         F            +P L D+L+  +D K  +S  LWE  
Sbjct: 93  PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPXLWEYL 152

Query: 62  QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
               + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 153 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 194


>gi|91782477|ref|YP_557683.1| C-5 cytosine-specific DNA methylase [Burkholderia xenovorans LB400]
 gi|91686431|gb|ABE29631.1| C-5 cytosine-specific DNA methylase [Burkholderia xenovorans LB400]
          Length = 418

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 40/119 (33%), Positives = 54/119 (45%), Gaps = 25/119 (21%)

Query: 6   FGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE------------------ 45
           +  PQ RER+ I+ F   + EF F         PRL  IL +                  
Sbjct: 228 YFTPQHRERIVIVGFREET-EFTFDDLNVPAEGPRLASILHKTDGSEPVLAHDGDRFFDH 286

Query: 46  ---HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
               +  + T++  LW   Q     ++ AG GFG+GL   +S  T TLSARY+KDGSEI
Sbjct: 287 ASREVQPRYTLTANLWAYLQAYAAKHRAAGNGFGFGLVTPDS-VTRTLSARYFKDGSEI 344


>gi|327198092|ref|YP_004306459.1| gp47 [Burkholderia phage KL3]
 gi|310657226|gb|ADP02340.1| gp47 [Burkholderia phage KL3]
          Length = 422

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 53/116 (45%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE--------------------- 45
           PQ RER+ I+ F      F +         PRL  IL +                     
Sbjct: 229 PQHRERIVIVGFRK-KTGFSWDDLRLPADGPRLASILHKTDGSEPVLPWDGERFFDHEKR 287

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 288 KVQSKYTLTPNLWTYLQAYAEKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 342


>gi|261337441|ref|ZP_05965325.1| modification methylase HpaII [Bifidobacterium gallicum DSM 20093]
 gi|270277829|gb|EFA23683.1| modification methylase HpaII [Bifidobacterium gallicum DSM 20093]
          Length = 442

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 58/117 (49%), Gaps = 25/117 (21%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEE-------------------- 45
           VPQ RER+YI+ F +   +F +        +P L DIL +                    
Sbjct: 231 VPQHRERIYIVGFCS-KTDFTWDDLKFPDHQPILADILHKTDGTEPYLPWDGDKYFDFEH 289

Query: 46  -HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             + DK T++ +LW+  Q  ++ ++  G GFGYGL       + TLSARY+KDGSEI
Sbjct: 290 QKVQDKYTLTPRLWQYLQDYRKKHEALGHGFGYGLVTP-DMVSRTLSARYHKDGSEI 345


>gi|209520785|ref|ZP_03269531.1| DNA-cytosine methyltransferase [Burkholderia sp. H160]
 gi|209498782|gb|EDZ98891.1| DNA-cytosine methyltransferase [Burkholderia sp. H160]
          Length = 432

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 54/116 (46%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEH-------------------- 46
           PQ RER+ I+ F   +  F +         PRLG IL                       
Sbjct: 238 PQHRERIIIVGFRGETT-FTWDDLRLPEQGPRLGAILHRKDGSEPVLPWDHDRFFDHAAR 296

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++ KLW   Q     ++ AG GFG+GL + +S  T TLSARY+KDGSEI
Sbjct: 297 RVQPKYTLTPKLWAYLQNYAAKHRAAGNGFGFGLAYPDS-VTRTLSARYHKDGSEI 351


>gi|296159065|ref|ZP_06841892.1| DNA-cytosine methyltransferase [Burkholderia sp. Ch1-1]
 gi|295890626|gb|EFG70417.1| DNA-cytosine methyltransferase [Burkholderia sp. Ch1-1]
          Length = 426

 Score =  141 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 54/116 (46%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEH-------------------- 46
           PQ RER+ I+ F   +  F +         PRLG IL                       
Sbjct: 232 PQHRERIIIVGFRGET-SFSWDDLHLPENGPRLGSILHRTDGSEPVLPWDHDRFFDHTSR 290

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 291 RVQPKYTLTPNLWTYLQNYAEKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 345


>gi|119355933|ref|YP_910577.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides DSM
           266]
 gi|119353282|gb|ABL64153.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides DSM
           266]
          Length = 425

 Score =  141 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/115 (36%), Positives = 53/115 (46%), Gaps = 23/115 (20%)

Query: 8   VPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEEH----------------- 46
           VPQ RER++I  F          F  P     +P +  IL                    
Sbjct: 224 VPQHRERIFIAGFREDCGFSFDRFDLP-HGNERPVIETILHPENGMEDEEPPYTVGPLAR 282

Query: 47  IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           I D+ T+S+ LWE  QK  E ++  G GFG+GL   +     TLSARYYKDGSEI
Sbjct: 283 ISDRYTLSDHLWEYLQKYAEKHRAKGNGFGFGLVGPHD-VARTLSARYYKDGSEI 336


>gi|149184876|ref|ZP_01863193.1| hypothetical protein ED21_17522 [Erythrobacter sp. SD-21]
 gi|148830987|gb|EDL49421.1| hypothetical protein ED21_17522 [Erythrobacter sp. SD-21]
          Length = 410

 Score =  141 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 23/121 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEH----------- 46
           + A  F +PQ RER+ ++ F      F +     P+  + R+  +L              
Sbjct: 216 LNARHF-LPQNRERIVLVGFR-EKSGFDWADLKLPVEGEARMRSVLHPENGSEIAESHYT 273

Query: 47  ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
                 +  K T+SN LW+  +     ++ AG GFGYGL   +  T  TLSARYYKDGSE
Sbjct: 274 EGELATVSAKYTLSNHLWKYLRDYSAKHRAAGNGFGYGLVGPDD-TCRTLSARYYKDGSE 332

Query: 101 I 101
           I
Sbjct: 333 I 333


>gi|118576810|ref|YP_876553.1| C-5 cytosine-specific DNA methylase [Cenarchaeum symbiosum A]
 gi|118195331|gb|ABK78249.1| C-5 cytosine-specific DNA methylase [Cenarchaeum symbiosum A]
          Length = 325

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 44/94 (46%), Positives = 56/94 (59%), Gaps = 2/94 (2%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67
           VPQ RERL+I+ F +  VEF+FP     KPRL DILE     +  ++  +W   ++ KE 
Sbjct: 159 VPQHRERLFIVGF-DREVEFEFPKMKNAKPRLRDILEPDPGSEYVLTPGVWAALKRHKEA 217

Query: 68  NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  G GFGYG+       T TLS RYYKDGSEI
Sbjct: 218 CRARGAGFGYGIADP-DGVTRTLSRRYYKDGSEI 250


>gi|226942156|ref|YP_002797230.1| Cytosine-specific methyltransferase [Laribacter hongkongensis
           HLHK9]
 gi|226717083|gb|ACO76221.1| Cytosine-specific methyltransferase [Laribacter hongkongensis
           HLHK9]
          Length = 420

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 54/117 (46%), Gaps = 26/117 (22%)

Query: 9   PQRRERLYIIDFLNPSVEFKF---PTPLGIKPRLGDILEEH------------------- 46
           PQ RER+ I  F  P V F +   P P      L  +L                      
Sbjct: 231 PQHRERILIAGFREP-VAFDWDAIPLPPKGSRTLRTVLHRTDGSEPVLPWDGDRFFDHQA 289

Query: 47  --IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             + DK T++ KLW+  Q   E ++  G GFG+GL   +S  T TLSARYYKDGSEI
Sbjct: 290 RCVQDKYTLTPKLWDYLQAYAEKHRAKGNGFGFGLVGPDS-VTRTLSARYYKDGSEI 345


>gi|295675907|ref|YP_003604431.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1002]
 gi|295435750|gb|ADG14920.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1002]
          Length = 430

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 53/116 (45%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEH-------------------- 46
           PQ RER+ I+ F      F +         PRLG IL                       
Sbjct: 236 PQHRERIIIVGFR-GKTAFTWDDLRLPDEGPRLGAILHRTDGTEPVLPWDHDRFFDHATR 294

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++ KLW   Q     ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 295 RVQPKYTLTPKLWAYLQNYAAKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 349


>gi|114571596|ref|YP_758276.1| DNA-cytosine methyltransferase [Maricaulis maris MCS10]
 gi|114342058|gb|ABI67338.1| DNA-cytosine methyltransferase [Maricaulis maris MCS10]
          Length = 406

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 42/102 (41%), Positives = 58/102 (56%), Gaps = 10/102 (9%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFP------TPLGIKPRLGDILEEH--IDDKSTISNKLWE 59
           VPQ+RER++I+ F + S +F F             P L  IL+ H  I  K T++ KLW+
Sbjct: 228 VPQKRERVFIVGFRD-STDFSFEGFERLIPHASNHPTLDSILQSHNEIGQKYTLTEKLWD 286

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             Q  ++ ++  G GFGY LF  +     TLSARY+KDGSEI
Sbjct: 287 YLQAYRQKHESKGNGFGYSLFGPDD-VARTLSARYHKDGSEI 327


>gi|320331203|gb|EFW87160.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330882725|gb|EGH16874.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 420

 Score =  140 bits (355), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 53/116 (45%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEH-------------------- 46
           PQ RER+ I+ F      F +         PRL  IL +                     
Sbjct: 228 PQHRERIIIVGFR-EKTGFSWDDLRLPTDGPRLASILHKTDGTERVLPWDEDRFFDHKKR 286

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+G+ F +S  T TLSARY+KDGSEI
Sbjct: 287 VVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGMAFPDS-VTRTLSARYHKDGSEI 341


>gi|85709931|ref|ZP_01040996.1| Type II restriction-modification system methylation subunit
           [Erythrobacter sp. NAP1]
 gi|85688641|gb|EAQ28645.1| Type II restriction-modification system methylation subunit
           [Erythrobacter sp. NAP1]
          Length = 370

 Score =  140 bits (354), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 59/111 (53%), Gaps = 10/111 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-------FKFPTPLGIKPRLGDILEEHID---DK 50
           + A +FGVPQ+RER+YI+ F             F      G   RLGD LE        +
Sbjct: 184 LAATEFGVPQKRERVYIVGFDRDHFGNIDANDVFAQLERGGHPTRLGDALEPEGANSLAR 243

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            TIS+KLW G  +R   ++  G GFG+ +F  +    NT+++RYYKDG EI
Sbjct: 244 YTISDKLWSGLIRRMARHEAKGNGFGHKVFNYDDPYCNTITSRYYKDGREI 294


>gi|260909972|ref|ZP_05916659.1| modification methylase EcoRII [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260635922|gb|EEX53925.1| modification methylase EcoRII [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 370

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 53/121 (43%), Positives = 71/121 (58%), Gaps = 20/121 (16%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGI----------------KPRLGD 41
           + A  FGVPQ RERL+II +    V+   FKFP  + I                  ++ +
Sbjct: 166 LNAKYFGVPQNRERLFIIAWNRELVDVDCFKFPYGIAIDGTSIYEKRKLKGRTIPTKVSE 225

Query: 42  ILEEH-IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           I E   +    TI++++WEGH+ RKE NK+ GKGFGY LF  NS  T+T+SARY+KDGSE
Sbjct: 226 IFEPDNVTTPFTITDRMWEGHKTRKERNKMNGKGFGYSLFNANSEYTSTISARYWKDGSE 285

Query: 101 I 101
           I
Sbjct: 286 I 286


>gi|187923141|ref|YP_001894783.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN]
 gi|187714335|gb|ACD15559.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN]
          Length = 426

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 52/116 (44%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEH-------------------- 46
           PQ RER+ I+ F      F +         PRLG IL                       
Sbjct: 232 PQHRERIIIVGFR-GKTAFSWDDLRLPQDGPRLGSILHRTDGSEPVLPWDHDRFFDHAGR 290

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+G+ +  S  T TLSARY+KDGSEI
Sbjct: 291 RVQPKYTLTPNLWTYLQNYAEKHRAAGNGFGFGMAYPTS-VTRTLSARYHKDGSEI 345


>gi|186476891|ref|YP_001858361.1| DNA-cytosine methyltransferase [Burkholderia phymatum STM815]
 gi|184193350|gb|ACC71315.1| DNA-cytosine methyltransferase [Burkholderia phymatum STM815]
          Length = 428

 Score =  138 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 54/116 (46%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEE--------------------- 45
           PQ RER+ +I F   +  F +         PRL  IL                       
Sbjct: 237 PQHRERIIMIGFRART-SFSWDDLRLPEEGPRLASILHRTDGTEPVLPWDGDRFFDHAAR 295

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           H+  K T++ KLW   Q   + ++ AG GFGYG+ +  S  T TLSARY+KDGSEI
Sbjct: 296 HVQPKYTLTPKLWTYLQNYADKHRAAGNGFGYGMAYPQS-VTRTLSARYHKDGSEI 350


>gi|149926993|ref|ZP_01915251.1| C-5 cytosine-specific DNA methylase [Limnobacter sp. MED105]
 gi|149824214|gb|EDM83434.1| C-5 cytosine-specific DNA methylase [Limnobacter sp. MED105]
          Length = 435

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/117 (36%), Positives = 54/117 (46%), Gaps = 26/117 (22%)

Query: 9   PQRRERLYIIDFLNPSVEFKF---PTPLGIKPRLGDILEE-------------------- 45
           PQ RER+ I  F +  V F +   P P     +L +IL +                    
Sbjct: 245 PQHRERILIAGFADQ-VAFDWDAIPLPPKGSRKLKEILHKTDGSEPYLPWDENRFFDHDS 303

Query: 46  -HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             + DK T++  LW   Q     +K  G GFG+GL    S TT TLSARYYKDGSEI
Sbjct: 304 KKVQDKYTLTPGLWTYLQNYAAKHKAKGNGFGFGLVGPES-TTRTLSARYYKDGSEI 359


>gi|254429380|ref|ZP_05043087.1| DNA-cytosine methyltransferase superfamily [Alcanivorax sp. DG881]
 gi|196195549|gb|EDX90508.1| DNA-cytosine methyltransferase superfamily [Alcanivorax sp. DG881]
          Length = 435

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 55/118 (46%), Gaps = 26/118 (22%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPL---GIKPRLGDILEEH------------------ 46
           VPQ RER+ I+ F  P   F +         + R+ ++L                     
Sbjct: 244 VPQHRERIAIVGFREPMP-FSWDAMKMAGKGEKRMREVLHREDGSEPYLEWDGDRFFDHG 302

Query: 47  ---IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              +++K  ++ KLW+  +  K  ++  G GFG+GL   +S    TLSARYYKDGSEI
Sbjct: 303 KGEVNEKYILTPKLWKYLKDYKAKHQAKGNGFGFGLVGPDS-VARTLSARYYKDGSEI 359


>gi|238898088|ref|YP_002923769.1| DNA cytosine methylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465848|gb|ACQ67622.1| DNA cytosine methylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 401

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 52/116 (44%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEH-------------------- 46
           PQ RER+ I+ F      F +         PRL  IL                       
Sbjct: 208 PQHRERIIIVGFR-EKTGFSWDDLKLPEEGPRLASILHRTDGTEPVLPWDGERFFDHDRR 266

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  + T++  LW   Q   + ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 267 AVPLRYTLTPNLWAYLQAYADKHRAAGNGFGFGIVYPDS-VTRTLSARYHKDGSEI 321


>gi|121997219|ref|YP_001002006.1| DNA-cytosine methyltransferase [Halorhodospira halophila SL1]
 gi|121588624|gb|ABM61204.1| DNA-cytosine methyltransferase [Halorhodospira halophila SL1]
          Length = 436

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 53/115 (46%), Gaps = 24/115 (20%)

Query: 8   VPQRRERLYIIDFLNPS----VEFKFPTPLGIKPRLGDILEEH----------------- 46
           VPQ RER+Y++ F   +     +  FP P      L ++L                    
Sbjct: 241 VPQHRERIYMVGFRKDTPFTWNQLDFPAPDAR--TLREVLHPEDGSEAAEPPYTEGDLAT 298

Query: 47  IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           + DK  +S KLW+  Q  +  ++ AG GFGY        T  TLSARY+KDGSEI
Sbjct: 299 VGDKYVLSEKLWKYLQDYRAKHEHAGNGFGYSKVGPED-TARTLSARYHKDGSEI 352


>gi|54293106|ref|YP_125521.1| hypothetical protein lpl0145 [Legionella pneumophila str. Lens]
 gi|53752938|emb|CAH14374.1| hypothetical protein lpl0145 [Legionella pneumophila str. Lens]
          Length = 417

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 39/113 (34%), Positives = 54/113 (47%), Gaps = 20/113 (17%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLG------IKPRLGDILEE---------HID 48
           VPQ RER++I+ F         + + P          + P  G  +EE          + 
Sbjct: 226 VPQHRERIFIVGFREDLPFSWNDLRLPPKNSVLLESILHPENGTEIEEKPYTFGEKAEVS 285

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              T+S+KLW   Q  K+ +   G GFG+GL  E +    TLSARY+KDGSEI
Sbjct: 286 SCFTLSDKLWNYLQDYKKKHSEKGNGFGFGLVSEKN-IARTLSARYHKDGSEI 337


>gi|254526757|ref|ZP_05138809.1| modification methylase EcoRII [Prochlorococcus marinus str. MIT
           9202]
 gi|221538181|gb|EEE40634.1| modification methylase EcoRII [Prochlorococcus marinus str. MIT
           9202]
          Length = 298

 Score =  136 bits (344), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 59/122 (48%), Gaps = 24/122 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL----GIKPRLGDILEEH---------- 46
           + A  F VPQ R+R+YI+ F   +  F F   +       P L  +L             
Sbjct: 99  INAKSF-VPQNRQRIYIVGFREEN-NFNFDDLIIPDISKGPTLSSVLHPEDGSENFEDPY 156

Query: 47  -------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99
                  +++K TI+NKLW+  +  ++ ++  G GFG+GL         TLSARY+KDG+
Sbjct: 157 TIPHLSKVNEKYTITNKLWDYLKMYEKKHRAKGNGFGFGLCKRED-VARTLSARYHKDGA 215

Query: 100 EI 101
           EI
Sbjct: 216 EI 217


>gi|228469904|ref|ZP_04054843.1| cytosine-specific methyltransferase NlaX [Porphyromonas uenonis
           60-3]
 gi|228308539|gb|EEK17327.1| cytosine-specific methyltransferase NlaX [Porphyromonas uenonis
           60-3]
          Length = 395

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 68/122 (55%), Gaps = 21/122 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFP----------------TPLGIKPRLGD 41
           + A  FGVPQ RERL+I+ +    +    F FP                    I+ ++ D
Sbjct: 188 LNAKYFGVPQNRERLFIVAWSKDLISADRFLFPYGIDAEGNTIYDKQMAKRCAIRTKVSD 247

Query: 42  ILEEHIDDK--STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99
           I E    ++   TIS+++W GHQ RK+ N++ GKGFGY  F  NS  T+T+SARY+KDGS
Sbjct: 248 IFEPQSIERDGFTISDRMWLGHQTRKKRNRLNGKGFGYSKFTGNSVYTSTISARYWKDGS 307

Query: 100 EI 101
           EI
Sbjct: 308 EI 309


>gi|126464142|ref|YP_001045255.1| DNA-cytosine methyltransferase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105953|gb|ABN78483.1| DNA-cytosine methyltransferase [Rhodobacter sphaeroides ATCC 17029]
          Length = 417

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 60/123 (48%), Gaps = 24/123 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEF-KFPTPLGIK-PRLGDILEEH--------- 46
           + A  F VPQ RER++I+         ++  K   P G+  PR G +L +          
Sbjct: 216 IDARCF-VPQHRERIFIVGVRKDLDMKIDLSKLVLPSGVTGPRFGTVLHKEDGSELPNNR 274

Query: 47  --------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
                   + D+ T+S+KLW+  Q   E ++  G GFG+GL         TLSARY+KDG
Sbjct: 275 SFLDPEGRVSDRYTLSDKLWKYLQDYAEKHRQKGNGFGFGL-TRRGDVARTLSARYHKDG 333

Query: 99  SEI 101
           SEI
Sbjct: 334 SEI 336


>gi|320156908|ref|YP_004189287.1| DNA-cytosine methyltransferase [Vibrio vulnificus MO6-24/O]
 gi|319932220|gb|ADV87084.1| DNA-cytosine methyltransferase [Vibrio vulnificus MO6-24/O]
          Length = 552

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 48/107 (44%), Gaps = 14/107 (13%)

Query: 9   PQRRERLYIIDFLNPSVEFKFP---------TPLGIKPRLGDIL---EEHIDDKSTISNK 56
           PQ RER+ ++      VE                  + R+ DIL    E    K T++  
Sbjct: 311 PQHRERIVLVGVRKDLVEKNPEYKKLSLKNIEVPQERLRVSDILTDLSEEETKKYTLTPN 370

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           LW         ++  G GFG+GL   ++    T TLSARYYKDGSEI
Sbjct: 371 LWNYLYHYALKHQSKGNGFGFGLVDPSNPNAVTRTLSARYYKDGSEI 417


>gi|46581246|ref|YP_012054.1| type II DNA modification methyltransferase [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|46450667|gb|AAS97314.1| type II DNA modification methyltransferase, putative [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311234912|gb|ADP87766.1| DNA-cytosine methyltransferase [Desulfovibrio vulgaris RCH1]
          Length = 358

 Score =  131 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 60/116 (51%), Gaps = 16/116 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-----------EFKF--PTPLGIKPRLGDILEEHI 47
           + A D+ +PQ RER++++ F  P             +F F   +  G +  L  ++E  +
Sbjct: 166 IDARDW-IPQHRERIFMVGFRLPEACPAGAQKWDVKDFDFGKVSRRGSQKDLESVIEPDV 224

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
            +K T+    W    + K N+   G+GFGYG+     A  TT TLSARY+KDG+EI
Sbjct: 225 PEKYTLGPGTWNTLVRHKANHAAKGQGFGYGMITPPFAGQTTRTLSARYHKDGAEI 280


>gi|332188292|ref|ZP_08390019.1| DNA-cytosine methyltransferase family protein [Sphingomonas sp.
           S17]
 gi|332011688|gb|EGI53766.1| DNA-cytosine methyltransferase family protein [Sphingomonas sp.
           S17]
          Length = 423

 Score =  128 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 28/120 (23%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD-------------------------- 41
           VPQ R+R+ ++ F    V F +   L   P + D                          
Sbjct: 229 VPQHRQRILLVGF-QKDVGFDWEKVLAKMPAVADGPKLASILHREDGTEEEGEDDDRRFI 287

Query: 42  ILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           + +  +  K  ++++LW+  Q   E ++ AG GFG  +      T+ TLSARYYKDGSEI
Sbjct: 288 LADGKVQKKYVLTDRLWQYLQGYAEKHRQAGNGFGCSVVGPKD-TSRTLSARYYKDGSEI 346


>gi|261252209|ref|ZP_05944782.1| DNA-cytosine methyltransferase [Vibrio orientalis CIP 102891]
 gi|260935600|gb|EEX91589.1| DNA-cytosine methyltransferase [Vibrio orientalis CIP 102891]
          Length = 584

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 11/105 (10%)

Query: 8   VPQRRERLYIIDFLNP------SVEFKFPTPLGIKPRLGDIL---EEHIDDKSTISNKLW 58
           +PQ RER+ ++            +          +  L DIL    +    K T++  LW
Sbjct: 307 LPQHRERVVLVGVRKDLTIDKSKLSLNNIQKPTERVPLKDILCELSDEDSSKYTLTPNLW 366

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
                    ++  G GFG+GL   +  +  T TLSARY+KDGSEI
Sbjct: 367 NYLYNYALKHQTQGNGFGFGLVDPSNINTVTRTLSARYHKDGSEI 411


>gi|225076313|ref|ZP_03719512.1| hypothetical protein NEIFLAOT_01354 [Neisseria flavescens
           NRL30031/H210]
 gi|224952437|gb|EEG33646.1| hypothetical protein NEIFLAOT_01354 [Neisseria flavescens
           NRL30031/H210]
          Length = 359

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +   +F++P P+G+K    DI E+  +  K  +S   
Sbjct: 181 INAKDFGVPQNRERIFIVGFHPDTKVNDFEYPKPIGLKTSFSDIREKETVPTKYYLSTVY 240

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +  +K KE ++  G GFGY +   +    N +
Sbjct: 241 IDTLRKHKERHEAKGNGFGYEII-PDDGIANAI 272


>gi|169786848|ref|YP_001700742.1| modification methylase (cytosine-specific
           methyltransferase)(HpaIIM-like) [Acinetobacter baumannii
           SDF]
 gi|169150765|emb|CAP02959.1| modification methylase (Cytosine-specific
           methyltransferase)(HpaIIM-like) [Acinetobacter
           baumannii]
          Length = 366

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 55/93 (59%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +   +F++PTP G K    D+ EE+ +  K  +SN+ 
Sbjct: 186 INAKDFGVPQNRERIFIVGFHKDTGVHDFEYPTPTGKKVCFADVKEENVVPTKYYLSNQY 245

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +  ++ K +++  G GFGY +   +++  N +
Sbjct: 246 LQTLERHKAHHESKGNGFGYAII-PDNSIANAI 277


>gi|261400408|ref|ZP_05986533.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
 gi|269209852|gb|EEZ76307.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
          Length = 362

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +   +FK+P P GI+    DI E+  +  K  +S + 
Sbjct: 180 VNAKDFGVPQNRERIFIVGFRGDTDIKDFKYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 239

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +  +K K+ ++  G GFGY +   +    N +
Sbjct: 240 IDTLRKHKQRHEEKGNGFGYEIIS-DDGIANAI 271


>gi|313668796|ref|YP_004049080.1| C-5 cytosine-specific DNA-methylase [Neisseria lactamica ST-640]
 gi|313006258|emb|CBN87720.1| C-5 cytosine-specific DNA-methylase [Neisseria lactamica 020-06]
          Length = 362

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +   +FK+P P GI+    DI E+  +  K  +S + 
Sbjct: 180 VNAKDFGVPQNRERIFIVGFRGDTDIKDFKYPEPTGIQTAFQDIREKDTVPTKYYLSTQY 239

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +  +K K+ ++  G GFGY +   +    N +
Sbjct: 240 IDTLRKHKQRHEEKGNGFGYEIIS-DDGIANAI 271


>gi|330960632|gb|EGH60892.1| DNA cytosine methylase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 178

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 19  DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYG 78
            F    +E   P     +P  GD+L++ +D K  ++  LW+   +  E ++  G GFG+G
Sbjct: 4   GFTLRDIEKLIPKQ---RPSFGDLLDKEVDSKYILTPNLWDYLYRYAEKHRQKGNGFGFG 60

Query: 79  LFFENSATTNTLSARYYKDGSEI 101
           L   N     TLSARY+KDGSEI
Sbjct: 61  LTRPND-IARTLSARYHKDGSEI 82


>gi|159027151|emb|CAO86782.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 347

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + A  FGVPQ R R++I+ F        F +P P   +  L DILEE  +  K  +SN+ 
Sbjct: 145 LNARYFGVPQNRPRIFIVGFREDLNIYHFSYPQPTHPETCLKDILEEKEVSVKYYLSNQY 204

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN 83
            E   K K  ++  G GFGY +   +
Sbjct: 205 LETLFKHKARHENKGNGFGYEIISPD 230


>gi|167854713|ref|ZP_02477492.1| cell division protein MukB [Haemophilus parasuis 29755]
 gi|167854127|gb|EDS25362.1| cell division protein MukB [Haemophilus parasuis 29755]
          Length = 361

 Score =  120 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F        F +P PL  K    D+ E++ +  K  +S + 
Sbjct: 181 LNAKDFGVPQNRERIFIVGFRQDLAINSFYYPAPLNRKVCFNDVKEKNVVPTKYYLSTQY 240

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            E  +K K  ++  G GFGY +   +    N +
Sbjct: 241 IETLRKHKARHQDKGNGFGYEII-PDDGIANAI 272


>gi|169334482|ref|ZP_02861675.1| hypothetical protein ANASTE_00885 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259199|gb|EDS73165.1| hypothetical protein ANASTE_00885 [Anaerofustis stercorihominis DSM
           17244]
          Length = 337

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + + +FGVPQ RER+YI+ F N     +F FPTP+    ++ DI+EE  +  K  +S+  
Sbjct: 156 LNSRNFGVPQNRERIYIVAFRNDIAPKDFIFPTPIDENKKIKDIMEEKPVSPKYYLSDVY 215

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF 81
            E  +K K  ++  G GFGY +  
Sbjct: 216 LETLRKHKARHEAKGNGFGYEIRD 239


>gi|219870523|ref|YP_002474898.1| Type II modification methyltransferase HpaII/DNA
           (cytosine-5-)-methyltransferase [Haemophilus parasuis
           SH0165]
 gi|219690727|gb|ACL31950.1| Type II modification methyltransferase HpaII/DNA
           (cytosine-5-)-methyltransferase [Haemophilus parasuis
           SH0165]
          Length = 350

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F        F +P PL  K    D+ E++ +  K  +S + 
Sbjct: 170 LNAKDFGVPQNRERIFIVGFRQDLAINSFYYPAPLNRKVCFNDVKEKNVVPTKYYLSTQY 229

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            E  +K K  ++  G GFGY +   +    N +
Sbjct: 230 IETLRKHKARHQDKGNGFGYEII-PDDGIANAI 261


>gi|27497145|gb|AAO17336.1| methylase [Neisseria lactamica]
          Length = 384

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +    F++P P GI+    DI E+  +  K  +S + 
Sbjct: 202 VNAKDFGVPQNRERIFIVGFRGDTDIKYFEYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 261

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +  +K K+ ++  G GFGY +   +    N +
Sbjct: 262 IDTLRKHKQRHEEKGNGFGYEIIS-DDGIANAI 293


>gi|213053049|ref|ZP_03345927.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
          Length = 169

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 33  LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTL 90
              +P L ++LE  ++ K  ++  LW+   +  + ++  G GFGYG+ + ++      TL
Sbjct: 1   PPRRPTLAELLEPVVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTL 60

Query: 91  SARYYKDGSEI 101
           SARYYKDG+EI
Sbjct: 61  SARYYKDGAEI 71


>gi|213027601|ref|ZP_03342048.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. 404ty]
          Length = 176

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 33  LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTL 90
              +P L ++LE  ++ K  ++  LW+   +  + ++  G GFGYG+ + ++      TL
Sbjct: 8   PPRRPTLAELLEPVVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTL 67

Query: 91  SARYYKDGSEI 101
           SARYYKDG+EI
Sbjct: 68  SARYYKDGAEI 78


>gi|166368121|ref|YP_001660394.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
 gi|166090494|dbj|BAG05202.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
          Length = 347

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + A  FGVPQ R R++I+ F        F +P P   +  L DILEE  +  K  +SN+ 
Sbjct: 145 LNARYFGVPQNRPRIFIVGFREDLNIYHFSYPQPTHQETCLKDILEEKEVSVKYYLSNQY 204

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN 83
            E   K K  ++  G GFGY +   +
Sbjct: 205 LETLFKHKARHQHKGNGFGYEIISTD 230


>gi|309378773|emb|CBX22599.1| putative DNA cytosine methyltransferase [Neisseria lactamica
           Y92-1009]
          Length = 342

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +    F++P P GI+    DI E+  +  K  +S + 
Sbjct: 160 VNAKDFGVPQNRERIFIVGFRGDTDIKYFEYPEPTGIQTAFRDIREKDTVPTKYYLSTQY 219

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +  +K K+ ++  G GFGY +   +    N +
Sbjct: 220 IDTLRKHKQRHEEKGNGFGYEIIS-DDGIANAI 251


>gi|290969050|ref|ZP_06560585.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781006|gb|EFD93599.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1
           str. 28L]
          Length = 333

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + + DFGVPQ RER+YI+ F        F+FP        + DI+EE     K  +S+  
Sbjct: 147 LNSKDFGVPQNRERIYIVAFREDIAPNTFRFPEKTDDTKVIADIMEEKEPSSKYYLSDVY 206

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
               +K K+ ++  G GFGY +   +S
Sbjct: 207 LASLRKHKQRHQAKGNGFGYEIRGVHS 233


>gi|127459|sp|P15446|MTH2_HAEPA RecName: Full=Modification methylase HpaII; Short=M.HpaII; AltName:
           Full=Cytosine-specific methyltransferase HpaII
 gi|43630|emb|CAA35705.1| unnamed protein product [Haemophilus parainfluenzae]
 gi|305377|gb|AAA20481.1| HpaII modification methyltransferase [Haemophilus parainfluenzae]
          Length = 358

 Score =  117 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A +FGVPQ RER+YI+ F   +    F +P PL       DI EE  +  K  +S + 
Sbjct: 176 VNAKNFGVPQNRERIYIVGFHKSTGVNSFSYPEPLDKIVTFADIREEKTVPTKYYLSTQY 235

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +  +K KE ++  G GFGY +   +    N +
Sbjct: 236 IDTLRKHKERHESKGNGFGYEII-PDDGIANAI 267


>gi|167751356|ref|ZP_02423483.1| hypothetical protein EUBSIR_02342 [Eubacterium siraeum DSM 15702]
 gi|167655602|gb|EDR99731.1| hypothetical protein EUBSIR_02342 [Eubacterium siraeum DSM 15702]
          Length = 475

 Score =  116 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + + +FGVPQ RER+YI+ F N     +F+FP       R+ DI+EE+ +  K  +S+  
Sbjct: 294 LNSKNFGVPQNRERIYIVAFRNDIAPEKFEFPQGNDDTKRIKDIIEENPVPAKYYLSDVY 353

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
            E  ++ K  ++  G GFGY +     
Sbjct: 354 LETLRRHKARHESKGNGFGYEVRGMED 380


>gi|149369548|ref|ZP_01889400.1| C-5 cytosine-specific DNA-methylase [unidentified eubacterium
           SCB49]
 gi|149356975|gb|EDM45530.1| C-5 cytosine-specific DNA-methylase [unidentified eubacterium
           SCB49]
          Length = 421

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + A  FGVPQ RER++I+ F        FK+P P   +  L +ILE E +  K  +S   
Sbjct: 241 LNAKKFGVPQNRERIFIVGFRKDLGINNFKYPEPTDTEAILENILEAEEVSVKYYLSEVY 300

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTN 88
            +  +  +  ++  G GFGY +   N+ T N
Sbjct: 301 LQTLRNHRARHESKGNGFGYEII-PNNGTAN 330


>gi|300813374|ref|ZP_07093725.1| Modification methylase HpaII [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300512517|gb|EFK39666.1| Modification methylase HpaII [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 347

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 32/87 (36%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + + DFGVPQ RER+YI+ F       +F FP        + DI+EE     K  +S+  
Sbjct: 147 INSKDFGVPQNRERIYIVAFREDISPNKFIFPEETDDTKVIADIMEEKETSPKYYLSDVY 206

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
            E  +K K+ +K  G GFGY +   NS
Sbjct: 207 LESLRKHKQRHKAKGNGFGYEIRDVNS 233


>gi|313892290|ref|ZP_07825883.1| modification methylase HpaII [Dialister microaerophilus UPII 345-E]
 gi|313119428|gb|EFR42627.1| modification methylase HpaII [Dialister microaerophilus UPII 345-E]
          Length = 329

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 31/87 (35%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + + +FGVPQ RER+YI+ F N      F FP     +  L DI+E E +  +  +S   
Sbjct: 147 LNSKNFGVPQNRERIYIVAFRNDISPENFDFPEGTDTEKTLKDIIEKEEVSSRYYLSETY 206

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
                K KE  K  G GFGY +   +S
Sbjct: 207 LNSLIKHKERQKAKGNGFGYEIRQMDS 233


>gi|327403407|ref|YP_004344245.1| DNA-cytosine methyltransferase [Fluviicola taffensis DSM 16823]
 gi|327318915|gb|AEA43407.1| DNA-cytosine methyltransferase [Fluviicola taffensis DSM 16823]
          Length = 422

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 4/91 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           M A +FGVPQ RER++I+ F        F++P P+       D+ EE  +  K  +S   
Sbjct: 241 MNAKNFGVPQNRERIFIVGFRKDLNIDSFEYPLPVSKSVTFQDVREEKEVSVKYYLSETY 300

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTN 88
                K KE +   G GFG+ +   +    N
Sbjct: 301 LNTLVKHKERHASKGNGFGFEII-PDDGIAN 330


>gi|326798326|ref|YP_004316145.1| DNA-cytosine methyltransferase [Sphingobacterium sp. 21]
 gi|326549090|gb|ADZ77475.1| DNA-cytosine methyltransferase [Sphingobacterium sp. 21]
          Length = 409

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-EEHIDDKSTISNKL 57
           + A +FGVPQ RER++I+ +        F++P PL     + DI  EE +  K  +S + 
Sbjct: 229 VNAKNFGVPQNRERIFIVGYRKDLGIDRFEYPEPLDEPVAIEDIFEEEEVSVKYYLSTQY 288

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTN 88
            +  ++ K  ++  G GFG+ +   N    N
Sbjct: 289 LKTLKEHKARHESKGNGFGFEII-PNDGIAN 318


>gi|154484133|ref|ZP_02026581.1| hypothetical protein EUBVEN_01844 [Eubacterium ventriosum ATCC
           27560]
 gi|149735175|gb|EDM51061.1| hypothetical protein EUBVEN_01844 [Eubacterium ventriosum ATCC
           27560]
          Length = 366

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + + DFGVPQ RER+YI+ F     S  F+FP        + DI+EE  +  K  +S   
Sbjct: 164 LNSKDFGVPQNRERIYIVAFRKDINSENFEFPVGNKPDTCIRDIMEEQEVSVKYYLSTTY 223

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN 83
            E  ++ K  +   G GFGY +   +
Sbjct: 224 IETLKRHKARHAAKGNGFGYEIRDLD 249


>gi|150026305|ref|YP_001297131.1| Type II modification methyltransferase HpaII [Flavobacterium
           psychrophilum JIP02/86]
 gi|149772846|emb|CAL44330.1| Type II modification methyltransferase HpaII [Flavobacterium
           psychrophilum JIP02/86]
          Length = 425

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDD-KSTISNKL 57
           + A +FGVPQ RER+YI+ F        F++P PL   P    + E+ +   K  +S + 
Sbjct: 239 VNAKNFGVPQNRERIYIVGFRQDLNISSFEYPEPLENNPTFESVKEKLVPPTKYYLSTQY 298

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +     K  +   G GFGY +   ++   N +
Sbjct: 299 VQTLINHKARHASKGNGFGYAII-PDNGIANAI 330


>gi|291530358|emb|CBK95943.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3]
          Length = 696

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + + +FGVPQ RER+YI+ F N      F FP        L DI E + +  K  +S+  
Sbjct: 154 LNSKNFGVPQNRERIYIVAFRNDIAPDNFDFPESTDTNKCLLDIRERNPVPAKYYLSDVY 213

Query: 58  WEGHQKRKENNKIAGKGFGYGL 79
            +  +K K  ++  G GFGY +
Sbjct: 214 VDTLRKHKARHEAKGNGFGYEI 235


>gi|292670064|ref|ZP_06603490.1| modification methylase EcoRII [Selenomonas noxia ATCC 43541]
 gi|292648252|gb|EFF66224.1| modification methylase EcoRII [Selenomonas noxia ATCC 43541]
          Length = 377

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + + DFGVPQ RER+YI+ F N   S  F FP        + DI+E E +  K  +S   
Sbjct: 181 LNSKDFGVPQNRERIYIVAFRNDIDSTGFAFPEGHDSNTTIRDIMEAEEVSVKYYLSTVY 240

Query: 58  WEGHQKRKENNKIAGKGFGY 77
               ++ K +++  G GFGY
Sbjct: 241 LASLRRHKAHHEALGHGFGY 260


>gi|282859944|ref|ZP_06269032.1| DNA (cytosine-5-)-methyltransferase [Prevotella bivia JCVIHMP010]
 gi|282587347|gb|EFB92564.1| DNA (cytosine-5-)-methyltransferase [Prevotella bivia JCVIHMP010]
          Length = 448

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + A +FGVPQ RER+YI+ F        F +P P        DI E   +  K  +S   
Sbjct: 258 LNAANFGVPQHRERVYIVGFRKDLNIKAFNYPMPTDNSKTFADIKEATTVSSKYYLSTTY 317

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +     K  +   G GFGY +   ++   N +
Sbjct: 318 LDTLIAHKARHAAKGHGFGYEIIS-DTGIANAI 349


>gi|313674544|ref|YP_004052540.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
 gi|312941242|gb|ADR20432.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
          Length = 420

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + A D+GVPQ+RER++I+ F        F++P P        D+ EE  +  K  +SN  
Sbjct: 242 INAKDYGVPQKRERIFIVGFRKDLKIETFEYPEPSKSPVSFEDVKEEEPVSVKYYLSNTY 301

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN 83
               +K K  +   G GFGY +  ++
Sbjct: 302 LNTLKKHKARHLGKGNGFGYAVIADD 327


>gi|255514225|gb|EET90487.1| DNA-cytosine methyltransferase [Candidatus Micrarchaeum acidiphilum
           ARMAN-2]
          Length = 328

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 14/113 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---------GIKPRLGD----ILEEHI 47
           + A ++GVPQ+R+R++ I       E     P+         G+KP +      +  + +
Sbjct: 156 LNAANYGVPQKRQRIFFIGVNRRQAEKAILPPVPTHSEHPTNGLKPWVPSKQFLLPPQKV 215

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
             +   S ++  G  +RK+ N     GFG+  F + S  +NT+SARY+KDG+E
Sbjct: 216 SKRFYYSERMINGFIRRKKKNAERNIGFGWQ-FLDFSKPSNTISARYWKDGAE 267


>gi|49476998|ref|YP_035184.1| modification methylase HpaII (cytosine-specific methyltransferase
           HpaII) [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|49328554|gb|AAT59200.1| modification methylase HpaII (Cytosine-specific methyltransferase
           HpaII) [Bacillus thuringiensis serovar konkukian str.
           97-27]
          Length = 373

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 14/106 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--------FKFPTPLGIKP---RLGDILEEHIDD 49
           + + +FGVPQ R R+YI+ F              F  P     K     + D+LE+++ +
Sbjct: 164 LNSRNFGVPQNRPRIYIVGFNQRLYRDKIESMPLFTLPKSRSRKKIYDSVRDVLEDNVGE 223

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFE---NSATTNTLSA 92
           K  +S    E  +K KE     G GFGY +       +  +N L A
Sbjct: 224 KYYLSEGYLETLKKHKEAQGKKGNGFGYSIVNLPEIENPVSNALLA 269


>gi|254282099|ref|ZP_04957067.1| modification methylase SsoII [gamma proteobacterium NOR51-B]
 gi|219678302|gb|EED34651.1| modification methylase SsoII [gamma proteobacterium NOR51-B]
          Length = 356

 Score = 96.5 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 5/97 (5%)

Query: 8   VPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           V QRR R +++   N        F+FP        L  +L +  D K T+S+K+W GH+ 
Sbjct: 192 VAQRRVRCFMVAVRNDIAANRGAFEFPKFPEGSIPLRSVLSKEPDPKYTLSDKMWAGHKA 251

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           R   N   G GF   L       +NT+ ARY KD  E
Sbjct: 252 RTIRNVERGTGFT-ALEANLDKPSNTIVARYGKDAKE 287


>gi|113971536|ref|YP_735329.1| DNA-cytosine methyltransferase [Shewanella sp. MR-4]
 gi|113886220|gb|ABI40272.1| DNA-cytosine methyltransferase [Shewanella sp. MR-4]
          Length = 417

 Score = 95.4 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/100 (38%), Positives = 50/100 (50%), Gaps = 8/100 (8%)

Query: 8   VPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEE---HIDDKSTISNKLWEG 60
           V QRR R +++            FKFP   G    L D LEE    + ++ TIS++LWEG
Sbjct: 254 VAQRRVRCFMVCVREDVFQEFGAFKFPEFEGEPIPLRDALEELTAELMEEYTISDRLWEG 313

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           H  R + N   G GF   +   N   +NT+ ARY KDG E
Sbjct: 314 HINRTQRNLDRGTGFTAHVADLNRP-SNTIVARYGKDGKE 352


>gi|323968854|gb|EGB64190.1| DNA-cytosine methyltransferase [Escherichia coli TA007]
          Length = 272

 Score = 92.7 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 4/57 (7%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSD 271


>gi|238917714|ref|YP_002931231.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC
           27750]
 gi|238873074|gb|ACR72784.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC
           27750]
          Length = 311

 Score = 90.4 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + + D+GVPQ R R YI+ F N +  F+FP    +   L D+LE  +DDK  +S+++   
Sbjct: 148 LNSADYGVPQTRNRTYIVCFDNQNARFEFPEKKKLNKTLQDLLEPEVDDKYFLSDRILPT 207

Query: 61  HQK-----RKENNKI 70
                    K  ++I
Sbjct: 208 ILSDGTGGYKAKSEI 222


>gi|119493789|ref|ZP_01624358.1| type II restriction enzyme HaeII [Lyngbya sp. PCC 8106]
 gi|119452484|gb|EAW33671.1| type II restriction enzyme HaeII [Lyngbya sp. PCC 8106]
          Length = 689

 Score = 90.4 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 6/86 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID-DKSTISNKLWE 59
           + A DFG+PQ+RER YI+ FL  ++ F FP P+  +  L +ILE     DKS  +++  +
Sbjct: 150 LNALDFGLPQKRERTYIVGFL-ENIHFSFPKPIQKRVSLSEILEPDEQVDKSLFASEFIQ 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSA 85
               +K   ++  K F   ++ EN +
Sbjct: 209 ----KKRIQRLKVKPFYPSIWHENKS 230


>gi|237742049|ref|ZP_04572530.1| modification methylase HpaII [Fusobacterium sp. 4_1_13]
 gi|229429697|gb|EEO39909.1| modification methylase HpaII [Fusobacterium sp. 4_1_13]
          Length = 385

 Score = 87.7 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 12/102 (11%)

Query: 3   ACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLG------DILEEHIDDKSTI 53
           A DFG+PQRR R YII F         F        +  L       D+LE   D K  +
Sbjct: 170 AKDFGIPQRRLRTYIIGFRKDLLQDNNFILEPLPKNRTDLKIYKNLNDLLEFQNDIKYYV 229

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFEN---SATTNTLSA 92
           ++   +  ++ K  + + G GFG+ +       +   NT+ A
Sbjct: 230 ASGYLKTLERHKLKHSLKGNGFGFEVVNAPNIKNPIANTILA 271


>gi|288559284|ref|YP_003422770.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1]
 gi|288541994|gb|ADC45878.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1]
          Length = 339

 Score = 87.3 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK--STISNKLW 58
           + + D+GVPQ RER++I+ F +    FKFP P   K  + D+LE+++ D   S I++   
Sbjct: 170 LNSKDYGVPQNRERIFIVGFKDNVNTFKFPLPFENKANINDLLEKNVKDHELSGIASDHL 229

Query: 59  EGHQKRKENNKIAGKGF 75
           + H +    NK   K +
Sbjct: 230 KKHYEEFLKNKKVNKNY 246


>gi|296114006|ref|YP_003627944.1| DNA-cytosine methyltransferase [Moraxella catarrhalis RH4]
 gi|295921700|gb|ADG62051.1| DNA-cytosine methyltransferase [Moraxella catarrhalis RH4]
          Length = 410

 Score = 87.3 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + D+G+PQ RER+++I F N P   F+FP P+ ++  + D LE++ D K  +  K  +
Sbjct: 182 LNSKDYGIPQHRERIFVIGFKNKPKNGFEFPQPIELEYTMQDFLEDYTDSKYFLKEKGIK 241

Query: 60  GHQKRKENNK 69
                K   K
Sbjct: 242 FVTSSKNRQK 251


>gi|326573696|gb|EGE23654.1| DNA-cytosine methyltransferase [Moraxella catarrhalis O35E]
          Length = 408

 Score = 86.9 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + D+G+PQ RER+++I F N P   F+FP P+ ++  + D LE++ D K  +  K  +
Sbjct: 180 LNSKDYGIPQHRERIFVIGFKNKPKNGFEFPQPIELEYTMQDFLEDYTDSKYFLKEKGIK 239

Query: 60  GHQKRKENNK 69
                K   K
Sbjct: 240 FVTSSKNRQK 249


>gi|282879499|ref|ZP_06288233.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS
           5C-B1]
 gi|281306646|gb|EFA98672.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS
           5C-B1]
          Length = 438

 Score = 86.1 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 4/70 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE- 59
           + + D+G+PQ RER++ I F  P V+F FP P+ ++ ++ D LE+++D K  +  K  + 
Sbjct: 208 LNSKDYGIPQHRERIFCIGFHTP-VKFAFPAPIPLEYKMYDFLEDYVDTKYFLKEKGIKF 266

Query: 60  --GHQKRKEN 67
              H+   + 
Sbjct: 267 VTSHKNHTKC 276


>gi|167746073|ref|ZP_02418200.1| hypothetical protein ANACAC_00768 [Anaerostipes caccae DSM 14662]
 gi|167654588|gb|EDR98717.1| hypothetical protein ANACAC_00768 [Anaerostipes caccae DSM 14662]
          Length = 312

 Score = 85.0 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   D+G+PQ R R YI+ F N + EF+FP    +   L D+LE  +DDK  +S ++   
Sbjct: 148 LNTADYGIPQTRNRTYIVCFANDNAEFEFPDKQELNLTLQDLLETEVDDKYFLSERILPT 207

Query: 61  HQK-----RKENNKI 70
                    K  ++I
Sbjct: 208 ILSDGTGGYKAKSEI 222


>gi|255279955|ref|ZP_05344510.1| modification methylase EcoRII [Bryantella formatexigens DSM 14469]
 gi|255269728|gb|EET62933.1| modification methylase EcoRII [Bryantella formatexigens DSM 14469]
          Length = 311

 Score = 84.6 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + DFGVPQ R R Y++ F N   EF FP    ++  L D+LE+ + +K  +S ++ 
Sbjct: 148 LNSADFGVPQTRNRTYLVCFSNQKAEFTFPQTEPLESTLQDLLEQDVAEKYFLSERII 205


>gi|170757755|ref|YP_001781752.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str.
           Okra]
 gi|169122967|gb|ACA46803.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str.
           Okra]
          Length = 561

 Score = 84.2 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 10/96 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+G+PQ RER++I+       +  F FP       RL D LE  +D+K  IS K  
Sbjct: 149 LNAKDYGIPQNRERVFIVSIRKDIDTGIFSFPKGFDNGLRLKDFLENEVDEKYYISEKAT 208

Query: 59  EGHQKR-KENNKIAGKGFGYGLFFENSATTNTLSAR 93
           +G  +  K  +          +  ++S  + TL  R
Sbjct: 209 QGLLRALKRPHTPK-------MLNKDSEYSPTLDTR 237


>gi|167747653|ref|ZP_02419780.1| hypothetical protein ANACAC_02374 [Anaerostipes caccae DSM 14662]
 gi|239625035|ref|ZP_04668066.1| modification methylase Rho11sI [Clostridiales bacterium 1_7_47_FAA]
 gi|167653015|gb|EDR97144.1| hypothetical protein ANACAC_02374 [Anaerostipes caccae DSM 14662]
 gi|239521421|gb|EEQ61287.1| modification methylase Rho11sI [Clostridiales bacterium 1_7_47FAA]
          Length = 504

 Score = 84.2 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 42/72 (58%), Gaps = 6/72 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN--- 55
           + A ++G+PQ RER+Y++       + +F FP P+    RL DILE+ +D+K  +S+   
Sbjct: 158 LNAKNYGIPQNRERVYLVLIKKECDNGKFVFPEPMENGRRLMDILEDEVDEKYYLSDDKV 217

Query: 56  -KLWEGHQKRKE 66
            KL    ++RK 
Sbjct: 218 QKLITDMKERKA 229


>gi|323152708|gb|EFZ38980.1| DNA-cytosine methyltransferase [Escherichia coli EPECa14]
          Length = 374

 Score = 83.8 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 29/70 (41%), Gaps = 8/70 (11%)

Query: 4   CDFGVPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNK 56
             F +PQ RER+ ++ F    N   +F            +  L  +L+  ++ K  ++  
Sbjct: 269 KHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYILTPV 327

Query: 57  LWEGHQKRKE 66
           LW+   +  +
Sbjct: 328 LWKYLYRYAK 337


>gi|315608882|ref|ZP_07883855.1| modification methylase EcoRII [Prevotella buccae ATCC 33574]
 gi|315249409|gb|EFU29425.1| modification methylase EcoRII [Prevotella buccae ATCC 33574]
          Length = 312

 Score = 83.8 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 3/66 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI--KPRLGDILEEHIDDKSTISNKLW 58
           + A DFG+PQ+RER+ I+ F + ++ F FPTP+ I  +  L DILE  +D K  + +K+ 
Sbjct: 147 LNALDFGIPQKRERIIIVGFKD-NILFSFPTPVPISQRKTLKDILEIDVDKKYYVKDKIR 205

Query: 59  EGHQKR 64
           E    R
Sbjct: 206 ESRLMR 211


>gi|254443346|ref|ZP_05056822.1| C-5 cytosine-specific DNA methylase superfamily [Verrucomicrobiae
           bacterium DG1235]
 gi|198257654|gb|EDY81962.1| C-5 cytosine-specific DNA methylase superfamily [Verrucomicrobiae
           bacterium DG1235]
          Length = 349

 Score = 83.0 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           +KA DFG+ Q+RER++I+ F        F +P     + ++ DILE  H   +  ++ K 
Sbjct: 176 LKASDFGLAQKRERVFIVGFRKSLGVEGFSYPEKGNDRSKISDILEPSHSVGQWLLTKKS 235

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN 83
               +      K+AG G GY +  EN
Sbjct: 236 LACLRDHSSKQKLAGNGHGYAILDEN 261


>gi|16923911|gb|AAL31632.1|AF438204_2 C5 DNA methyltransferase [Positive selection vector pMTet1]
          Length = 418

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 9/97 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  FG+PQ+R+R Y++ FLN ++ F+FP P  I   +G++LE  +    +IS  L + 
Sbjct: 246 LDASHFGIPQKRKRFYLVAFLNQNIHFEFPKPPMISKDIGEVLESDVTG-YSISEHLQKS 304

Query: 61  HQKRKENNKIAGKGFGYGLFFEN-SATTNTLSARYYK 96
           +  +K++ K         L  +N +    TL + Y+K
Sbjct: 305 YLFKKDDGK-------PSLIDKNTTGAVKTLVSTYHK 334


>gi|127464|sp|P11408|MTM1_MORSP RecName: Full=Modification methylase MspI; Short=M.MspI; AltName:
           Full=Cytosine-specific methyltransferase MspI
 gi|44539|emb|CAA32393.1| unnamed protein product [Moraxella sp.]
          Length = 418

 Score = 82.7 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 53/97 (54%), Gaps = 9/97 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  FG+PQ+R+R Y++ FLN ++ F+FP P  I   +G++LE  +    +IS  L + 
Sbjct: 246 LDASHFGIPQKRKRFYLVAFLNQNIHFEFPKPPMISKDIGEVLESDVTG-YSISEHLQKS 304

Query: 61  HQKRKENNKIAGKGFGYGLFFEN-SATTNTLSARYYK 96
           +  +K++ K         L  +N +    TL + Y+K
Sbjct: 305 YLFKKDDGK-------PSLIDKNTTGAVKTLVSTYHK 334


>gi|159026805|emb|CAO86650.1| ngoBIM [Microcystis aeruginosa PCC 7806]
          Length = 331

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FG+PQ+RER++I+ F      F +P P   +  L +ILEE++ D    S K+ + 
Sbjct: 156 LNALNFGLPQKRERIFIVGFREAR-GFIWPKPALSRTSLTEILEENVSDFYYASEKIQKS 214

Query: 61  HQKRKENNK 69
              ++E  K
Sbjct: 215 RLLKREGKK 223


>gi|281420730|ref|ZP_06251729.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205]
 gi|281405022|gb|EFB35702.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205]
          Length = 432

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + +CD+G+PQ RER++ + F  P+ +FK+P P+ ++ ++ D LE++ID K  +  K  + 
Sbjct: 203 LNSCDYGIPQHRERVFCLGFKKPT-DFKYPAPIKLEYKMYDFLEDYIDTKYFLKEKGIKF 261

Query: 61  HQKRKENNKI 70
               K   K 
Sbjct: 262 VTSHKNREKS 271


>gi|317497298|ref|ZP_07955621.1| C-5 cytosine-specific DNA methylase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316895367|gb|EFV17526.1| C-5 cytosine-specific DNA methylase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 363

 Score = 82.7 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 36/56 (64%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+GVPQ RER++ I  LN   +F+FP    +K +L DILE+++D K  + N 
Sbjct: 204 LNARDYGVPQNRERVFCISELNGENKFEFPKSRELKLKLYDILEKNVDSKYYLKNN 259


>gi|291087089|ref|ZP_06345376.2| modification methylase HpaII [Clostridium sp. M62/1]
 gi|291076158|gb|EFE13522.1| modification methylase HpaII [Clostridium sp. M62/1]
          Length = 490

 Score = 82.3 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 40/103 (38%), Gaps = 12/103 (11%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR---------LGDILEEHIDDKST 52
              +FG+PQ R R+YI+ F                P          + DIL+  + ++  
Sbjct: 182 NTRNFGLPQNRPRVYIVAFSRNYFGEHLKLIPERTPEKSEKVIFKSVRDILDVDVSERFF 241

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENS---ATTNTLSA 92
           +S+ L +  ++ K   K  G GFG  +           +T+ A
Sbjct: 242 LSSGLLKTLEEHKARQKRNGNGFGCRIANATEIECPIASTILA 284


>gi|306828113|ref|ZP_07461376.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pyogenes ATCC
           10782]
 gi|304429650|gb|EFM32696.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pyogenes ATCC
           10782]
          Length = 214

 Score = 82.3 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 32/55 (58%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A D+GVPQ RER++ +  L     + FP    +  RL D+LEE +D+K  +S 
Sbjct: 150 LNAKDYGVPQNRERVFCVSILGDHEPYIFPEKQELTIRLKDVLEEDVDEKYYLSE 204


>gi|288576182|ref|ZP_05978340.2| DNA (cytosine-5-)-methyltransferase [Neisseria mucosa ATCC 25996]
 gi|288566126|gb|EFC87686.1| DNA (cytosine-5-)-methyltransferase [Neisseria mucosa ATCC 25996]
          Length = 406

 Score = 81.9 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F   P+  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 179 MNSKDYGIPQHRERIFVVGFHTPPTNGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 235


>gi|319956919|ref|YP_004168182.1| DNA-cytosine methyltransferase [Nitratifractor salsuginis DSM
           16511]
 gi|319419323|gb|ADV46433.1| DNA-cytosine methyltransferase [Nitratifractor salsuginis DSM
           16511]
          Length = 394

 Score = 81.9 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           +    +G+PQ RER +++ F + +    F+FP  + +K  L D+LE  +D+K  +++K  
Sbjct: 145 LNTKHYGLPQNRERYFLVGFKSKTAGERFRFPKKVPLKLILSDVLENKVDEKYYLTDKAL 204

Query: 59  EGHQKRKENNKIAGKG 74
           E        N+  G G
Sbjct: 205 EYM------NRDTGDG 214


>gi|145629543|ref|ZP_01785341.1| modification methylase HaeII [Haemophilus influenzae 22.1-21]
 gi|144978386|gb|EDJ88150.1| modification methylase HaeII [Haemophilus influenzae 22.1-21]
          Length = 219

 Score = 81.5 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 10/94 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ FL+  + F+FP P+G    L +ILE    + +   +S++L 
Sbjct: 45  LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL- 102

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
               KRK  + I        ++ EN   +  +SA
Sbjct: 103 ----KRKRLSSITKDVPYPSIWHEN--ISGNVSA 130


>gi|56461628|ref|YP_156909.1| DNA cytosine methylase [Idiomarina loihiensis L2TR]
 gi|56180638|gb|AAV83360.1| DNA cytosine methylase [Idiomarina loihiensis L2TR]
          Length = 419

 Score = 81.5 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 9/97 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ R+R Y++ F      F FP P  IK  +G +LE+   +  +IS  L + 
Sbjct: 240 LNASDFGVPQNRKRFYLVAFDGKDCGFSFPQPPMIKADIGTLLEKG-AEGYSISEHLQKT 298

Query: 61  HQKRKENNKIAGKGFGYGLFFEN-SATTNTLSARYYK 96
           +  +K++ +         L   N      TL + Y+K
Sbjct: 299 YLFKKDDGR-------PILIDRNTKGPMRTLVSSYHK 328


>gi|161869767|ref|YP_001598934.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
 gi|161595320|gb|ABX72980.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
          Length = 411

 Score = 81.5 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|218767941|ref|YP_002342453.1| putative modification methylase [Neisseria meningitidis Z2491]
 gi|6900408|emb|CAB72018.1| putative cytosine-specific methyltransferase [Neisseria
           meningitidis]
 gi|121051949|emb|CAM08255.1| putative modification methylase [Neisseria meningitidis Z2491]
          Length = 411

 Score = 81.5 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|148826843|ref|YP_001291596.1| modification methylase HaeII [Haemophilus influenzae PittGG]
 gi|148718085|gb|ABQ99212.1| modification methylase HaeII [Haemophilus influenzae PittGG]
          Length = 318

 Score = 81.5 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 10/94 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ FL+  + F+FP P+G    L +ILE    + +   +S++L 
Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL- 201

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
               KRK  + I        ++ EN   +  +SA
Sbjct: 202 ----KRKRLSSITKDVPYPSIWHEN--ISGNVSA 229


>gi|319776347|ref|YP_004138835.1| Cytosine-specific methyltransferase [Haemophilus influenzae F3047]
 gi|329123500|ref|ZP_08252064.1| modification methylase HaeII [Haemophilus aegyptius ATCC 11116]
 gi|317450938|emb|CBY87164.1| Cytosine-specific methyltransferase [Haemophilus influenzae F3047]
 gi|327471082|gb|EGF16537.1| modification methylase HaeII [Haemophilus aegyptius ATCC 11116]
          Length = 318

 Score = 81.5 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 10/94 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ FL+  + F+FP P+G    L +ILE    + +   +S++L 
Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL- 201

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
               KRK  + I        ++ EN   +  +SA
Sbjct: 202 ----KRKRLSSITKDVPYPSIWHEN--ISGNVSA 229


>gi|325127899|gb|EGC50802.1| DNA-cytosine methyltransferase [Neisseria meningitidis N1568]
          Length = 411

 Score = 81.5 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|304387865|ref|ZP_07370039.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|254670653|emb|CBA06706.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha153]
 gi|254672637|emb|CBA06420.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha275]
 gi|261392815|emb|CAX50396.1| putative type II restriction-modification system enzyme Mod
           [Neisseria meningitidis 8013]
 gi|304338130|gb|EFM04266.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|319410190|emb|CBY90526.1| putative type II restriction-modification system enzyme Mod
           [Neisseria meningitidis WUE 2594]
 gi|325134031|gb|EGC56686.1| DNA-cytosine methyltransferase [Neisseria meningitidis M13399]
 gi|325203903|gb|ADY99356.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240355]
          Length = 411

 Score = 81.5 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|15676724|ref|NP_273868.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis MC58]
 gi|7226061|gb|AAF41239.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis MC58]
 gi|308389005|gb|ADO31325.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha710]
 gi|316984499|gb|EFV63467.1| modification methylase HpaII [Neisseria meningitidis H44/76]
 gi|325129944|gb|EGC52743.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304]
 gi|325140023|gb|EGC62552.1| DNA-cytosine methyltransferase [Neisseria meningitidis CU385]
 gi|325206334|gb|ADZ01787.1| DNA-cytosine methyltransferase [Neisseria meningitidis M04-240196]
          Length = 411

 Score = 81.5 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|121634611|ref|YP_974856.1| putative modification methylase [Neisseria meningitidis FAM18]
 gi|4887086|gb|AAD32180.1|AF125564_2 putative site specific DNA methyltransferase [Neisseria
           meningitidis]
 gi|120866317|emb|CAM10058.1| putative modification methylase [Neisseria meningitidis FAM18]
 gi|325132026|gb|EGC54724.1| DNA-cytosine methyltransferase [Neisseria meningitidis M6190]
 gi|325135954|gb|EGC58564.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579]
 gi|325137780|gb|EGC60355.1| DNA-cytosine methyltransferase [Neisseria meningitidis ES14902]
 gi|325142075|gb|EGC64502.1| DNA-cytosine methyltransferase [Neisseria meningitidis 961-5945]
 gi|325198036|gb|ADY93492.1| DNA-cytosine methyltransferase [Neisseria meningitidis G2136]
 gi|325202381|gb|ADY97835.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149]
 gi|325207867|gb|ADZ03319.1| DNA-cytosine methyltransferase [Neisseria meningitidis NZ-05/33]
          Length = 411

 Score = 81.5 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 240


>gi|12229852|sp|O30868|MTH2_HAEAE RecName: Full=Modification methylase HaeII; Short=M.HaeII; AltName:
           Full=Cytosine-specific methyltransferase HaeII
 gi|2425087|gb|AAB70829.1| HaeII methylase [Haemophilus aegyptius ATCC 11116]
          Length = 318

 Score = 81.5 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 10/94 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ FL+  + F+FP P+G    L +ILE    + +   +S++L 
Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL- 201

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
               KRK  + I        ++ EN   +  +SA
Sbjct: 202 ----KRKRLSSITKDVPYPSIWHEN--ISGNVSA 229


>gi|68250112|ref|YP_249224.1| modification methylase HaeII [Haemophilus influenzae 86-028NP]
 gi|68058311|gb|AAX88564.1| modification methylase HaeII [Haemophilus influenzae 86-028NP]
          Length = 318

 Score = 81.5 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 10/94 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ FL+  + F+FP P+G    L +ILE    + +   +S++L 
Sbjct: 144 LNTLDFGLPQKRERIYIVGFLD-KLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL- 201

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
               KRK  + I        ++ EN   +  +SA
Sbjct: 202 ----KRKRLSSITKDVPYPSIWHEN--ISGNVSA 229


>gi|462658|sp|P34878|MTSB_LACLC RecName: Full=Modification methylase ScrFIB; Short=M.ScrFI-B;
           Short=M.ScrFIB; AltName: Full=Cytosine-specific
           methyltransferase ScrFIB
 gi|149495|gb|AAA16838.1| methyl-5-cytosine methylase [Lactococcus lactis]
 gi|2327032|gb|AAB66694.1| 5-methyl-cytosine-methyltransferase [Lactococcus lactis subsp.
           cremoris]
 gi|739995|prf||2004282A methyl-5-cytosine methyltransferase
          Length = 360

 Score = 81.1 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A DFG+PQ RER++ I  LNP+ +F FP    +   + D+LEE++ +K  + N 
Sbjct: 201 LNARDFGIPQNRERVFCISILNPNEDFTFPQKQNLTLSMNDLLEENVSEKFYLKNN 256


>gi|325144138|gb|EGC66445.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240013]
 gi|325200491|gb|ADY95946.1| DNA-cytosine methyltransferase [Neisseria meningitidis H44/76]
          Length = 406

 Score = 81.1 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 179 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 235


>gi|313668701|ref|YP_004048985.1| modification methylase [Neisseria lactamica ST-640]
 gi|313006163|emb|CBN87625.1| putative modification methylase [Neisseria lactamica 020-06]
          Length = 372

 Score = 81.1 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 145 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 201


>gi|166367724|ref|YP_001659997.1| modification methylase NgoBI [Microcystis aeruginosa NIES-843]
 gi|166090097|dbj|BAG04805.1| modification methylase NgoBI [Microcystis aeruginosa NIES-843]
          Length = 330

 Score = 80.7 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FG+PQ+RER++I+ F      F +P P   +  L +ILEE++ D    S ++ + 
Sbjct: 156 LNALNFGLPQKRERIFIVGFREAR-GFIWPKPALSRTTLTEILEENVSDFYYASARIQKS 214

Query: 61  --HQKRKEN--------NKIAG 72
              ++  +         ++  G
Sbjct: 215 RFLKREGKKPYSEPTIWHENKG 236


>gi|170719133|ref|YP_001784281.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336]
 gi|168827262|gb|ACA32633.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336]
          Length = 408

 Score = 80.7 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + ++G+PQ RER++++ F  +P   F+FPT + ++  + D LE++ D K  +  K  +
Sbjct: 180 MNSKNYGIPQHRERIFVVGFKTSPKGGFQFPTKIPLERTMQDFLEDYTDSKYFLKEKGIK 239

Query: 60  GHQKRKENNK 69
                K   K
Sbjct: 240 FVTSSKNRQK 249


>gi|296313699|ref|ZP_06863640.1| modification methylase NgoBI [Neisseria polysaccharea ATCC 43768]
 gi|296839717|gb|EFH23655.1| modification methylase NgoBI [Neisseria polysaccharea ATCC 43768]
          Length = 315

 Score = 79.6 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LGD+LE    ++    +S+ L 
Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGDLLENDRDVEPSYFLSDAL- 199

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN 83
               K+K    +        ++ EN
Sbjct: 200 ----KQKRLAALKKAPPTPSIWHEN 220


>gi|148826164|ref|YP_001290917.1| modification methylase [Haemophilus influenzae PittEE]
 gi|148716324|gb|ABQ98534.1| modification methylase [Haemophilus influenzae PittEE]
 gi|162532590|gb|ABY16693.1| probable methylase [Haemophilus influenzae]
 gi|309973308|gb|ADO96509.1| Probable cytosine-specific DNA methyltransferase [Haemophilus
           influenzae R2846]
          Length = 409

 Score = 79.2 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + ++G+PQ RER++++ F   P   F FP  + ++  + D LE++ D K  +  K  +
Sbjct: 181 MNSKNYGIPQHRERIFVVGFKTPPQGGFMFPAEIPLEHSMQDFLEDYTDSKYYLKEKGIK 240

Query: 60  GHQKRKENNK 69
                K   K
Sbjct: 241 FVTSSKNRQK 250


>gi|268595734|ref|ZP_06129901.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae 35/02]
 gi|291044897|ref|ZP_06570606.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293397972|ref|ZP_06642178.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|268549123|gb|EEZ44541.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae 35/02]
 gi|291011791|gb|EFE03787.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291611918|gb|EFF40987.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
          Length = 320

 Score = 79.2 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE    ++    +S+ L 
Sbjct: 147 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 204

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN 83
               K+K    +        ++ EN
Sbjct: 205 ----KQKRLAALKKAPPTPSIWHEN 225


>gi|239999928|ref|ZP_04719852.1| NgoIM [Neisseria gonorrhoeae 35/02]
 gi|240116859|ref|ZP_04730921.1| NgoIM [Neisseria gonorrhoeae PID1]
 gi|240127204|ref|ZP_04739865.1| NgoIM [Neisseria gonorrhoeae SK-93-1035]
          Length = 278

 Score = 79.2 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE    ++    +S+ L 
Sbjct: 105 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 162

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN 83
               K+K    +        ++ EN
Sbjct: 163 ----KQKRLAALKKAPPTPSIWHEN 183


>gi|268597921|ref|ZP_06132088.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA19]
 gi|268551709|gb|EEZ46728.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA19]
          Length = 320

 Score = 79.2 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE    ++    +S+ L 
Sbjct: 147 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 204

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN 83
               K+K    +        ++ EN
Sbjct: 205 ----KQKRLAALKKAPPTPSIWHEN 225


>gi|194099739|ref|YP_002002874.1| NgoIM [Neisseria gonorrhoeae NCCP11945]
 gi|240013125|ref|ZP_04720038.1| NgoIM [Neisseria gonorrhoeae DGI18]
 gi|240015568|ref|ZP_04722108.1| NgoIM [Neisseria gonorrhoeae FA6140]
 gi|240114103|ref|ZP_04728593.1| NgoIM [Neisseria gonorrhoeae MS11]
 gi|240114658|ref|ZP_04728720.1| NgoIM [Neisseria gonorrhoeae PID18]
 gi|240120196|ref|ZP_04733158.1| NgoIM [Neisseria gonorrhoeae PID24-1]
 gi|240122493|ref|ZP_04735449.1| NgoIM [Neisseria gonorrhoeae PID332]
 gi|240126658|ref|ZP_04739544.1| NgoIM [Neisseria gonorrhoeae SK-92-679]
 gi|254492718|ref|ZP_05105889.1| modification methylase NgoBI [Neisseria gonorrhoeae 1291]
 gi|260441536|ref|ZP_05795352.1| NgoIM [Neisseria gonorrhoeae DGI2]
 gi|268600171|ref|ZP_06134338.1| modification methylase NgoBI [Neisseria gonorrhoeae MS11]
 gi|268600304|ref|ZP_06134471.1| modification methylase NgoBI [Neisseria gonorrhoeae PID18]
 gi|268602536|ref|ZP_06136703.1| modification methylase NgoBI [Neisseria gonorrhoeae PID1]
 gi|268681085|ref|ZP_06147947.1| modification methylase NgoBI [Neisseria gonorrhoeae PID332]
 gi|268685237|ref|ZP_06152099.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-92-679]
 gi|268685565|ref|ZP_06152427.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-93-1035]
 gi|193935029|gb|ACF30853.1| NgoIM [Neisseria gonorrhoeae NCCP11945]
 gi|226511758|gb|EEH61103.1| modification methylase NgoBI [Neisseria gonorrhoeae 1291]
 gi|268584302|gb|EEZ48978.1| modification methylase NgoBI [Neisseria gonorrhoeae MS11]
 gi|268584435|gb|EEZ49111.1| modification methylase NgoBI [Neisseria gonorrhoeae PID18]
 gi|268586667|gb|EEZ51343.1| modification methylase NgoBI [Neisseria gonorrhoeae PID1]
 gi|268621369|gb|EEZ53769.1| modification methylase NgoBI [Neisseria gonorrhoeae PID332]
 gi|268625521|gb|EEZ57921.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-92-679]
 gi|268625849|gb|EEZ58249.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-93-1035]
 gi|317165226|gb|ADV08767.1| NgoIM [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 315

 Score = 78.8 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE    ++    +S+ L 
Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 199

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN 83
               K+K    +        ++ EN
Sbjct: 200 ----KQKRLAALKKAPPTPSIWHEN 220


>gi|59802299|ref|YP_209011.1| NgoIM [Neisseria gonorrhoeae FA 1090]
 gi|240081825|ref|ZP_04726368.1| NgoIM [Neisseria gonorrhoeae FA19]
 gi|59719194|gb|AAW90599.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA 1090]
          Length = 315

 Score = 78.8 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE    ++    +S+ L 
Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 199

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN 83
               K+K    +        ++ EN
Sbjct: 200 ----KQKRLAALKKAPPTPSIWHEN 220


>gi|197303495|ref|ZP_03168534.1| hypothetical protein RUMLAC_02217 [Ruminococcus lactaris ATCC
           29176]
 gi|197297493|gb|EDY32054.1| hypothetical protein RUMLAC_02217 [Ruminococcus lactaris ATCC
           29176]
          Length = 496

 Score = 78.4 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 44/103 (42%), Gaps = 12/103 (11%)

Query: 2   KACDFGVPQRRERLYIIDFLNP---------SVEFKFPTPLGIKPRLGDILEEHIDDKST 52
              +FG+PQ R R+YI+ F            + +        I   + ++L+ ++DDK  
Sbjct: 165 NTREFGLPQNRPRVYIMAFSKKIYGNAIKLLNAQLPISRDETIFRDVTEVLDTNVDDKYY 224

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLF---FENSATTNTLSA 92
           ++    E  ++ K   K  G GFGY +     E+     T+ A
Sbjct: 225 MAEGYLETLKRHKARQKKNGYGFGYCVVNKSNEDHPIAYTILA 267


>gi|12229862|sp|Q59603|MTB1_NEIGO RecName: Full=Modification methylase NgoBI; Short=M.NgoBI; AltName:
           Full=Cytosine-specific methyltransferase NgoBI;
           Short=M.NgoI
 gi|5924404|gb|AAB03206.2| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae]
          Length = 317

 Score = 78.0 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE    ++    +S+ L 
Sbjct: 142 LNTLDFGLPQKRERIYIVGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDTL- 199

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN 83
               K+K    +        ++ EN
Sbjct: 200 ----KQKRLAALKKAPPTPSIWHEN 220


>gi|291165856|gb|EFE27903.1| modification methylase EcoRII [Filifactor alocis ATCC 35896]
          Length = 375

 Score = 77.6 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 41/104 (39%), Gaps = 13/104 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFK--------FPTPLG--IKPRLGDILEEHIDDKS 51
            + +FG+PQ R R YI+ F                 PT     +   L  +LE   + K 
Sbjct: 165 NSRNFGIPQNRPRTYIMAFNRQLYGADTLLGIGNLLPTEKNRYLYEDLNSLLEFRAEPKY 224

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFE---NSATTNTLSA 92
            +S+  +    + +E  +  G GFGY +  E        NT+ A
Sbjct: 225 YMSSGYFNTLVRHRERERKKGNGFGYRVVNEPGIEHPVANTIMA 268


>gi|219855710|ref|YP_002472832.1| hypothetical protein CKR_2367 [Clostridium kluyveri NBRC 12016]
 gi|219569434|dbj|BAH07418.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 419

 Score = 76.9 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKL 57
           M A +FG+PQRRER+ I+ F       +F FP      K  +  ILE +     +IS +L
Sbjct: 245 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTG-YSISKRL 303

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96
            E +  +K++ K         +   +S    NTL A Y+K
Sbjct: 304 QESYLFKKDDGK-------PQIVDFDSTIQVNTLVASYHK 336


>gi|153955289|ref|YP_001396054.1| DNA methylase [Clostridium kluyveri DSM 555]
 gi|146348147|gb|EDK34683.1| Predicted DNA methylase [Clostridium kluyveri DSM 555]
          Length = 416

 Score = 76.5 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKL 57
           M A +FG+PQRRER+ I+ F       +F FP      K  +  ILE +     +IS +L
Sbjct: 242 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTG-YSISKRL 300

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96
            E +  +K++ K         +   +S    NTL A Y+K
Sbjct: 301 QESYLFKKDDGK-------PQIVDFDSTIQVNTLVASYHK 333


>gi|220930232|ref|YP_002507141.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
 gi|220000560|gb|ACL77161.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
          Length = 416

 Score = 76.5 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKL 57
           M A +FG+PQRRER+ I+ F       +F FP      K  +  ILE +     +IS +L
Sbjct: 242 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTG-YSISKRL 300

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96
            E +  +K++ K         +   +S    NTL A Y+K
Sbjct: 301 QESYLFKKDDGK-------PQIVDFDSTIQVNTLVASYHK 333


>gi|254804105|ref|YP_003082326.1| putative type II DNA modification methyltransferase [Neisseria
           meningitidis alpha14]
 gi|254667647|emb|CBA03458.1| putative type II DNA modification methyltransferase [Neisseria
           meningitidis alpha14]
          Length = 315

 Score = 76.5 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISNKLW 58
           +   DFG+PQ+RER+YII F + ++ F FP P+     LG++LE    ++    +S+ L 
Sbjct: 142 LNTLDFGLPQKRERIYIIGFSD-NIPFYFPEPINQYRPLGELLENDRDVEPSYFLSDAL- 199

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN 83
               K+K    +        ++ EN
Sbjct: 200 ----KQKRLAALKKAPPTPSIWHEN 220


>gi|307152213|ref|YP_003887597.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
 gi|306982441|gb|ADN14322.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
          Length = 317

 Score = 76.1 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 7/92 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ+RER++I+  L P + F++P P+     L +ILE  +      S ++   
Sbjct: 159 LNALDFGLPQKRERIFIVGCLEP-IPFEWPMPVRTIKPLKEILETTVAASYYASEQI--- 214

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
              R    +         ++ EN      +SA
Sbjct: 215 RLNRLAKYQGKNDN-EPTIWHENK--AGHISA 243


>gi|154173655|ref|YP_001409100.1| cytosine-specific methyltransferase NlaX [Campylobacter curvus
           525.92]
 gi|112802981|gb|EAU00325.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Campylobacter
           curvus 525.92]
          Length = 352

 Score = 75.7 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFL--NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   D+G+ Q RER+YI+ FL  +  + F F   + +   + D L++ +D+K  ++  
Sbjct: 152 LNTKDYGIAQNRERIYIVGFLDFDEYLNFDFAPRVPLTTAIRDYLDDEVDEKYYLNEN 209


>gi|331091171|ref|ZP_08340013.1| hypothetical protein HMPREF9477_00656 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330405393|gb|EGG84929.1| hypothetical protein HMPREF9477_00656 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 375

 Score = 75.3 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 41/104 (39%), Gaps = 13/104 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG----------IKPRLGDILEEHIDDKS 51
            + +FG+PQ R R YI+ F            +           +   L ++LE H + K 
Sbjct: 165 NSRNFGIPQNRPRTYIMAFNRQRYGAAALAGIENCLPIENDWYLYEDLNELLEFHAEAKY 224

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFE---NSATTNTLSA 92
            +++   +   + +E     G GFGY +  E        NT+ A
Sbjct: 225 YMASGYLDTLIRHREREHGKGNGFGYRIVNEPGIEHPVANTIMA 268


>gi|254303554|ref|ZP_04970912.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148323746|gb|EDK88996.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 492

 Score = 74.2 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + + D+G+PQ RER++++ F        +F+FP P  ++  + D L +++  K  +  K
Sbjct: 265 LNSKDYGIPQNRERVFVVGFRKDLKLKKKFEFPRPFLLEKTMQDFLLDNVAGKYYLQEK 323


>gi|153870185|ref|ZP_01999636.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS]
 gi|152073352|gb|EDN70367.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS]
          Length = 235

 Score = 74.2 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + + DFG+PQ+RER  I+ F   ++ F FP PLGIKP L  ILE+   D     N L   
Sbjct: 144 LNSLDFGIPQKRERTIIVGF-QENIAFSFPKPLGIKPDLTKILEK---DSEVEKNILLLM 199

Query: 61  HQKRKENNKIA 71
             K++E  K+ 
Sbjct: 200 SLKKRECKKLN 210


>gi|291561285|emb|CBL40084.1| DNA-methyltransferase (dcm) [butyrate-producing bacterium SS3/4]
          Length = 247

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 39/70 (55%), Gaps = 2/70 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + D+GVPQ RER++I+       +  F+FP  + ++  +GD+L+E +  +  +S +  
Sbjct: 153 LNSADYGVPQGRERVFIVSIRKDVDDHSFRFPPVIPLEMCMGDLLDEEVPAEFYLSEEKT 212

Query: 59  EGHQKRKENN 68
           +   +   N+
Sbjct: 213 QSVIRHDSNH 222


>gi|127427|sp|P17044|MTBF_BACSU RecName: Full=Modification methylase BsuFI; Short=M.BsuFI; AltName:
           Full=Cytosine-specific methyltransferase BsuFI
 gi|39984|emb|CAA35888.1| unnamed protein product [Bacillus subtilis]
          Length = 409

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 12/100 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKL 57
           M A +FG+PQRRER+ I+ F       +F FP      K  +  ILE +     +IS +L
Sbjct: 241 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTG-YSISKRL 299

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96
            E +  +K++ K         +         NTL A Y+K
Sbjct: 300 QESYLFKKDDGK-------PQIVDFRCTYQVNTLVASYHK 332


>gi|218439646|ref|YP_002377975.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424]
 gi|218172374|gb|ACK71107.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424]
          Length = 320

 Score = 73.4 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 11/94 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ+RER++I+  L+P + F +P        L +ILE  +      S ++ + 
Sbjct: 159 LNALDFGLPQKRERIFIVGCLDP-IPFIWPNSTRPFKPLQEILETQVSSSYYASEQIRK- 216

Query: 61  HQKRKENNKIAGKGFG--YGLFFENSATTNTLSA 92
              R    +     F     ++ EN      +SA
Sbjct: 217 --NRLAKYEGK---FYNEPTIWHENK--AGHISA 243


>gi|159026722|emb|CAO89036.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 455

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 3/48 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEE 45
           + A DFG+PQ RER++I+           FKFP PLGI P++ DILE+
Sbjct: 169 LNAYDFGLPQNRERVFIVGIRKDIDNYERFKFPLPLGIHPKVLDILED 216


>gi|166368611|ref|YP_001660884.1| cytosine-specific methyltransferase [Microcystis aeruginosa
           NIES-843]
 gi|166090984|dbj|BAG05692.1| cytosine-specific methyltransferase [Microcystis aeruginosa
           NIES-843]
          Length = 464

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 3/48 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEE 45
           + A DFG+PQ RER++I+           FKFP PLGI P++ DILE+
Sbjct: 177 LNAYDFGLPQNRERVFIVGIRKDIDNYERFKFPLPLGIHPKVLDILED 224


>gi|302671270|ref|YP_003831230.1| DNA-cytosine methyltransferase [Butyrivibrio proteoclasticus B316]
 gi|302395743|gb|ADL34648.1| DNA-cytosine methyltransferase [Butyrivibrio proteoclasticus B316]
          Length = 579

 Score = 72.6 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+GVPQ RERL+++ F N     VEF FP  + ++ ++ D L ++      +  K
Sbjct: 354 LNARDYGVPQNRERLFVVGFRNDLDLDVEFSFPQAIELEKKMQDFLLDNAPGGYFLPEK 412


>gi|313678561|ref|YP_004056301.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45]
 gi|312950401|gb|ADR24996.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45]
          Length = 315

 Score = 72.3 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDK--STISN 55
           + A D+G +PQ RER+YI+ F +      F FP P+ ++  + D LE ++DD      ++
Sbjct: 145 LNAKDYGDIPQNRERIYIVGFKDKHSHDAFSFPLPVKLRTSINDCLEVNVDDDSFYYSAD 204

Query: 56  K 56
           K
Sbjct: 205 K 205


>gi|172038109|ref|YP_001804610.1| putative modification methylase [Cyanothece sp. ATCC 51142]
 gi|171699563|gb|ACB52544.1| putative modification methylase [Cyanothece sp. ATCC 51142]
          Length = 344

 Score = 72.3 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW-E 59
           + A +FG+PQ+RER++I+ F +P   F +  P  +   L +I+E+ + +    S ++   
Sbjct: 167 LNALNFGLPQKRERVFIVGFRDPLA-FIWKQPNILMKPLSEIIEKSVSEFYYASEQIQRN 225

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
              K + N++         ++ EN      +SA
Sbjct: 226 RLAKYQGNHQHK-----ITIWHENK--AGHISA 251


>gi|325269501|ref|ZP_08136117.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
 gi|324988120|gb|EGC20087.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
          Length = 388

 Score = 72.3 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+G+PQ RERLY + F     +FK+P P+ ++ ++ D LE++ + +    +K
Sbjct: 180 LNARDYGIPQTRERLYCVGFKK-KTKFKYPAPIPLRYKMYDFLEDYTNSEYFEKDK 234


>gi|323650448|gb|ADX97301.1| M.Fnu4HI [Fusobacterium nucleatum]
          Length = 351

 Score = 71.9 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 7/70 (10%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTIS-- 54
           + A D+G +PQ RER+YI+ F N      F+FP PL +   + D+LE+ +ID+K   S  
Sbjct: 145 LNAKDYGNIPQNRERIYIVGFKNEEHFKNFEFPFPLELTRNIEDMLEKNNIDEKYYYSKE 204

Query: 55  -NKLWEGHQK 63
            NK ++  +K
Sbjct: 205 KNKFYDTLEK 214


>gi|291320332|ref|YP_003515594.1| modification methylase Bsp6I [Mycoplasma agalactiae]
 gi|290752665|emb|CBH40638.1| Modification methylase Bsp6I [Mycoplasma agalactiae]
          Length = 315

 Score = 71.5 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK--STISN 55
           + A D+G +PQ RER+YI+ F +      F FP P+ +K  L D LE ++DD      ++
Sbjct: 145 LNAKDYGDIPQNRERIYIVGFKDKHSYDIFSFPLPVKLKTSLNDCLEVNVDDDCFYYSAD 204

Query: 56  K 56
           K
Sbjct: 205 K 205


>gi|54297036|ref|YP_123405.1| hypothetical protein lpp1078 [Legionella pneumophila str. Paris]
 gi|53750821|emb|CAH12229.1| hypothetical protein lpp1078 [Legionella pneumophila str. Paris]
          Length = 320

 Score = 70.7 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 9/87 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKLW 58
           + + DFGVPQ+RER YI+ F++ +V F+FP   G+   L  ILE+   I +K   S+ + 
Sbjct: 146 LNSLDFGVPQKRERTYIVGFID-NVPFEFPK-GGVPFNLESILEKEQQIPNKYYASDYI- 202

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSA 85
               ++K    + G      ++ EN +
Sbjct: 203 ----RQKRIAALKGVPPIPSIWHENKS 225


>gi|251778642|ref|ZP_04821562.1| methyl transferase [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|243082957|gb|EES48847.1| methyl transferase [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 586

 Score = 70.7 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + + D+GV Q RER++++ F N       F+ P  + +  ++ D L +++  K  +++K
Sbjct: 330 LNSKDYGVAQNRERIFVVGFRNDLELVKPFEEPEKVQLNKKMKDYLLDNVSGKYYLNSK 388


>gi|67922277|ref|ZP_00515790.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
 gi|67855853|gb|EAM51099.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
          Length = 226

 Score = 70.7 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++II   +P + F F  P   +  L +I+E+ + +    S  + +
Sbjct: 167 LNALDFGLPQKRERIFIIGLRDP-LNFTFKKPNISRKPLSEIIEKSVSEFYYASEHIQK 224


>gi|310657624|ref|YP_003935345.1| cytosine-specific methyltransferase [Clostridium sticklandii DSM
           519]
 gi|308824402|emb|CBH20440.1| Cytosine-specific methyltransferase [Clostridium sticklandii]
          Length = 326

 Score = 70.3 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 45/98 (45%), Gaps = 14/98 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR----LGDILEEHIDDKSTISN 55
           M + +FGVPQ+RER+ II F     +EF FP  +         L  ++E  + +K   S 
Sbjct: 154 MNSVNFGVPQKRERVIIIGFRKDLELEFNFPEEIIANEWEFLNLSMVIESEVSEKYFFSE 213

Query: 56  KLWEG-HQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
           K  +G  +KR   NK        G   + +   NT+ A
Sbjct: 214 KAVQGMLKKRATMNK--------GRAQDINKPCNTVGA 243


>gi|288928693|ref|ZP_06422539.1| modification methylase NgoBI (Cytosine-specific methyltransferase
           NgoBI) [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329677|gb|EFC68262.1| modification methylase NgoBI (Cytosine-specific methyltransferase
           NgoBI) [Prevotella sp. oral taxon 317 str. F0108]
          Length = 309

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 42/91 (46%), Gaps = 13/91 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLN----PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A DFG+PQ+RER+ I+ F +     + +F F         L  ILEE  D    I  K
Sbjct: 142 LNAMDFGLPQKRERVIIVGFRDKMAYENFDFTFKKKPFN---LATILEEEKD----IDPK 194

Query: 57  LWEG-HQKRKENNKIAGKG-FGYGLFFENSA 85
           L+     + K     AGK  F   ++ EN A
Sbjct: 195 LYASKTIREKRKASTAGKEVFYPSIWHENKA 225


>gi|256822924|ref|YP_003146887.1| DNA-cytosine methyltransferase [Kangiella koreensis DSM 16069]
 gi|256796463|gb|ACV27119.1| DNA-cytosine methyltransferase [Kangiella koreensis DSM 16069]
          Length = 419

 Score = 69.9 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 12/64 (18%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP-----------SVEFKFPTPLGIKPRLGDILEEHID 48
           + + DFG VPQ RER+YII F +            + EF +P P+ +   + D+L++ + 
Sbjct: 239 LNSMDFGDVPQNRERIYIIGFKDEANWQNNKGATRTSEFSWPEPIRLSKSVRDLLDKQVS 298

Query: 49  DKST 52
           +   
Sbjct: 299 EHYF 302


>gi|82752078|ref|YP_417819.1| DNA modification methylase [Staphylococcus aureus RF122]
 gi|82657609|emb|CAI82057.1| DNA modification methylase [Staphylococcus aureus RF122]
          Length = 402

 Score = 69.6 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDIL--EEHIDDKST 52
           + A D+G +PQ RER+YI+ F        F+FP  + +K  + DI+  E  ID++  
Sbjct: 156 LNAKDYGDIPQNRERIYIVGFKCRKAFDLFEFPEKIDLKTGIKDIINFESEIDERYY 212


>gi|10954474|ref|NP_039765.1| DNA cytosine-5 methylase subunit A [Methanothermobacter
           thermautotrophicus]
 gi|266583|sp|P29567|MTHT_METTF RecName: Full=Modification methylase MthTI; Short=M.MthTI; AltName:
           Full=Cytosine-specific methyltransferase MthTI
 gi|44641|emb|CAA48436.1| TIM [Methanothermobacter thermautotrophicus]
 gi|149743|gb|AAA73370.1| TIM [Methanothermobacter thermautotrophicus]
          Length = 330

 Score = 69.6 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 18/96 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ R+R++I+ +    +++F+FP PL  K  L D + +  + K  +      
Sbjct: 144 LNAKDYGVPQDRKRVFIVGYREDLNLKFEFPKPLNKKVTLRDAIGDLPEPKPAL------ 197

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARY 94
                 E N+  G+     L   N    T T S+RY
Sbjct: 198 ------EKNRSNGEN----LEVPNHEYMTGTFSSRY 223


>gi|329767116|ref|ZP_08258644.1| hypothetical protein HMPREF0428_00341 [Gemella haemolysans M341]
 gi|328837841|gb|EGF87466.1| hypothetical protein HMPREF0428_00341 [Gemella haemolysans M341]
          Length = 396

 Score = 69.2 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK--STISN 55
           +   D+G VPQ RER+YI+ FL      +F+FP  + ++ +L DI++  I +K      +
Sbjct: 145 LNGKDYGNVPQNRERIYIVGFLEKESFDKFEFPKKIKLETKLSDIIDFDIKEKEIYYYRD 204


>gi|2599488|gb|AAB84141.1| FauI DNA methyltransferase [Flavobacterium aquatile]
          Length = 343

 Score = 69.2 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 53/99 (53%), Gaps = 16/99 (16%)

Query: 1   MKACDFGVPQRRERLYIIDFL--NPSVEFKFPTPL---GIKPRLGDILEEHID--DKSTI 53
           + + +FGVPQ+RER++I+ F   +  + FKFP P+   G K  L +++++  D  +K   
Sbjct: 165 LNSSEFGVPQKRERVFIVGFRDFDDYLNFKFPQPITLEGSKIVLKEVIDKKADTEEKWFF 224

Query: 54  SNKLWEGHQK-RKENNKIAGKGFGYGLFFENSATTNTLS 91
           S K  +G  + R++ NK        G   + +   NT+S
Sbjct: 225 SQKAVDGMLRVREKMNK--------GRVQDLNQPCNTIS 255


>gi|5420107|emb|CAB46561.1| cytosine-specific methyltransferase [Streptococcus thermophilus]
          Length = 316

 Score = 68.8 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL--EEHIDDKSTIS 54
           M A D+G +PQ RER+YI+ F +     +F  P  + ++  + D++  +  +DDK   +
Sbjct: 145 MNAADYGNIPQNRERIYIVAFRDKEDYADFDLPKSIPLETSIKDVIDFDSKVDDKFYYT 203


>gi|1171044|sp|P43420|MTB6_BACSF RecName: Full=Modification methylase Bsp6I; Short=M.Bsp6I; AltName:
           Full=Cytosine-specific methyltransferase Bsp6I
 gi|547481|emb|CAA57293.1| site-specific DNA-methyltransferase (cytosine-specific) [Bacillus
           sp.]
 gi|1098125|prf||2115268B methyltransferase Bsp6IM
          Length = 315

 Score = 68.8 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDI--LEEHIDDKSTISN 55
           + A DFG +PQ RER+YI+ F N      F FP P  +   + D+  L + +DD+   + 
Sbjct: 145 LNAKDFGNIPQNRERIYIVGFRNIEHYKNFNFPMPQPLTLTIKDMINLSDKLDDRFYYTE 204


>gi|308185227|ref|YP_003929360.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori SJM180]
 gi|308061147|gb|ADO03043.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori SJM180]
          Length = 317

 Score = 68.8 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 14/101 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   DFG+PQ+R R++I+        ++EF FP  +  K    D+L++ ++ K  IS K+
Sbjct: 141 LNTLDFGIPQQRNRVFIVALRKNSFTNLEFVFPAKIPCKISTLDLLDKQVELKYFISQKM 200

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYK 96
            +    +           GY +     ++    TL+A  +K
Sbjct: 201 IKTILGKGTK--------GY-IVEPSIDTPIAKTLTATMHK 232


>gi|225571452|ref|ZP_03780448.1| hypothetical protein CLOHYLEM_07550 [Clostridium hylemonae DSM
           15053]
 gi|225159928|gb|EEG72547.1| hypothetical protein CLOHYLEM_07550 [Clostridium hylemonae DSM
           15053]
          Length = 377

 Score = 68.8 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 9/86 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER+ II    P + ++ F   +  K  L DILE+ ID K   S ++  
Sbjct: 222 LNALDFGLPQKRERIIIIGSKKPFLMDWTF--NVEKKKTLDDILEKDIDKKHYASPEIVA 279

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSA 85
              KRK  +  +       ++ EN +
Sbjct: 280 ---KRKAKHTAS---IYPSIWHENKS 299


>gi|325913633|ref|ZP_08175995.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B]
 gi|325476992|gb|EGC80142.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B]
          Length = 372

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 11/99 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           ++A DFG+ Q R+R+ I+ F +   +  F+FP        + DILE++ +    IS KL 
Sbjct: 199 LEASDFGLAQSRKRVIIVGFRSDIDDSSFEFPKGNSKHVAVKDILEDNPEG-YPISKKLQ 257

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENS-ATTNTLSARYYK 96
           E +  +K++ +         +  +NS     TL++ Y+K
Sbjct: 258 ENYLFKKDDGR-------PYVVDKNSTGLAKTLNSSYHK 289


>gi|322383485|ref|ZP_08057261.1| hypothetical protein PL1_3347 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321152224|gb|EFX45054.1| hypothetical protein PL1_3347 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 425

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 32/81 (39%), Gaps = 26/81 (32%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--------------------------PSVEFKFPTPLG 34
           + +  +GVPQ RER++I+   +                           +  F +P    
Sbjct: 144 LNSKFYGVPQSRERVFIVCSRDVEPEAWSIEGNGVLAKAKRRLQAMGARTFNFDWPKNGE 203

Query: 35  IKPRLGDILEEHIDDKSTISN 55
           +  RL DILE  +D+K  +S 
Sbjct: 204 VMTRLRDILEPEVDEKYYLSP 224


>gi|331270911|ref|YP_004385622.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
 gi|329127303|gb|AEB77247.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
          Length = 318

 Score = 68.4 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 2/62 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEF--KFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           M   D+G+P  R RLYI+       +F  KFPT + +K  + D+LE+ ++DK  +++K++
Sbjct: 151 MNTSDYGLPHTRRRLYIVGQRKDLGDFDYKFPTEIELKLNVQDLLEKDVNDKYYLTDKMY 210

Query: 59  EG 60
           + 
Sbjct: 211 KT 212


>gi|309379398|emb|CBX21965.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 223

 Score = 68.0 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 7  GVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
          G PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K
Sbjct: 2  GFPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREK 52


>gi|293596744|ref|ZP_05263998.2| DNA-methyltransferase [Listeria monocytogenes J2818]
 gi|293592003|gb|EFG00338.1| DNA-methyltransferase [Listeria monocytogenes J2818]
          Length = 327

 Score = 67.6 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 42/104 (40%), Gaps = 8/104 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD-KSTISNKLWE 59
           + A DFG+PQ RER++++  L  +  F+FP  +     L D ++  +D     +S    +
Sbjct: 150 LNARDFGIPQNRERVFVVSVLGNNTGFQFPEKIESAMSLKDYIDFEVDPTDYALSENEKQ 209

Query: 60  GHQKRKEN---NKIAGKGF----GYGLFFENSATTNTLSARYYK 96
              +       +    KGF     +        T+ T   R  K
Sbjct: 210 LFFRENNKLFIHTNTKKGFQEVEQFDSVNVERPTSKTRRGRVGK 253


>gi|269122857|ref|YP_003305434.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM
           12112]
 gi|268314183|gb|ACZ00557.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM
           12112]
          Length = 329

 Score = 67.6 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDIL--EEHID------DK 50
           + + DFG+PQ+RER+Y++ F        F FP P  +   + D+L  +E +       D 
Sbjct: 152 LNSLDFGIPQKRERIYMVCFRKDLNIKNFIFPKPFKLSTFVEDLLLPDEEVSNLIINRDD 211

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
             + +K  + +  +       GKG      +       TLSA
Sbjct: 212 LVLKDKEIKENSNKAIRIGTVGKGGQGERIYSPKGIAITLSA 253


>gi|254901064|ref|ZP_05260988.1| DNA-methyltransferase (cytosine-specific) [Listeria monocytogenes
           J0161]
          Length = 320

 Score = 67.6 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 42/104 (40%), Gaps = 8/104 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD-KSTISNKLWE 59
           + A DFG+PQ RER++++  L  +  F+FP  +     L D ++  +D     +S    +
Sbjct: 143 LNARDFGIPQNRERVFVVSVLGNNTGFQFPEKIESAMSLKDYIDFEVDPTDYALSENEKQ 202

Query: 60  GHQKRKEN---NKIAGKGF----GYGLFFENSATTNTLSARYYK 96
              +       +    KGF     +        T+ T   R  K
Sbjct: 203 LFFRENNKLFIHTNTKKGFQEVEQFDSVNVERPTSKTRRGRVGK 246


>gi|327463103|gb|EGF09424.1| modification methylase ScrFIA [Streptococcus sanguinis SK1]
          Length = 346

 Score = 67.2 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 3   ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNKL 57
           A  +GVPQ+RER++I+      +  F+FP            L  IL+++ID+K   S + 
Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNEEDYTPLKAILQKNIDEKYYFSERA 220

Query: 58  WEGHQKRKENNKIAGKG 74
            +G    K   K   KG
Sbjct: 221 VKGMLNSKS-GKKMNKG 236


>gi|218247578|ref|YP_002372949.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|218168056|gb|ACK66793.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
          Length = 727

 Score = 66.9 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 6/62 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI------DDKSTIS 54
           + A DFGVPQ RER+ II   +   +F         P+L + L++          + T+ 
Sbjct: 146 LNAKDFGVPQHRERIVIIATRHKKFDFNLIQQQKPIPKLREFLDKTGNFDYLHPKEYTLI 205

Query: 55  NK 56
           + 
Sbjct: 206 DN 207


>gi|167465361|ref|ZP_02330450.1| DNA-cytosine methyltransferase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 432

 Score = 66.9 bits (163), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 32/81 (39%), Gaps = 26/81 (32%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--------------------------PSVEFKFPTPLG 34
           + +  +GVPQ RER++II   +                           +  F +P    
Sbjct: 144 LNSKFYGVPQSRERVFIICSRDVEPEAWSTEGNGVLTKAKRRLQMMGARTFNFDWPKNSE 203

Query: 35  IKPRLGDILEEHIDDKSTISN 55
           +  RL DILE  +D+K  +S 
Sbjct: 204 VTTRLRDILETEVDEKYYLSP 224


>gi|291551321|emb|CBL27583.1| DNA-methyltransferase (dcm) [Ruminococcus torques L2-14]
          Length = 595

 Score = 66.5 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTI 53
           + + ++G+PQ RERL+++ F        +F FP P+ ++ ++ D L ++      +
Sbjct: 368 LNSKNYGIPQNRERLFVVGFREDLELAKKFSFPNPIPLRKKMKDFLMDNAPGGYFL 423


>gi|257061088|ref|YP_003138976.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|256591254|gb|ACV02141.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 331

 Score = 66.5 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 6/62 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI------DDKSTIS 54
           + A DFGVPQ RER+ II   +   +F         P+L + L++          + T+ 
Sbjct: 146 LNAKDFGVPQHRERIVIIATRHKKFDFNLIQQQKPIPKLREFLDKTGNFDYLHSKEYTLI 205

Query: 55  NK 56
           + 
Sbjct: 206 DN 207


>gi|329769727|ref|ZP_08261128.1| hypothetical protein HMPREF0433_00892 [Gemella sanguinis M325]
 gi|328838089|gb|EGF87707.1| hypothetical protein HMPREF0433_00892 [Gemella sanguinis M325]
          Length = 406

 Score = 66.1 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDK--STISN 55
           +   D+G +PQ RER+YI+ FL      +F+FP  + ++ +L DI++  I +K      +
Sbjct: 155 LNGKDYGNIPQNRERIYIVGFLEKESYDKFEFPNEIKLETKLSDIIDFDIKEKEIYYYRD 214


>gi|169823657|ref|YP_001691160.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328]
 gi|167832277|dbj|BAG09192.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328]
          Length = 332

 Score = 66.1 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL--EEHIDDKSTISN 55
           + A +FG +PQ RER+YI+ F + +    F+FP P+ +   + D +  E   D     + 
Sbjct: 147 LNATEFGNIPQNRERIYIVAFRDKNCLDNFEFPKPIELTTTIRDFIDFENKKDTSFYYTE 206

Query: 56  K 56
           K
Sbjct: 207 K 207


>gi|269121452|ref|YP_003309629.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
 gi|268615330|gb|ACZ09698.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
          Length = 372

 Score = 66.1 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLWE 59
           + A ++ +PQ RERL+ +  L+  V++ FP P  +   L D+LE+ +D+K  I+  K   
Sbjct: 150 LNALNYEIPQNRERLFCLSILDDKVKYNFPGPKKLNILLKDLLEKEVDEKYFINEEKTKA 209

Query: 60  GHQKRKEN 67
             +K K+ 
Sbjct: 210 FIEKYKDK 217


>gi|220929948|ref|YP_002506857.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
 gi|220000276|gb|ACL76877.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
          Length = 338

 Score = 66.1 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 17/106 (16%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL---EEHIDDKSTISN 55
           + A ++G+PQ RER+Y++ F N      F FP P  +K  + D L   E  ++       
Sbjct: 152 LNAVNYGIPQNRERIYMVCFRNDLNIENFNFPKPFPLKRYVEDFLLEDESQVEHLYIQRP 211

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFEN---------SATTNTLSA 92
              + +    E+NK + K    G+  +               TLSA
Sbjct: 212 ---DTYFNGVEDNKYSNKPIRLGIVNKGGQGERIYSTKGIAITLSA 254


>gi|314055098|ref|YP_004063436.1| cytosine-specific methyltransferase [Ostreococcus tauri virus 2]
 gi|313574989|emb|CBI70002.1| cytosine-specific methyltransferase [Ostreococcus tauri virus 2]
          Length = 315

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 8   VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           VPQ RER+YI+ F +      F F    G K  L D +E  + DK   S+K 
Sbjct: 153 VPQHRERIYIVGFRDKELHDNFNFDFVEGDKGNLCDFMESCVPDKYYYSDKY 204


>gi|126660265|ref|ZP_01731380.1| putative DNA modification methylase (N.MgoV) [Cyanothece sp.
           CCY0110]
 gi|126618440|gb|EAZ89194.1| putative DNA modification methylase (N.MgoV) [Cyanothece sp.
           CCY0110]
          Length = 458

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 12/90 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILEE----HIDDKSTI 53
           + + DFGVPQ RER++I+           ++FP PL ++ RL D+L+E     + +K  +
Sbjct: 173 INSYDFGVPQNRERVFIVGIRKDRKNCHHYQFPKPLKVQIRLLDVLDELKHCQVTEKVKL 232

Query: 54  SNKLWEG-----HQKRKENNKIAGKGFGYG 78
           + ++         + R + N      F + 
Sbjct: 233 TPEILFNGNIPPSRNRFQKNDELNDFFTFS 262


>gi|172039424|ref|YP_001805925.1| putative site-specific DNA-methyltransferase [Cyanothece sp. ATCC
           51142]
 gi|171700878|gb|ACB53859.1| putative site-specific DNA-methyltransferase [Cyanothece sp. ATCC
           51142]
          Length = 729

 Score = 65.7 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 6/59 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE-----EHIDDK-STI 53
           + A DFGVPQ RER+ II  LN    F         P L   L+     E++D K  T+
Sbjct: 146 LNAKDFGVPQNRERIIIIGTLNKKFNFDLIDIQKNVPSLRSFLDQKGNFEYLDPKEYTL 204


>gi|281491829|ref|YP_003353809.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
 gi|281375540|gb|ADA65046.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
          Length = 351

 Score = 65.3 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 6/79 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP----RLGDILEEHIDDKSTISN 55
           ++A ++G+PQ+RER++I+   N  + +F F  P    P     L  +L++  D+K   S+
Sbjct: 159 LRAVEYGIPQKRERVFIVGIRNDLNKKFHFADPPIQSPLDYTPLKKVLQKDFDEKYYFSD 218

Query: 56  KLWEGHQKRKENNKIAGKG 74
           +  EG  K K  +KI  KG
Sbjct: 219 RAVEGMLKSK-MSKIMNKG 236


>gi|15616070|ref|NP_244375.1| cytosine-specific methyltransferase [Bacillus halodurans C-125]
 gi|10176132|dbj|BAB07227.1| cytosine-specific methyltransferase [Bacillus halodurans C-125]
          Length = 326

 Score = 65.3 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 6/55 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLG----IKPRLGDILEEHIDD 49
           + A D+ VPQ RER+ I+ F N     EF FP        ++  L D+ E   +D
Sbjct: 146 LNAKDYSVPQNRERVIIVGFRNDLGITEFTFPEKHDKIVTLREALADLPEPSPED 200


>gi|257870038|ref|ZP_05649691.1| DNA methylase [Enterococcus gallinarum EG2]
 gi|257804202|gb|EEV33024.1| DNA methylase [Enterococcus gallinarum EG2]
          Length = 401

 Score = 65.3 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDIL--EEHIDDKSTIS 54
           +   D+G VPQ RER+Y++ F N      F FP+ + +  +L D++  E   DDK    
Sbjct: 156 LNGKDYGNVPQNRERIYVVGFRNQQAFDNFHFPSKVELTTKLSDVIDFENPKDDKYYYK 214


>gi|289167787|ref|YP_003446056.1| site-specific DNA methylase [Streptococcus mitis B6]
 gi|288907354|emb|CBJ22191.1| site-specific DNA methylase [Streptococcus mitis B6]
          Length = 346

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 3   ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNKL 57
           A  +GVPQ+RER++I+      +  F+FP            L  IL++ ID+K   S + 
Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNVEDYTPLKVILQQDIDEKYYFSERA 220

Query: 58  WEGHQKRKENNKIAGKG 74
            +G    K   K   KG
Sbjct: 221 VQGMLNSKS-GKKMNKG 236


>gi|148988377|ref|ZP_01819824.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pneumoniae
           SP6-BS73]
 gi|147926058|gb|EDK77132.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pneumoniae
           SP6-BS73]
          Length = 343

 Score = 65.3 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 3   ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNKL 57
           A  +GVPQ+RER++I+      +  F+FP            L  IL++ ID+K   S + 
Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNVEDYTPLKVILQQDIDEKYYFSERA 220

Query: 58  WEGHQKRKENNKIAGKG 74
            +G    K   K   KG
Sbjct: 221 VQGMLNSKS-GKKMNKG 236


>gi|312281368|ref|YP_004022731.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181897|gb|ADQ42066.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 319

 Score = 64.9 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEE--HIDDKSTISN 55
           + + ++G VPQ RER+YI+ FL+ S    FKFP P+ +   + DI++     D+K     
Sbjct: 146 LNSLEYGNVPQNRERVYIVGFLDKSMYEAFKFPEPVSLTVTIHDIIKPWEKKDEKYYYRE 205


>gi|328912201|gb|AEB63797.1| Modification methylase Rho11sI [Bacillus amyloliquefaciens LL3]
          Length = 503

 Score = 64.5 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 34/101 (33%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30
           + +  F VPQ RER+YII      +E                              FK+ 
Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWVLEKGRNDVLSKGKKRLKELNIKSFNFKWS 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISN----KLWEGHQKRKEN 67
               +  RL +ILEE++D+K  +S     KL E  +K KE 
Sbjct: 209 AQDIVGQRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEK 249


>gi|218248203|ref|YP_002373574.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|257060473|ref|YP_003138361.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|218168681|gb|ACK67418.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|256590639|gb|ACV01526.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 460

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 32/48 (66%), Gaps = 3/48 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEE 45
           + A DFG+PQ R+R++++   N    S  ++FP PL I P++ DIL++
Sbjct: 168 LNAYDFGLPQNRDRVFLVGIRNDIEGSQNYQFPDPLNIHPKVLDILDD 215


>gi|269119458|ref|YP_003307635.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
 gi|268613336|gb|ACZ07704.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
          Length = 383

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A D+ +PQRR+R++ +     + ++ FP P+ +K RL D+LE+ + +K  + +
Sbjct: 148 LNAKDYRIPQRRKRVFCVSIF-GNEKYVFPKPVELKLRLRDMLEKEVPEKYYLKD 201


>gi|308185228|ref|YP_003929361.1| DNA-cytosine methyltransferase [Helicobacter pylori SJM180]
 gi|308061148|gb|ADO03044.1| DNA-cytosine methyltransferase [Helicobacter pylori SJM180]
          Length = 368

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 37/85 (43%), Gaps = 25/85 (29%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH------------ 46
           + A ++G+PQ R RL+++ F        F FP+P  +   + D+L+++            
Sbjct: 187 LDARNYGIPQGRRRLFLVGFKEQEKCANFTFPSPKELTITMQDLLQDNIKEGNLLSKNAI 246

Query: 47  -----------IDDKSTISNKLWEG 60
                      +D+K  +S KL + 
Sbjct: 247 LDTKSFLGGELVDEKYFLSEKLLKY 271


>gi|328553026|gb|AEB23518.1| SP-beta prophage DNA (cytosine-5-)-methyltransferase [Bacillus
           amyloliquefaciens TA208]
          Length = 503

 Score = 64.5 bits (157), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 34/101 (33%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30
           + +  F VPQ RER+YII      +E                              FK+ 
Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWIVEKGRNDVLSKGKKRLKELNIKSFNFKWS 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISN----KLWEGHQKRKEN 67
               +  RL +ILEE++D+K  +S     KL E  +K KE 
Sbjct: 209 AQDIVGKRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEK 249


>gi|254933776|ref|ZP_05267135.1| DNA-cytosine methyltransferase [Listeria monocytogenes HPB2262]
 gi|293585336|gb|EFF97368.1| DNA-cytosine methyltransferase [Listeria monocytogenes HPB2262]
          Length = 325

 Score = 64.2 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK-STISNK 56
           + A D+G+PQ RER++++  L  + EF+FP  +     L D ++  +D     +S  
Sbjct: 143 LNARDYGIPQNRERVFVVSVLGNNKEFQFPEKVKPVKSLKDYIDFDVDPTAYALSEN 199


>gi|332310450|gb|EGJ23545.1| DNA-methyltransferase (Dcm) [Listeria monocytogenes str. Scott A]
          Length = 325

 Score = 64.2 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK-STISNK 56
           + A D+G+PQ RER++++  L  + EF+FP  +     L D ++  +D     +S  
Sbjct: 143 LNARDYGIPQNRERVFVVSVLGNNKEFQFPEKVKPVKSLKDYIDFDVDPTAYALSEN 199


>gi|157265308|ref|YP_001467867.1| C5 cytosine-specific DNA methylase [Thermus phage P23-45]
 gi|157265426|ref|YP_001467984.1| C5 cytosine-specific DNA methylase [Thermus phage P74-26]
 gi|156905203|gb|ABU96847.1| C5 cytosine-specific DNA methylase [Thermus phage P23-45]
 gi|156905321|gb|ABU96964.1| C5 cytosine-specific DNA methylase [Thermus phage P74-26]
          Length = 368

 Score = 64.2 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 9/54 (16%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53
           + A D+GVPQ+RER++I+    +   +F FP P    P         +  K  +
Sbjct: 162 LNAADYGVPQKRERVFIVGVRSDLPGDFAFPLPTHANP--------QVAAKYGL 207


>gi|327399867|ref|YP_004346898.1| cytosine-specific methyltransferase [Lactobacillus amylovorus GRL
           1112]
 gi|327182537|gb|AEA32972.1| cytosine-specific methyltransferase [Lactobacillus amylovorus GRL
           1112]
          Length = 401

 Score = 64.2 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           +   D+G +PQ RER+Y++ F N      F FP P+ +   L DI++     D+K     
Sbjct: 153 LNGKDYGNIPQNRERIYVVGFDNKEDYDRFDFPAPIKLTKTLHDIIDFHGKKDEKYYYRE 212


>gi|255018626|ref|ZP_05290752.1| DNA-methyltransferase (cytosine-specific) [Listeria monocytogenes
           FSL F2-515]
          Length = 172

 Score = 64.2 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK-STISNK 56
           + A DFG+PQ RER++++  L  + EF+FP  +     L D ++  ++     +S  
Sbjct: 110 LNARDFGIPQNRERVFVVSVLGNNKEFQFPEKVEPVKSLKDYIDFDVEPTAYALSEN 166


>gi|1171045|sp|P09915|MTBR_BPRH1 RecName: Full=Modification methylase Rho11sI; Short=M.Rho11sI;
           AltName: Full=Bsu P11s; AltName: Full=Cytosine-specific
           methyltransferase Rho11sI
 gi|579194|emb|CAA28869.1| unnamed protein product [Bacillus phage rho11s]
          Length = 503

 Score = 64.2 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 34/101 (33%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30
           + +  F VPQ RER+YII      +E                              FK+ 
Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWVVEKGRNDVLSKGKKRLKELNIKSFNFKWS 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISN----KLWEGHQKRKEN 67
               +  RL +ILEE++D+K  +S     KL E  +K KE 
Sbjct: 209 AQDIVGRRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEK 249


>gi|901818|gb|AAA69959.1| 5C-DNA methyltransferase [Bacillus phage H2]
          Length = 503

 Score = 64.2 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 34/101 (33%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30
           + +  F VPQ RER+YII      +E                              FK+ 
Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWIVEKGRYDVLSKGKKRLKELNIKSFNFKWS 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISN----KLWEGHQKRKEN 67
               +  RL +ILEE++D+K  +S     KL E  +K KE 
Sbjct: 209 AQDIVGKRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEK 249


>gi|303231468|ref|ZP_07318199.1| modification methylase HhaI family protein [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513905|gb|EFL55916.1| modification methylase HhaI family protein [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 411

 Score = 64.2 bits (156), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           +   D+G +PQ RER+YI+ FL  S    F FP  + +   L DI++    +D+    + 
Sbjct: 154 LNGKDYGNIPQNRERIYIVGFLEKSAYDAFIFPDEIPLTTSLSDIIDFNGKMDEYYYYTE 213


>gi|118138268|pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances
           Sequence Discrimination Of Dna Methyltransferase M.Hhai
          Length = 327

 Score = 64.2 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|229824483|ref|ZP_04450552.1| hypothetical protein GCWU000282_01806 [Catonella morbi ATCC 51271]
 gi|229786084|gb|EEP22198.1| hypothetical protein GCWU000282_01806 [Catonella morbi ATCC 51271]
          Length = 406

 Score = 63.8 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDD--KSTIS 54
           +   D G +PQ RER+YI+ F +      F+FP  + +  +L D+++ HI +  K   +
Sbjct: 156 LNGKDHGNIPQNRERIYIVGFRDKQAFDAFQFPESVDLTTKLDDVIDFHIAENAKYYYT 214


>gi|161761159|pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna
           Methyltransferase, With Unmodified Dna And Adohcy
          Length = 327

 Score = 63.8 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|160877870|pdb|2Z6U|A Chain A, Ternary Structure Of The Glu119ala M.Hhai, C5-Cytosine Dna
           Methyltransferase, With Unmodified Dna And Adohcy
          Length = 327

 Score = 63.8 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|50513617|pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna
           Methyltransferase: An Insight Into Protein-Protein
           Interactions
 gi|50513618|pdb|1SVU|B Chain B, Structure Of The Q237w Mutant Of Hhai Dna
           Methyltransferase: An Insight Into Protein-Protein
           Interactions
          Length = 327

 Score = 63.8 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|189096062|pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With
           13mer Gcgc-Gmgc Oligonucleotide And Sah
          Length = 327

 Score = 63.8 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|12084381|pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase
           Mutant (T250g) In Complex With Dna And Adohcy
 gi|85544394|pdb|2C7R|A Chain A, Hhai Dna Methyltransferase (T250g Mutant) Complex With
           Oligonucleotide Containing 2-Aminopurine As A Target
           Base (Gpgc:gmgc) And Sah
          Length = 327

 Score = 63.8 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|127455|sp|P05102|MTH1_HAEPH RecName: Full=Modification methylase HhaI; Short=M.HhaI; AltName:
           Full=Cytosine-specific methyltransferase HhaI
 gi|1065144|pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna
           And S-Adenosyl-L-Homocysteine
 gi|1942412|pdb|3MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With
           Unmodified Dna And Adohcy
 gi|1942415|pdb|4MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Native
           Dna And Adohcy
 gi|2392799|pdb|5MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With
           Hemimethylated Dna And Adohcy
 gi|3660437|pdb|6MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Adohcy
           And Dna Containing 4'-Thio-2'deoxycytidine At The Target
 gi|4139672|pdb|7MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX
 gi|4139675|pdb|8MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX
 gi|4139680|pdb|9MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX
 gi|4558252|pdb|10MH|A Chain A, Ternary Structure Of Hhai Methyltransferase With Adohcy
           And Hemimethylated Dna Containing
           5,6-Dihydro-5-Azacytosine At The Target
 gi|4699814|pdb|2HMY|B Chain B, Binary Complex Of Hhai Methyltransferase With Adomet
           Formed In The Presence Of A Short Nonpsecific Dna
           Oligonucleotide
 gi|24158912|pdb|1M0E|A Chain A, Zebularine: A Novel Dna Methylation Inhibitor That Forms A
           Covalent Complex With Dna Methyltransferase
 gi|52695513|pdb|1SKM|A Chain A, Hhai Methyltransferase In Complex With Dna Containing An
           Abasic South Carbocyclic Sugar At Its Target Site
 gi|85544385|pdb|2C7O|A Chain A, Hhai Dna Methyltransferase Complex With 13mer
           Oligonucleotide Containing 2-Aminopurine Adjacent To The
           Target Base (Pcgc:gmgc) And Sah
 gi|85544388|pdb|2C7P|A Chain A, Hhai Dna Methyltransferase Complex With Oligonucleotide
           Containing 2-Aminopurine Opposite To The Target Base (
           Gcgc:gmpc) And Sah
 gi|85544391|pdb|2C7Q|A Chain A, Hhai Dna Methyltransferase Complex With Oligonucleotide
           Containing 2-Aminopurine Outside The  Recognition
           Sequence (Paired With G) And Sah
 gi|116667789|pdb|2HR1|A Chain A, Ternary Structure Of Wt M.Hhai C5-Cytosine Dna
           Methyltransferase With Unmodified Dna And Adohcy
 gi|157831356|pdb|1HMY|A Chain A, Crystal Structure Of The Hhal Dna Methyltransferase
           Complexed With S-Adenosyl-L-Methionine
 gi|290560089|pdb|3EEO|A Chain A, M. Hhai Co-Crystallized With Synthetic Dsdna Containing A
           Propane Diol In Place Of The Deoxycytidine Residue
           Targeted For Methylation.
 gi|148949|gb|AAA24989.1| DNA methylase [Haemophilus haemolyticus]
          Length = 327

 Score = 63.8 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|159795737|pdb|2Z6A|A Chain A, S-Adenosyl-L-Methionine-Dependent Methyl Transfer:
           Observable Precatalytic Intermediates During Dna
           Cytosine Methylation
          Length = 327

 Score = 63.8 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|331270912|ref|YP_004385623.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
 gi|329127304|gb|AEB77248.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
          Length = 349

 Score = 63.8 bits (155), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53
           + A +FG+PQ RER+++I       + + KF        RL DIL+  +D++  I
Sbjct: 149 LNAKNFGIPQNRERIFVIGIREYIDNKQMKFNEGKDYGYRLKDILQNQVDERFYI 203


>gi|146298415|ref|YP_001193006.1| DNA-cytosine methyltransferase [Flavobacterium johnsoniae UW101]
 gi|146152833|gb|ABQ03687.1| DNA-cytosine methyltransferase [Flavobacterium johnsoniae UW101]
          Length = 329

 Score = 63.8 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 9/101 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDF-----LNPSVEFKFPTPLGIKPRLGDIL-EEHIDDK-ST 52
           +   DFG +P  RER++I+ F      +   EF FP    +   + D++ +E +D+K   
Sbjct: 144 LNTKDFGNIPHNRERIFIVAFDKDYIKDDKFEFHFPEKEDLTKSIKDLITKEKVDEKFYY 203

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFEN-SATTNTLSA 92
             +K      +    NK     F      EN S+   TL+A
Sbjct: 204 HEDKYMYDMLRESITNKDRIYQFRRQYVRENKSSVCPTLTA 244


>gi|197302809|ref|ZP_03167861.1| hypothetical protein RUMLAC_01538 [Ruminococcus lactaris ATCC
           29176]
 gi|197298046|gb|EDY32594.1| hypothetical protein RUMLAC_01538 [Ruminococcus lactaris ATCC
           29176]
          Length = 333

 Score = 63.4 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL---EEHIDDKSTISN 55
           + A D+G+PQ+RER+Y++ F N      F +P P  +   + + L   EE + D      
Sbjct: 152 LNAVDYGIPQKRERIYMVCFRNDLGITGFSYPKPFKLTRHVENFLLDDEEMVKDLYVERP 211


>gi|148380278|ref|YP_001254819.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum A str.
           ATCC 3502]
 gi|148289762|emb|CAL83870.1| putative C-5 cytosine-specific DNA methylase [Clostridium botulinum
           A str. ATCC 3502]
          Length = 340

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + + D+G PQ RER++ I          FKFP P+     +  IL+E++D K    NK 
Sbjct: 152 LNSKDYGSPQSRERMFCISIRKDIDACLFKFPKPMDSIVPINTILDEYVDKKYYCINKY 210


>gi|260890220|ref|ZP_05901483.1| modification methylase EcoRII [Leptotrichia hofstadii F0254]
 gi|260859840|gb|EEX74340.1| modification methylase EcoRII [Leptotrichia hofstadii F0254]
          Length = 293

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 5/57 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL--EEHIDDKST 52
           + A ++G VPQ RER+YII F        F+   PL ++ ++GDI+  ++ +D+K  
Sbjct: 115 LNASEYGNVPQNRERIYIIGFRKKEDYDNFEDIKPLKLEKKIGDIIDFDKKVDEKYY 171


>gi|296126993|ref|YP_003634245.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563]
 gi|296018809|gb|ADG72046.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563]
          Length = 324

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RER+YI+ F       +F FP P+ +   L D L E 
Sbjct: 152 LNASDYGIPQKRERIYIVCFRKDLNIKKFDFPKPIELIKHLEDFLLEE 199


>gi|126658057|ref|ZP_01729209.1| DNA cytosine methylase [Cyanothece sp. CCY0110]
 gi|126620695|gb|EAZ91412.1| DNA cytosine methylase [Cyanothece sp. CCY0110]
          Length = 358

 Score = 63.4 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 1   MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A  F +PQ RER+YI+ F    L   VEF FP        +   +E +++   +IS  
Sbjct: 181 LDAALFNLPQVRERIYIVGFCRDYLKERVEFNFPVGRKNNVFIDQFIETNVEG-YSISKH 239

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96
           L + +  +K++ +         +  +NS     T  + Y+K
Sbjct: 240 LQKTYLFKKDDGR-------PQIVDQNSKVKVKTFVSTYHK 273


>gi|325269502|ref|ZP_08136118.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
 gi|324988121|gb|EGC20088.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
          Length = 393

 Score = 63.0 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   D+GVPQ R+R+Y I F   + +FK+P P+ +   + D L++  + +  +  K
Sbjct: 180 LNGKDYGVPQSRDRIYCIGFKKET-DFKYPAPIPLVKTVYDYLQKKFEKRYLLRQK 234


>gi|317500279|ref|ZP_07958506.1| cytosine-specific methyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087487|ref|ZP_08336423.1| hypothetical protein HMPREF1025_00006 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|316898322|gb|EFV20366.1| cytosine-specific methyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330410467|gb|EGG89898.1| hypothetical protein HMPREF1025_00006 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 410

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/46 (47%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A DFGVPQ+RERL  +   N     V F FP     KP L DIL
Sbjct: 227 LNAWDFGVPQKRERLITVGIRNDLVGKVSFSFPKEHNYKPVLRDIL 272


>gi|258511120|ref|YP_003184554.1| DNA-cytosine methyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477846|gb|ACV58165.1| DNA-cytosine methyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 395

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 10/70 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER++I+ F  + ++E+ FP P      L  + ++ +  +       WE
Sbjct: 178 LNAADYGVPQKRERVFIVGFRSDLNIEWSFPNPTHSFDAL--LYDQWVTGEY------WE 229

Query: 60  GHQKRKENNK 69
            H +  + ++
Sbjct: 230 RH-RVAKKHR 238


>gi|330718183|ref|ZP_08312783.1| cytosine-specific methyltransferase [Leuconostoc fallax KCTC 3537]
          Length = 414

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           + A ++G +PQ RER+Y++ F +      F FP  + +  +L DI++
Sbjct: 152 LNAKEYGNIPQNRERIYVVGFKDKKAFDNFSFPEKIDLTTKLSDIID 198


>gi|57506196|ref|ZP_00372116.1| C-5 cytosine-specific DNA methylase [Campylobacter upsaliensis
           RM3195]
 gi|57015523|gb|EAL52317.1| C-5 cytosine-specific DNA methylase [Campylobacter upsaliensis
           RM3195]
          Length = 315

 Score = 62.6 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   ++G +PQ RER+YII FL+      F FP  + +  ++  +LE+ +D     ++ 
Sbjct: 142 LNTSEYGNIPQNRERIYIIGFLDFHTYESFHFPAKIKLTQKIQHLLEKGVDKSFYYTSH 200


>gi|309789605|ref|ZP_07684186.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6]
 gi|308228341|gb|EFO81988.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6]
          Length = 342

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 37/100 (37%), Gaps = 18/100 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL----EEHIDDKSTISNK 56
           + A  +GVPQ RERL ++        F FP PL  K  +G+ L         +   ++  
Sbjct: 157 LNAVHYGVPQNRERLIVVG---HKGGFSFPKPLSTKVTVGEALGEMVHSTPPESKFLTPS 213

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFEN---SATTNTLSAR 93
           +     K +  +        Y     +      + TL+ R
Sbjct: 214 MDAYVAKYERAS--------YCKVPRDLHLDKPSRTLTCR 245


>gi|300869073|ref|ZP_07113674.1| Cytosine-specific methyltransferase (fragment) [Oscillatoria sp.
           PCC 6506]
 gi|300332930|emb|CBN58870.1| Cytosine-specific methyltransferase (fragment) [Oscillatoria sp.
           PCC 6506]
          Length = 345

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDILEEHID------DKSTI 53
           + A +FG+PQ RER++II       EFKF        P+L D L+   D       K T+
Sbjct: 141 LNAKNFGLPQHRERIFIIG--TKGKEFKFSKLKTKFPPKLRDFLDVEGDFEILDRSKYTL 198

Query: 54  SN 55
            +
Sbjct: 199 ID 200


>gi|9630267|ref|NP_046694.1| modification methylase [Bacillus phage SPBc2]
 gi|16079084|ref|NP_389907.1| SP-beta prophage DNA (cytosine-5-)-methyltransferase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221309931|ref|ZP_03591778.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221314254|ref|ZP_03596059.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221319176|ref|ZP_03600470.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221323451|ref|ZP_03604745.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|56405062|sp|P68585|MTBP_BACSU RecName: Full=Phi-3T prophage-derived modification methylase
           Phi3TI; Short=M.Phi3TI; AltName: Full=Cytosine-specific
           methyltransferase Phi3TI
 gi|56405063|sp|P68586|MTBP_BPPHT RecName: Full=Modification methylase Phi3TI; Short=M.Phi3TI;
           AltName: Full=Cytosine-specific methyltransferase Phi3TI
 gi|7433506|pir||T12906 modification methylase - Bacillus subtilis phage SPBc2
 gi|215471|gb|AAA32352.1| methyltransferase (ttg start codon) [Bacillus phage phi3T]
 gi|2634418|emb|CAB13917.1| putative SP-beta prophage DNA (cytosine-5-)-methyltransferase
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|3025620|gb|AAC13115.1| modification methylase [Bacillus phage SPbeta]
          Length = 443

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 33/85 (38%), Gaps = 30/85 (35%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30
           + +  F VPQ RER+YII      VE                              FK+P
Sbjct: 182 LNSKFFNVPQNRERVYIIGIREDLVENEQWVVGQKRNDVLSKGKKRLQEINIKSFNFKWP 241

Query: 31  TPLGIKPRLGDILEEHIDDKSTISN 55
               +  RL +ILE+ +D+K  ++ 
Sbjct: 242 LQDTVTKRLREILEDFVDEKYYLNE 266


>gi|208289|gb|AAA72678.1| Mtase protein (ttg start codon) [synthetic construct]
          Length = 474

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 33/85 (38%), Gaps = 30/85 (35%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE------------------------------FKFP 30
           + +  F VPQ RER+YII      VE                              FK+P
Sbjct: 182 LNSKFFNVPQNRERVYIIGIREDLVENEQWVVGQKRNDVLSKGKKRLQEINIKSFNFKWP 241

Query: 31  TPLGIKPRLGDILEEHIDDKSTISN 55
               +  RL +ILE+ +D+K  ++ 
Sbjct: 242 LQDTVTKRLREILEDFVDEKYYLNE 266


>gi|223937258|ref|ZP_03629164.1| DNA-cytosine methyltransferase [bacterium Ellin514]
 gi|223894043|gb|EEF60498.1| DNA-cytosine methyltransferase [bacterium Ellin514]
          Length = 408

 Score = 62.2 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 10/72 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER++I+ F +   +E+ FP P           +  +  K   +   WE
Sbjct: 186 LNAADYGVPQFRERVFIVGFRHDLGIEWSFPKPTHSY-------DALVKAKWV-TGDYWE 237

Query: 60  GHQKRKENNKIA 71
            H K  + ++  
Sbjct: 238 QH-KIAKKHRPK 248


>gi|331084584|ref|ZP_08333682.1| hypothetical protein HMPREF0992_02606 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330400654|gb|EGG80261.1| hypothetical protein HMPREF0992_02606 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 324

 Score = 61.5 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL--EEHIDDKSTISN 55
           + A  +G V Q RER+YI+ F +     +F +P  + +   + DI+  E  +D+K   + 
Sbjct: 146 LNAMTYGNVAQNRERIYIVAFRDEEDYEKFHWPLSIPLTNSVKDIIDFENKVDEKYYYTP 205


>gi|326571776|gb|EGE21785.1| DNA-cytosine methyltransferase [Moraxella catarrhalis BC7]
          Length = 458

 Score = 61.5 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 6/67 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + + D+GVPQ RER Y +       +  F+FP       +L DI+E   +DKS I +K  
Sbjct: 261 LNSYDYGVPQFRERWYCVAIRKDSDNGRFEFPKNRDRTTKLRDIIESDNNDKSLILSKFE 320

Query: 58  ---WEGH 61
                 H
Sbjct: 321 IDRINYH 327


>gi|227500535|ref|ZP_03930589.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus
           tetradius ATCC 35098]
 gi|227217363|gb|EEI82692.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus
           tetradius ATCC 35098]
          Length = 321

 Score = 61.5 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++  L  +  F F      + R L + LE+ + +  TI+   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFDKLERKETRTLSEFLEKDVSELYTITQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|254442311|ref|ZP_05055787.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
 gi|198256619|gb|EDY80927.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
          Length = 338

 Score = 61.5 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 5/66 (7%)

Query: 3   ACDFGVPQRRERLYIIDFL----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + DFGVPQ RER+Y +       N + +F FP        LG  L+   D    +S+  +
Sbjct: 156 SVDFGVPQMRERVYFVGVRKDLVNSNFDFTFPEKAKRVKGLGSYLKSK-DPSYALSDAGY 214

Query: 59  EGHQKR 64
              +K 
Sbjct: 215 AYLEKY 220


>gi|119511452|ref|ZP_01630563.1| modification methylase NlaIV [Nodularia spumigena CCY9414]
 gi|119463917|gb|EAW44843.1| modification methylase NlaIV [Nodularia spumigena CCY9414]
          Length = 433

 Score = 61.5 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 31/82 (37%), Gaps = 19/82 (23%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-----PT--------------PLGIKPRLGD 41
           + + +FG+PQ R R+Y+I  LN + +F       P                      + D
Sbjct: 148 LNSANFGLPQNRVRIYLIGILNATPKFNLMSDVGPKDSHTYNPQQMSLFHKPKRPATVAD 207

Query: 42  ILEEHIDDKSTISNKLWEGHQK 63
           ILE++   K   S       ++
Sbjct: 208 ILEDNPSSKYDCSPPFINALKR 229


>gi|237739124|ref|ZP_04569605.1| C-5 cytosine-specific DNA methylase [Fusobacterium sp. 2_1_31]
 gi|229423724|gb|EEO38771.1| C-5 cytosine-specific DNA methylase [Fusobacterium sp. 2_1_31]
          Length = 361

 Score = 61.1 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDK 50
           + A ++GV Q+RERL I+   N     + F FPTP   KP L DIL +  + K
Sbjct: 179 LNAWNYGVAQKRERLIIVGIRNDLINKLNFLFPTPHKYKPVLRDILLDCPESK 231


>gi|209524941|ref|ZP_03273486.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
 gi|209494590|gb|EDZ94900.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
          Length = 442

 Score = 61.1 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFG+PQ R+R++I+      N    F+FP PL + P+L D +E  +  K  I  K 
Sbjct: 160 INASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNLHPKLFDFVEG-VSQKPVIKKKF 218


>gi|159027646|emb|CAO89510.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 728

 Score = 61.1 bits (148), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL-----EEHIDDK-STIS 54
           + A DFGVPQ RER+ II   N    F         P+L D L      E++D K  T+ 
Sbjct: 146 LNAKDFGVPQNRERIIIIATQNKKFNFNSLKYTSPIPKLRDFLSPQGNFEYLDKKEYTLI 205

Query: 55  NK 56
           + 
Sbjct: 206 DN 207


>gi|218902126|ref|YP_002449960.1| cytosine-specific methyltransferase NlaX [Bacillus cereus AH820]
 gi|218538919|gb|ACK91317.1| cytosine-specific methyltransferase NlaX [Bacillus cereus AH820]
          Length = 350

 Score = 61.1 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 6/57 (10%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHI---DDKS 51
           + + ++G VPQ RER+YI+ FL    + +F FP P+ +   L  ++  +    D+K 
Sbjct: 153 LNSMEYGNVPQNRERIYIVGFLENELTAKFDFPAPIPLTNTLNTVINRNSSINDEKY 209


>gi|163938820|ref|YP_001643704.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4]
 gi|163861017|gb|ABY42076.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4]
          Length = 350

 Score = 61.1 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 6/57 (10%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHI---DDKS 51
           + + ++G VPQ RER+YI+ FL    + +F FP P+ +   L  ++  +    D+K 
Sbjct: 153 LNSMEYGNVPQNRERIYIVGFLENELTAKFDFPAPIPLTNTLNTVINRNSSINDEKY 209


>gi|257060181|ref|YP_003138069.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|256590347|gb|ACV01234.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 336

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 10/81 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DF +P +RER++I+ F +P ++F +   +     L  ILE ++      S ++   
Sbjct: 167 LNALDFALPHKRERIFIVGFRDP-LQFTWKNSIIPMKSLEKILENNVAQSYYASQQIRAN 225

Query: 61  -HQKRKEN--------NKIAG 72
             +K +          ++  G
Sbjct: 226 RLEKYQGKTYQEPTIWHENKG 246


>gi|331091845|ref|ZP_08340677.1| hypothetical protein HMPREF9477_01320 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402744|gb|EGG82311.1| hypothetical protein HMPREF9477_01320 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 410

 Score = 60.7 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A DFGVPQ+RERL  +   N     V F FP     KP L D+L
Sbjct: 227 LNAWDFGVPQKRERLITVGIRNDLVGKVSFSFPKEHDYKPVLRDVL 272


>gi|311064356|ref|YP_003971081.1| cytosine methyl transferase Dcm [Bifidobacterium bifidum PRL2010]
 gi|310866675|gb|ADP36044.1| Dcm Cytosine methyl transferase [Bifidobacterium bifidum PRL2010]
          Length = 326

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 44/108 (40%), Gaps = 23/108 (21%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK------PR-------LGDILEEH 46
           + A D+GVPQ R+R+ I+   N   VEF +P P   K      PR       + DI +  
Sbjct: 154 LNAADYGVPQTRQRVIIVGVRNDLDVEFTYPQPTNSKEGKNGLPRWISVQEAIKDIPDPD 213

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
             D  S  +N+  +         K+  + +      +    + T+ AR
Sbjct: 214 GPDADSVPNNEYSQY--------KVKPRNYTGHRITDPDKPSPTILAR 253


>gi|325270473|ref|ZP_08137075.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
 gi|324987196|gb|EGC19177.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
          Length = 365

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 49/98 (50%), Gaps = 13/98 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK---PRLGDILEE--HIDDKSTIS 54
           +KA ++G+PQRRER+ I+   +  +  +++P P+  +     L  +++E    D K   S
Sbjct: 158 LKAVEYGIPQRRERVIIVGIRDDLTFNYEYPAPVCTEAEATPLSAVIDELAITDSKYYFS 217

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            +  +G  K+ +NN   G      L+   S    T++A
Sbjct: 218 ERAVQG-VKKAKNNMKRG------LWQSLSQPCLTITA 248


>gi|238025826|ref|YP_002910057.1| DNA cytosine methyltransferase M.NgoMIII [Burkholderia glumae BGR1]
 gi|237875020|gb|ACR27353.1| DNA cytosine methyltransferase M.NgoMIII [Burkholderia glumae BGR1]
          Length = 407

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 11/69 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER++I+ F  +  V++ FP P      L  + ++ +  +       WE
Sbjct: 182 VNAADYGVPQKRERVFIVGFRSDLDVDWSFPRPTHSYDSL--LRDQWVTGEY------WE 233

Query: 60  GHQ--KRKE 66
            HQ  +R  
Sbjct: 234 RHQVPRRAR 242


>gi|23100788|ref|NP_694255.1| cytosine-specific DNA-methyltransferase [Oceanobacillus iheyensis
           HTE831]
 gi|22779022|dbj|BAC15289.1| cytosine-specific DNA-methyltransferase [Oceanobacillus iheyensis
           HTE831]
          Length = 370

 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           M   D+G +PQ RER++I+ F +     +F++P  +G+   + ++++  +  DD    + 
Sbjct: 177 MNTMDYGNIPQNRERIFIVGFKDEEKYNKFQWPQKIGLTKSIDNVIDRSKKQDDAYYYTE 236


>gi|166163613|gb|ABY83631.1| DNA methyltransferase Cfr42I [Citrobacter freundii]
          Length = 402

 Score = 60.3 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 9/62 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+G+PQ+RER++I+ F +   +E+ FP P      L  I ++ +          W+
Sbjct: 181 VNAADYGIPQKRERVFIVGFRDDLEIEWSFPKPTHSYDAL--IYDQWVTGDY------WK 232

Query: 60  GH 61
            H
Sbjct: 233 RH 234


>gi|325678044|ref|ZP_08157681.1| putative DNA (cytosine-5-)-methyltransferase [Ruminococcus albus 8]
 gi|324110261|gb|EGC04440.1| putative DNA (cytosine-5-)-methyltransferase [Ruminococcus albus 8]
          Length = 324

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 36/82 (43%), Gaps = 13/82 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEEHIDD------K 50
           + A D+GVPQ+RER+ ++   N     + ++ FP P      +   L   + +      +
Sbjct: 155 INAADYGVPQKRERVIMVGIRNDIFQKNGDYSFPQPTNEGKWVP--LSVAVPELAIENQR 212

Query: 51  STISNKLWEGHQKRKENNKIAG 72
              S K  +G +   +NN   G
Sbjct: 213 YYFSEKAVQGMKN-AKNNMKRG 233


>gi|328946253|gb|EGG40397.1| modification methylase Sau96I [Streptococcus sanguinis SK1087]
          Length = 333

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RER+ ++   N     + F++P P   KP L DIL
Sbjct: 151 LNAWDYGVAQKRERMIMVGIRNDLTDKITFEYPEPHDYKPVLKDIL 196


>gi|256821199|ref|YP_003142398.1| DNA-cytosine methyltransferase [Anaerococcus prevotii DSM 20548]
 gi|256799179|gb|ACV29833.1| DNA-cytosine methyltransferase [Anaerococcus prevotii DSM 20548]
          Length = 321

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  F   +  F        +P L + LE++I +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSQFGENNFSFNKLERKETRP-LSEFLEKNISELYTMTQPYML 209

Query: 60  GHQKRKENNKIAG-----KGFGYGL 79
               +  +N   G     K F Y +
Sbjct: 210 KFLNKGIDNSFKGRLKVIKDFSYTI 234


>gi|307140960|ref|ZP_07500316.1| DNA-cytosine methyltransferase [Escherichia coli H736]
 gi|331645014|ref|ZP_08346131.1| DNA cytosine methyltransferase M.NgoMIII [Escherichia coli H736]
 gi|331035989|gb|EGI08227.1| DNA cytosine methyltransferase M.NgoMIII [Escherichia coli H736]
          Length = 413

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGI 35
           + A D+GVPQ+RER++I+ F +   +E+ FP P   
Sbjct: 192 VNAADYGVPQKRERVFIVGFRDDLEIEWSFPKPTHS 227


>gi|113477918|ref|YP_723979.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101]
 gi|110168966|gb|ABG53506.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101]
          Length = 337

 Score = 60.3 bits (146), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 40/102 (39%), Gaps = 22/102 (21%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-----IDDKSTISN 55
           +   DFGVPQ R+R+ +I       EF FP  L  K  +G+ LEE       + K  ++ 
Sbjct: 155 LNTVDFGVPQNRQRVIVIG---HKGEFTFPQVLDKKVTVGEALEEMAFHAPPESKF-LTP 210

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSAT----TNTLSAR 93
            + +  +K ++ +                        TL+ R
Sbjct: 211 SMDKYIEKYEKASSCK---------QPRDLYLDKPARTLTCR 243


>gi|313668596|ref|YP_004048880.1| DNA cytosine methyltransferase [Neisseria lactamica ST-640]
 gi|313006058|emb|CBN87519.1| DNA cytosine methyltransferase [Neisseria lactamica 020-06]
          Length = 393

 Score = 60.3 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 21/98 (21%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER+ I+    +  +++KFP     + RL         +K   + + WE
Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKETHSEDRLN-------WEKYV-TGEYWE 221

Query: 60  GH-------QKRKENNKIAGKGFGYGLFFENSATTNTL 90
            H       +   E  +       YG+F        T+
Sbjct: 222 KHNEPKRFNKDIAEKLQKK-----YGIFEPEKKPWQTV 254


>gi|332970702|gb|EGK09683.1| DNA (cytosine-5-)-methyltransferase [Kingella kingae ATCC 23330]
          Length = 197

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46
           + A +FGVPQ+RER++I+ F +     +F+FP  L  K  L   L+E 
Sbjct: 144 LNASEFGVPQKRERVFIVGFRDDEDFFKFQFPETLPEKIPLKYALDEQ 191


>gi|218900598|ref|YP_002449009.1| modification methylase HaeIII [Bacillus cereus G9842]
 gi|218544695|gb|ACK97089.1| modification methylase HaeIII [Bacillus cereus G9842]
          Length = 313

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 44/107 (41%), Gaps = 17/107 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDI-----LEEHIDDKSTIS 54
           + A D+GVPQ R+R++I+       + + +PTP   +    D+     L++ +     +S
Sbjct: 145 LNAADYGVPQTRQRVFIVGVRKDLDLTYSYPTPTHEESPTFDLFNLNALQKWVTIGEALS 204

Query: 55  N--------KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           +         L           ++   G+      + +  + T++AR
Sbjct: 205 DIPEPDEAHNLLNHVYS---QYRLKFNGYIGHRVTDPNKPSPTITAR 248


>gi|167751358|ref|ZP_02423485.1| hypothetical protein EUBSIR_02344 [Eubacterium siraeum DSM 15702]
 gi|167655604|gb|EDR99733.1| hypothetical protein EUBSIR_02344 [Eubacterium siraeum DSM 15702]
          Length = 316

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHI--DDKSTISN 55
            ACD+G+PQ R R YI+ F +      F+FP    ++  L D++++ +   D+  +S 
Sbjct: 144 DACDYGIPQHRTRTYIVAFKSQKACDSFRFPEKCELQKHLFDVIDKTVKGKDRYYVSE 201


>gi|195867949|ref|ZP_03079946.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           9 str. ATCC 33175]
 gi|195660345|gb|EDX53605.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           9 str. ATCC 33175]
          Length = 319

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           +   D+G VPQ RER+YI+ FL+      FK+P P+ +   + D+++
Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEAFKYPCPITLTNTIRDVID 192


>gi|171920707|ref|ZP_02931926.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 13
           str. ATCC 33698]
 gi|185179015|ref|ZP_02964765.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 5
           str. ATCC 27817]
 gi|188024024|ref|ZP_02996783.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 7
           str. ATCC 27819]
 gi|188518336|ref|ZP_03003849.1| cytosine-specific methyltransferase NlaX [Ureaplasma urealyticum
           serovar 11 str. ATCC 33695]
 gi|188524309|ref|ZP_03004347.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           12 str. ATCC 33696]
 gi|198273488|ref|ZP_03206024.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           4 str. ATCC 27816]
 gi|225550923|ref|ZP_03771872.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           2 str. ATCC 27814]
 gi|225551062|ref|ZP_03772008.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           8 str. ATCC 27618]
 gi|171903447|gb|EDT49736.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 13
           str. ATCC 33698]
 gi|184209104|gb|EDU06147.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 5
           str. ATCC 27817]
 gi|188019052|gb|EDU57092.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 7
           str. ATCC 27819]
 gi|188997975|gb|EDU67072.1| cytosine-specific methyltransferase NlaX [Ureaplasma urealyticum
           serovar 11 str. ATCC 33695]
 gi|195660089|gb|EDX53469.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           12 str. ATCC 33696]
 gi|198250008|gb|EDY74788.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           4 str. ATCC 27816]
 gi|225378877|gb|EEH01242.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           8 str. ATCC 27618]
 gi|225380077|gb|EEH02439.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           2 str. ATCC 27814]
          Length = 319

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           +   D+G VPQ RER+YI+ FL+      FK+P P+ +   + D+++
Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEAFKYPCPITLTNTIRDVID 192


>gi|34451619|gb|AAQ72366.1| TspRI methylase [Thermus sp. R]
          Length = 431

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT----PLGIKPRLG 40
           + A DFGVPQ R+R++ +    P +EF++P     PLG  P + 
Sbjct: 215 LNAADFGVPQHRKRIFFVGVR-PGIEFRWPRPTHGPLGEHPWVS 257


>gi|2765225|emb|CAA73243.1| methylase [Lactococcus lactis subsp. cremoris]
          Length = 317

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 2   KACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE--EHIDDKSTIS 54
            A ++G +PQ RER+YI+ F N      F+ P  + +K  + D+++  +  DDK   +
Sbjct: 146 NASEYGNIPQNRERIYIVAFKNKKDYANFELPKSIPLKTTIHDVIDFSKKQDDKFYYT 203


>gi|59801568|ref|YP_208280.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae FA
           1090]
 gi|194097887|ref|YP_002000932.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998362|ref|ZP_04718286.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           35/02]
 gi|240113683|ref|ZP_04728173.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           MS11]
 gi|240116425|ref|ZP_04730487.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           PID18]
 gi|240117164|ref|ZP_04731226.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           PID1]
 gi|240125114|ref|ZP_04738000.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           SK-92-679]
 gi|254494438|ref|ZP_05107609.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae 1291]
 gi|260441646|ref|ZP_05795462.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           DGI2]
 gi|268594223|ref|ZP_06128390.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           35/02]
 gi|268599750|ref|ZP_06133917.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae MS11]
 gi|268602094|ref|ZP_06136261.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID18]
 gi|268602852|ref|ZP_06137019.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID1]
 gi|268683710|ref|ZP_06150572.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae
           SK-92-679]
 gi|291045024|ref|ZP_06570732.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           DGI2]
 gi|10444408|gb|AAG17898.1|AF297971_2 DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae]
 gi|59718463|gb|AAW89868.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae FA
           1090]
 gi|193933177|gb|ACF29001.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           NCCP11945]
 gi|226513478|gb|EEH62823.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae 1291]
 gi|268547612|gb|EEZ43030.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           35/02]
 gi|268583881|gb|EEZ48557.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae MS11]
 gi|268586225|gb|EEZ50901.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID18]
 gi|268586983|gb|EEZ51659.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID1]
 gi|268623994|gb|EEZ56394.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae
           SK-92-679]
 gi|291011027|gb|EFE03024.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           DGI2]
 gi|317163651|gb|ADV07192.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 377

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 21/98 (21%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER+ I+    +  +++KFP     + RL         +K   + + WE
Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKRTHSEDRLN-------WEKYV-TGEYWE 221

Query: 60  GH-------QKRKENNKIAGKGFGYGLFFENSATTNTL 90
            H       +   E  +       YG+F        T+
Sbjct: 222 KHNEPKRFNKDIAEKLQKK-----YGIFEPEKKPWQTV 254


>gi|254445875|ref|ZP_05059351.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
 gi|198260183|gb|EDY84491.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
          Length = 321

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/45 (48%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ R+RLYI+       S EFKFP   G + RL D+L
Sbjct: 147 LNASDYGVPQARKRLYIVGIRKDLGSGEFKFPETSGARVRLKDLL 191


>gi|261839203|gb|ACX98968.1| DNA-cytosine methyltransferase [Helicobacter pylori 52]
          Length = 309

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISN-K 56
           +   ++  +PQ RER+YI+ FL+ +    F FP  +     + D+LE  + ++      +
Sbjct: 142 LNTYEYSTIPQNRERIYIVGFLDKNHYKRFHFPLKVNHTQSIKDLLEIKVGEEFYYKQYR 201

Query: 57  LWEGHQK 63
            +E  +K
Sbjct: 202 FYETLKK 208


>gi|256544753|ref|ZP_05472125.1| type II restriction-modification system methylation subunit
           [Anaerococcus vaginalis ATCC 51170]
 gi|256399642|gb|EEU13247.1| type II restriction-modification system methylation subunit
           [Anaerococcus vaginalis ATCC 51170]
          Length = 320

 Score = 59.9 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++      +  F        +P L D LE+ + +  T++   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSDFLEKDVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|314055145|ref|YP_004063483.1| putative cytosine-specific methyltransferase [Ostreococcus tauri
           virus 2]
 gi|313575036|emb|CBI70049.1| putative cytosine-specific methyltransferase [Ostreococcus tauri
           virus 2]
          Length = 349

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 27/43 (62%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43
           +KA + GVPQ+RERL+I+   +    F+FP P   +  L DIL
Sbjct: 152 LKAHEHGVPQKRERLFIVGSRDADFTFEFPEPSNNEVGLKDIL 194


>gi|322511205|gb|ADX06517.1| putative C-5 cytosine specific DNA methyltransferase [Organic Lake
           phycodnavirus]
          Length = 384

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 1   MKACDF-GVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   D  G+P  RER+YI+   + +V  +F    P   K ++ + LE  I +K   ++K
Sbjct: 214 LNTADITGIPHHRERIYIVCIKSKNVFDKFNLDFPKINKKKISEFLEHDIPEKYYYTDK 272


>gi|309380076|emb|CBX21487.1| putative DNA cytosine methyltransferase [Neisseria lactamica
           Y92-1009]
          Length = 377

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 21/98 (21%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER+ I+    +  +++KFP     + RL         +K   + + WE
Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKETHSEDRLN-------WEKYV-TGEYWE 221

Query: 60  GH-------QKRKENNKIAGKGFGYGLFFENSATTNTL 90
            H       +   E  +       YG+F        T+
Sbjct: 222 KHNEPKRFNKDIAEKLQKK-----YGIFEPEKKPWQTV 254


>gi|322376119|ref|ZP_08050628.1| DNA modification methylase [Streptococcus sp. C300]
 gi|321278887|gb|EFX55931.1| DNA modification methylase [Streptococcus sp. C300]
          Length = 406

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        F+FP  + +   L D++   + +D+      
Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDSFEFPEEIKLTTSLQDVINFGDKLDEVYYYRE 217


>gi|157151353|ref|YP_001449946.1| cytosine-specific methyltransferase [Streptococcus gordonii str.
           Challis substr. CH1]
 gi|157076147|gb|ABV10830.1| cytosine-specific methyltransferase [Streptococcus gordonii str.
           Challis substr. CH1]
          Length = 406

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        FKFP  + +   L D++   + +D+     +
Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFKFPEAIKLTTSLQDVINFGDKLDEVYYYRD 217


>gi|94995093|ref|YP_603191.1| Type II restriction-modification system methylation subunit
           [Streptococcus pyogenes MGAS10750]
 gi|94548601|gb|ABF38647.1| Type II restriction-modification system methylation subunit
           [Streptococcus pyogenes MGAS10750]
          Length = 321

 Score = 59.5 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++  L  +  F F      + R L + LE+++ +  T++   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFDKLERKETRPLSEFLEKNVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|291549830|emb|CBL26092.1| DNA-methyltransferase (dcm) [Ruminococcus torques L2-14]
          Length = 410

 Score = 59.5 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ+RERL  I   N       F FP     KP L DIL
Sbjct: 227 LNAWDYGVPQKRERLITIGIRNDLVEKTSFTFPKEQEYKPVLRDIL 272


>gi|313890914|ref|ZP_07824537.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|313120711|gb|EFR43827.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus
           SPIN 20026]
          Length = 316

 Score = 59.2 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++      +  F        +P L D LE+ + +  T++   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSDFLEKDVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|193216537|ref|YP_001999779.1| cytosine-specific methyltransferase, related to HhaI [Mycoplasma
           arthritidis 158L3-1]
 gi|193001860|gb|ACF07075.1| cytosine-specific methyltransferase, related to HhaI [Mycoplasma
           arthritidis 158L3-1]
          Length = 327

 Score = 59.2 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKP 37
           + + +FGVPQ+RER+Y++ F        F FP P  +  
Sbjct: 152 LNSLNFGVPQKRERIYMVCFRRDLNIKNFSFPKPFKLST 190


>gi|77409601|ref|ZP_00786278.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae COH1]
 gi|77171795|gb|EAO74987.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae COH1]
          Length = 333

 Score = 59.2 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 40/100 (40%), Gaps = 27/100 (27%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A D+GV Q+RER+ ++   N  V    F++P P   KP L DIL +        S  +
Sbjct: 151 LNAWDYGVAQKRERMIMVGIRNDLVNMTSFEYPKPHDYKPVLRDILLDCPP-----SQGM 205

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97
               QKRK           + L              Y+KD
Sbjct: 206 QYSEQKRKI----------FELVPPGG---------YWKD 226


>gi|319779706|ref|YP_004130619.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9]
 gi|317109730|gb|ADU92476.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9]
          Length = 329

 Score = 59.2 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + +CD+G+PQ R R++++ F       EFKFP P  +   + DIL   
Sbjct: 152 LNSCDYGIPQSRARIFMVAFREDLKHQEFKFPAPKNLDKYVEDILLPD 199


>gi|153933427|ref|YP_001385281.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. ATCC 19397]
 gi|153933974|ref|YP_001384769.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. ATCC 19397]
 gi|153935154|ref|YP_001386762.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
 gi|153935271|ref|YP_001386815.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
 gi|153937696|ref|YP_001388073.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
 gi|152929471|gb|ABS34971.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. ATCC 19397]
 gi|152930018|gb|ABS35518.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. ATCC 19397]
 gi|152931068|gb|ABS36567.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
 gi|152931185|gb|ABS36684.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
 gi|152933610|gb|ABS39109.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
          Length = 315

 Score = 59.2 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 11/93 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-PRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++ I  L+ ++ F F      K P + + LE+  ++K  ++   + 
Sbjct: 149 LNALDFGLPQKRERVFTISCLDGTL-FNFNALERKKAPHIREFLEDTQEEKYIVTQPSML 207

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                 K+ +   G  FG G     +   +T++
Sbjct: 208 ------KKMHDKNGN-FG-GRVEVINDCCSTIT 232


>gi|209554428|ref|YP_002284952.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 10
           str. ATCC 33699]
 gi|209541929|gb|ACI60158.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 10
           str. ATCC 33699]
          Length = 319

 Score = 59.2 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE 44
           +   D+G VPQ RER+YI+ FL+      FK+P P+ +   + D+++
Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEVFKYPCPITLTNTIRDVID 192


>gi|169824652|ref|YP_001692263.1| cytosine-specific DNA-methyltransferase [Finegoldia magna ATCC
           29328]
 gi|297588631|ref|ZP_06947274.1| type II restriction-modification system methylation subunit
           [Finegoldia magna ATCC 53516]
 gi|304440076|ref|ZP_07399968.1| type II restriction-modification system methylation subunit
           [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|167831457|dbj|BAG08373.1| cytosine-specific DNA-methyltransferase [Finegoldia magna ATCC
           29328]
 gi|297574004|gb|EFH92725.1| type II restriction-modification system methylation subunit
           [Finegoldia magna ATCC 53516]
 gi|304371443|gb|EFM25057.1| type II restriction-modification system methylation subunit
           [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 320

 Score = 59.2 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 7/85 (8%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++      +  F        +P L + LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209

Query: 60  GHQKRKENNKIAG-----KGFGYGL 79
               +  +N   G     K F Y +
Sbjct: 210 KFLNKSIDNSFRGRLKVIKDFSYTI 234


>gi|326802740|ref|YP_004320558.1| DNA (cytosine-5-)-methyltransferase [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651598|gb|AEA01781.1| DNA (cytosine-5-)-methyltransferase [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 321

 Score = 59.2 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 7/85 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R L + LE+ +    T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-SFSFDKLERKETRPLSEFLEKDVSGLYTMTQPYML 209

Query: 60  GHQKRKENNKIAG-----KGFGYGL 79
               +  +N   G     K F Y +
Sbjct: 210 KFLNKGIDNSFKGRLKVIKDFSYTI 234


>gi|332362221|gb|EGJ40021.1| DNA methylase [Streptococcus sanguinis SK1056]
          Length = 412

 Score = 58.8 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        F+FP  + +   L D++   + +D+      
Sbjct: 164 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTTLQDVINFGDQLDEVYYYRE 223


>gi|239812977|ref|YP_002941924.1| DNA-cytosine methyltransferase [Geobacillus sp. WCH70]
 gi|239809042|gb|ACS26105.1| DNA-cytosine methyltransferase [Geobacillus sp. WCH70]
          Length = 370

 Score = 58.8 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 11/64 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK---------PRLGDILEE-HIDD 49
           + A D+GVPQ+RER++II   N  +++++FP P   +           +G++LE   +++
Sbjct: 172 INAADYGVPQKRERVFIIGVRNDLNIQYEFPEPTHNEDGSDGKLPWVTVGEVLENLQVEE 231

Query: 50  KSTI 53
              I
Sbjct: 232 HHFI 235


>gi|307067513|ref|YP_003876479.1| site-specific DNA methylase [Streptococcus pneumoniae AP200]
 gi|306409050|gb|ADM84477.1| Site-specific DNA methylase [Streptococcus pneumoniae AP200]
          Length = 321

 Score = 58.8 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++ +L   +  F        +P L + LE  + +  T++   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSYLGANNFSFNKLERKETRP-LSEFLENDVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|189339547|pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer
           Gcgc-Gmgc Oligonucleotide And Sah
          Length = 327

 Score = 58.8 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RE +Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKRENIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|189096047|pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer
           Gcgc-Gmgc Oligonucleotide And Sah
          Length = 327

 Score = 58.8 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+ ER+Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKNERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|195867543|ref|ZP_03079546.1| type II restriction-modification system methylation subunit
           [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
 gi|195867960|ref|ZP_03079957.1| type II restriction-modification system methylation subunit
           [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
 gi|195660356|gb|EDX53616.1| type II restriction-modification system methylation subunit
           [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
 gi|195660787|gb|EDX54041.1| type II restriction-modification system methylation subunit
           [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
          Length = 323

 Score = 58.8 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 7/85 (8%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++      +  F        +P L + LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209

Query: 60  GHQKRKENNKIAG-----KGFGYGL 79
               +  +N   G     K F Y +
Sbjct: 210 KFLNKGIDNSFKGRLKVIKDFSYTI 234


>gi|294668765|ref|ZP_06733858.1| modification methylase BsuRI [Neisseria elongata subsp. glycolytica
           ATCC 29315]
 gi|291309282|gb|EFE50525.1| modification methylase BsuRI [Neisseria elongata subsp. glycolytica
           ATCC 29315]
          Length = 313

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 10/76 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG------IKPRLGDILEEHID---DK 50
           + A D+GVPQ R+R++I+   N    E+ FP P            +G+ L    D    +
Sbjct: 141 LNAADYGVPQLRKRIFIVGIRNDIGAEYTFPAPTHGTEGKPPHITIGEALRGMPDWPEGE 200

Query: 51  STISNKLWEGHQKRKE 66
                  W    + + 
Sbjct: 201 YYDRPFHWYYLSRNRR 216


>gi|312902257|ref|ZP_07761465.1| helix-turn-helix protein [Enterococcus faecalis TX0635]
 gi|283466064|emb|CBG92839.1| hypothetical protein [Enterococcus casseliflavus]
 gi|310634316|gb|EFQ17599.1| helix-turn-helix protein [Enterococcus faecalis TX0635]
          Length = 470

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEEHIDD 49
           + A ++GV Q+RER+ II   N   E     FKFP     +P L D+L++    
Sbjct: 286 LNAWNYGVAQKRERIVIIGIRNDLFEQQQYSFKFPKEYTYQPVLRDVLKDVPKS 339


>gi|261840146|gb|ACX99911.1| cytosine-specific methyltransferase [Helicobacter pylori 52]
          Length = 343

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A + GV Q+RERL+I+      +  F FP PL  K  L DIL
Sbjct: 151 LNASNHGVAQKRERLFIVGIRKDLNRSFNFPKPLKNKKVLKDIL 194


>gi|257867246|ref|ZP_05646899.1| DNA methyltransferase [Enterococcus casseliflavus EC30]
 gi|257873580|ref|ZP_05653233.1| DNA methyltransferase [Enterococcus casseliflavus EC10]
 gi|257801302|gb|EEV30232.1| DNA methyltransferase [Enterococcus casseliflavus EC30]
 gi|257807744|gb|EEV36566.1| DNA methyltransferase [Enterococcus casseliflavus EC10]
          Length = 470

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEEHIDD 49
           + A ++GV Q+RER+ II   N   E     FKFP     +P L D+L++    
Sbjct: 286 LNAWNYGVAQKRERIVIIGIRNDLFEQQQYSFKFPKEYTYQPVLRDVLKDVPKS 339


>gi|209901299|ref|YP_002290938.1| putative DNA methylase [Clostridium phage phiCD27]
 gi|199612180|gb|ACH91353.1| putative DNA methylase [Clostridium phage phiCD27]
          Length = 276

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDI 42
           + + +FGVPQ RER++I+  F   S    FP     +  L  +
Sbjct: 150 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSRKNLEQL 192


>gi|284051619|ref|ZP_06381829.1| DNA-cytosine methyltransferase [Arthrospira platensis str. Paraca]
          Length = 443

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILE 44
           + A DFG+PQ R+R++I+      N    F+FP PL   P+L + +E
Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206


>gi|313888225|ref|ZP_07821897.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845756|gb|EFR33145.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 321

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 7/85 (8%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++      +  F        +P L + LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209

Query: 60  GHQKRKENNKIAG-----KGFGYGL 79
               +  +N   G     K F Y +
Sbjct: 210 KFLNKGIDNSFKGRLKVIKDFSYTI 234


>gi|126698504|ref|YP_001087401.1| putative DNA methylase [Clostridium difficile 630]
 gi|115249941|emb|CAJ67761.1| putative phage DNA modification methylase [Clostridium difficile]
          Length = 357

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDI 42
           + + +FGVPQ RER++I+  F   S    FP     +  L  +
Sbjct: 150 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSRKNLEQL 192


>gi|307710826|ref|ZP_07647254.1| DNA-cytosine methyltransferase family protein [Streptococcus mitis
           SK321]
 gi|307617432|gb|EFN96604.1| DNA-cytosine methyltransferase family protein [Streptococcus mitis
           SK321]
          Length = 406

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        F+FP  + +   L D++   + +D+      
Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTSLQDVINFGDKLDEVYYYRE 217


>gi|291570812|dbj|BAI93084.1| cytosine-specific DNA methyltransferase [Arthrospira platensis
           NIES-39]
          Length = 443

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILE 44
           + A DFG+PQ R+R++I+      N    F+FP PL   P+L + +E
Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206


>gi|158431504|pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna
           Methyltransferase With Unmodified Dna And Adohcy
          Length = 327

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G+PQ+RE +Y+I F N      F+FP P  +   + D+L   
Sbjct: 152 LNALDYGIPQKREAIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPD 199


>gi|254825117|ref|ZP_05230118.1| DNA-cytosine methyltransferase [Listeria monocytogenes FSL J1-194]
 gi|293594360|gb|EFG02121.1| DNA-cytosine methyltransferase [Listeria monocytogenes FSL J1-194]
          Length = 326

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           +   DFG+PQ+RER+Y +  L+ P  +F       ++P + + LE  +DD  TI 
Sbjct: 149 LNPMDFGIPQKRERIYTVSVLSGPQFDFSKLKKEPMRP-INEFLETDVDDIYTIK 202


>gi|302380785|ref|ZP_07269249.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna
           ACS-171-V-Col3]
 gi|302311385|gb|EFK93402.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna
           ACS-171-V-Col3]
          Length = 321

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++  L  +  F F      + R L + LE+ +    T++   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-SFSFDKLERKETRPLSEFLEKDVSGLYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|20385949|gb|AAM21516.1|AF438205_2 GST-M.SPRX methyltransferase fusion protein [Mutation screening
           vector pSPRX]
          Length = 659

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 31/85 (36%), Gaps = 30/85 (35%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RERLYII                                   S  F++ 
Sbjct: 375 LNSKFFNVPQNRERLYIIGIREDLIKNEEWSLDFKRKDILQKGKQRLVELDIKSFNFRWT 434

Query: 31  TPLGIKPRLGDILEEHIDDKSTISN 55
                  RL D+LEE++D+K  ++ 
Sbjct: 435 AQSAATKRLKDLLEEYVDEKYYLNE 459


>gi|108563484|ref|YP_627800.1| type II DNA modification enzyme [Helicobacter pylori HPAG1]
 gi|107837257|gb|ABF85126.1| type II DNA modification enzyme [Helicobacter pylori HPAG1]
          Length = 313

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 31/72 (43%), Gaps = 4/72 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK--L 57
           + + DF + Q+RERLYI+ F       F FP  L       D L+   ++    +N    
Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFNDFLDAD-NECYLDTNNATF 197

Query: 58  WEGHQKRKENNK 69
               + R  +N+
Sbjct: 198 QRYLRNRYNHNR 209


>gi|306824635|ref|ZP_07457980.1| DNA methylase [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304433203|gb|EFM36174.1| DNA methylase [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 410

 Score = 58.4 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        F+FP  + +   L D++   + +D+      
Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTTLQDVINFGDKLDEVYYYRE 217


>gi|216171|gb|AAA32604.1| DNA methyltransferase [Bacillus phage SPR]
          Length = 439

 Score = 58.4 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 31/85 (36%), Gaps = 30/85 (35%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RERLYII                                   S  F++ 
Sbjct: 149 LNSKFFNVPQNRERLYIIGIREDLIKNEEWSLDFKRKDILQKGKQRLVELDIKSFNFRWT 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISN 55
                  RL D+LEE++D+K  ++ 
Sbjct: 209 AQSAATKRLKDLLEEYVDEKYYLNE 233


>gi|322392562|ref|ZP_08066022.1| DNA methylase [Streptococcus peroris ATCC 700780]
 gi|321144554|gb|EFX39955.1| DNA methylase [Streptococcus peroris ATCC 700780]
          Length = 406

 Score = 58.4 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        F+FP  + +   L D++   + +D+      
Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTSLQDVINFGDQLDEVYYYRE 217


>gi|127431|sp|P00476|MTBS_BPSPR RecName: Full=Modification methylase SPRI; Short=M.SPRI; AltName:
           Full=Cytosine-specific methyltransferase SPRI
 gi|224091|prf||1010250A methyltransferase
          Length = 439

 Score = 58.4 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 31/85 (36%), Gaps = 30/85 (35%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RERLYII                                   S  F++ 
Sbjct: 149 LNSKFFNVPQNRERLYIIGIREDLIKNEEWSLDFKRKDILQKGKQRLVELDIKSFNFRWT 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISN 55
                  RL D+LEE++D+K  ++ 
Sbjct: 209 AQSAATKRLKDLLEEYVDEKYYLNE 233


>gi|282883032|ref|ZP_06291633.1| type II restriction-modification system methylation subunit
           [Peptoniphilus lacrimalis 315-B]
 gi|281297089|gb|EFA89584.1| type II restriction-modification system methylation subunit
           [Peptoniphilus lacrimalis 315-B]
          Length = 312

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++      +  F        +P L + LE+++ +  T++   + 
Sbjct: 151 LNAVDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKNVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|228899601|ref|ZP_04063856.1| Modification methylase SinI [Bacillus thuringiensis IBL 4222]
 gi|228860031|gb|EEN04436.1| Modification methylase SinI [Bacillus thuringiensis IBL 4222]
          Length = 362

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36
           + A ++GVPQ+RER++II         F+FP P   +
Sbjct: 171 LNAANYGVPQKRERVFIIGIRQDLKKTFEFPEPTHNE 207


>gi|134287405|ref|YP_001110788.1| putative cytosine-C5 specific DNA methylase [Clostridium phage
           phiC2]
 gi|93117243|gb|ABE99533.1| putative cytosine-C5 specific DNA methylase [Clostridium phage
           phiC2]
          Length = 316

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDI 42
           + + +FGVPQ RER++I+  F   S    FP     +  L  +
Sbjct: 133 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSRKNLEQL 175


>gi|300813808|ref|ZP_07094115.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus sp. oral taxon
           836 str. F0141]
 gi|300512098|gb|EFK39291.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus sp. oral taxon
           836 str. F0141]
          Length = 321

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++      +  F        +P L + LE+ + +  T++   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|240128365|ref|ZP_04741026.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268686763|ref|ZP_06153625.1| DNA modification methylase [Neisseria gonorrhoeae SK-93-1035]
 gi|268627047|gb|EEZ59447.1| DNA modification methylase [Neisseria gonorrhoeae SK-93-1035]
          Length = 423

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +    T S+   + 
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 213 LLKKFPPSELYGK 225


>gi|79835495|gb|ABB52098.1| Mod [Arthrospira platensis]
          Length = 412

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILE 44
           + A DFG+PQ R+R++I+      N    F+FP PL   P+L + +E
Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVE 206


>gi|59801103|ref|YP_207815.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA 1090]
 gi|121634967|ref|YP_975212.1| DNA modification methylase [Neisseria meningitidis FAM18]
 gi|194098793|ref|YP_002001855.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           NCCP11945]
 gi|239999085|ref|ZP_04719009.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           35/02]
 gi|240014008|ref|ZP_04720921.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           DGI18]
 gi|240016449|ref|ZP_04722989.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA6140]
 gi|240080568|ref|ZP_04725111.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA19]
 gi|240113063|ref|ZP_04727553.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           MS11]
 gi|240115818|ref|ZP_04729880.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID18]
 gi|240118116|ref|ZP_04732178.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID1]
 gi|240121574|ref|ZP_04734536.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID24-1]
 gi|240123666|ref|ZP_04736622.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID332]
 gi|240125856|ref|ZP_04738742.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           SK-92-679]
 gi|254493863|ref|ZP_05107034.1| DNA modification methylase [Neisseria gonorrhoeae 1291]
 gi|260440365|ref|ZP_05794181.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           DGI2]
 gi|268594923|ref|ZP_06129090.1| DNA modification methylase [Neisseria gonorrhoeae 35/02]
 gi|268596698|ref|ZP_06130865.1| DNA modification methylase [Neisseria gonorrhoeae FA19]
 gi|268599147|ref|ZP_06133314.1| DNA modification methylase [Neisseria gonorrhoeae MS11]
 gi|268601493|ref|ZP_06135660.1| DNA modification methylase [Neisseria gonorrhoeae PID18]
 gi|268603831|ref|ZP_06137998.1| DNA modification methylase [Neisseria gonorrhoeae PID1]
 gi|268682295|ref|ZP_06149157.1| DNA modification methylase [Neisseria gonorrhoeae PID332]
 gi|268684453|ref|ZP_06151315.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679]
 gi|291043662|ref|ZP_06569378.1| DNA modification methylase [Neisseria gonorrhoeae DGI2]
 gi|293398965|ref|ZP_06643130.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|59717998|gb|AAW89403.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA 1090]
 gi|120866673|emb|CAM10425.1| DNA modification methylase [Neisseria meningitidis FAM18]
 gi|193934083|gb|ACF29907.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           NCCP11945]
 gi|226512903|gb|EEH62248.1| DNA modification methylase [Neisseria gonorrhoeae 1291]
 gi|268548312|gb|EEZ43730.1| DNA modification methylase [Neisseria gonorrhoeae 35/02]
 gi|268550486|gb|EEZ45505.1| DNA modification methylase [Neisseria gonorrhoeae FA19]
 gi|268583278|gb|EEZ47954.1| DNA modification methylase [Neisseria gonorrhoeae MS11]
 gi|268585624|gb|EEZ50300.1| DNA modification methylase [Neisseria gonorrhoeae PID18]
 gi|268587962|gb|EEZ52638.1| DNA modification methylase [Neisseria gonorrhoeae PID1]
 gi|268622579|gb|EEZ54979.1| DNA modification methylase [Neisseria gonorrhoeae PID332]
 gi|268624737|gb|EEZ57137.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679]
 gi|291012125|gb|EFE04114.1| DNA modification methylase [Neisseria gonorrhoeae DGI2]
 gi|291610379|gb|EFF39489.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|317164377|gb|ADV07918.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 423

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +    T S+   + 
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 213 LLKKFPPSELYGK 225


>gi|218768275|ref|YP_002342787.1| DNA modification methylase [Neisseria meningitidis Z2491]
 gi|121052283|emb|CAM08611.1| DNA modification methylase [Neisseria meningitidis Z2491]
          Length = 423

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +    T S+   + 
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 213 LLKKFPPSELYGK 225


>gi|308061704|gb|ADO03592.1| DNA-cytosine methyltransferase [Helicobacter pylori Cuz20]
 gi|308063214|gb|ADO05101.1| DNA-cytosine methyltransferase [Helicobacter pylori Sat464]
 gi|317180749|dbj|BAJ58535.1| DNA-cytosine methyltransferase [Helicobacter pylori F32]
          Length = 309

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISN-K 56
           +   ++  +PQ RER+YII FL+ +    F FP  +     + D+LE  + ++      +
Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYYKQYR 201

Query: 57  LWEGHQK 63
            +E  +K
Sbjct: 202 FYETLKK 208


>gi|227484740|ref|ZP_03915056.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus
           lactolyticus ATCC 51172]
 gi|227237262|gb|EEI87277.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus
           lactolyticus ATCC 51172]
          Length = 321

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++      +  F        +P L + LE+ + +  T++   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|188527161|ref|YP_001909848.1| DNA-cytosine methyltransferase [Helicobacter pylori Shi470]
 gi|188143401|gb|ACD47818.1| DNA-cytosine methyltransferase [Helicobacter pylori Shi470]
          Length = 309

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISN-K 56
           +   ++  +PQ RER+YII FL+ +    F FP  +     + D+LE  + ++      +
Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYYKQYR 201

Query: 57  LWEGHQK 63
            +E  +K
Sbjct: 202 FYETLKK 208


>gi|317181696|dbj|BAJ59480.1| DNA-cytosine methyltransferase [Helicobacter pylori F57]
          Length = 309

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISN-K 56
           +   ++  +PQ RER+YII FL+ +    F FP  +     + D+LE  + ++      +
Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYYKQYR 201

Query: 57  LWEGHQK 63
            +E  +K
Sbjct: 202 FYETLKK 208


>gi|325849320|ref|ZP_08170737.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325480182|gb|EGC83251.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 321

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++      +  F        +P L + LE+ + +  T++   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKDVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|317008995|gb|ADU79575.1| DNA-cytosine methyltransferase [Helicobacter pylori India7]
          Length = 309

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           +   ++  +PQ RER+YII FL+ +    F FP  +     + D+LE  + ++    
Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDENHYKRFHFPLKINHTQSIKDLLEIKVGEEFYYK 198


>gi|168335325|ref|ZP_02693422.1| DNA-cytosine methyltransferase [Epulopiscium sp. 'N.t. morphotype
           B']
          Length = 324

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GV Q R+R++ I F    +++F+FP P   KP L DIL
Sbjct: 143 LNANDYGVAQDRKRVFYIGFRKDLNIKFEFPKPQEYKPVLRDIL 186


>gi|313677762|ref|YP_004055758.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
 gi|312944460|gb|ADR23650.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
          Length = 378

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 47/98 (47%), Gaps = 16/98 (16%)

Query: 2   KACDFGVPQRRERLYIIDFLN--PSVEFKFPTPL---GIKPRLGDILEEHI--DDKSTIS 54
            A ++GVPQ+RER++II F N      F FP P      K +L +++++    D+K   S
Sbjct: 166 NASEYGVPQKRERVFIIGFKNYEDFAYFNFPQPTTLNDSKVKLKEVIDKKANKDEKWFFS 225

Query: 55  NKLWEGHQK-RKENNKIAGKGFGYGLFFENSATTNTLS 91
            +  +G  + +K+ NK   +              NT+S
Sbjct: 226 QRAVDGMMRVQKKMNKGRDQN--------LEEPCNTIS 255


>gi|261400634|ref|ZP_05986759.1| DNA (cytosine-5-)-methyltransferase [Neisseria lactamica ATCC
           23970]
 gi|313668389|ref|YP_004048673.1| DNA modification methylase [Neisseria lactamica ST-640]
 gi|1709164|sp|P50182|MTN4_NEILA RecName: Full=Modification methylase NlaIV; Short=M.NlaIV; AltName:
           Full=Cytosine-specific methyltransferase NlaIV
 gi|476227|gb|AAA53237.1| M.NlaIV [Neisseria lactamica]
 gi|269209540|gb|EEZ75995.1| DNA (cytosine-5-)-methyltransferase [Neisseria lactamica ATCC
           23970]
 gi|313005851|emb|CBN87307.1| DNA modification methylase [Neisseria lactamica 020-06]
          Length = 423

 Score = 58.0 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +    T S+   + 
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTPS--PKLKNILESGLP---TESSPFIKK 212

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 213 LLKKFPPSELYGK 225


>gi|210135280|ref|YP_002301719.1| type II R-M system methyltransferase [Helicobacter pylori P12]
 gi|210133248|gb|ACJ08239.1| type II R-M system methyltransferase [Helicobacter pylori P12]
          Length = 315

 Score = 58.0 bits (140), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 2/71 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN-KLW 58
           + + DF + Q RER+YI+ F       F FP  L       D L+   +    I+N    
Sbjct: 139 LNSADFQLAQNRERIYIVGFRKDLKHPFNFPLGLANDYYFKDFLDADNECYLDINNATFQ 198

Query: 59  EGHQKRKENNK 69
           +    +  +N+
Sbjct: 199 KYLHNKYNHNR 209


>gi|304387455|ref|ZP_07369646.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|304338548|gb|EFM04667.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
          Length = 273

 Score = 57.6 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +    T S+   + 
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 213 LLKKFPPSELYGK 225


>gi|254673505|emb|CBA08927.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha275]
          Length = 273

 Score = 57.6 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +    T S+   + 
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 213 LLKKFPPSELYGK 225


>gi|325846341|ref|ZP_08169331.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325481605|gb|EGC84644.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 315

 Score = 57.6 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++      +  F        +P L + LE+++ +  T++   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKNVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|303233873|ref|ZP_07320524.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna BVS033A4]
 gi|302495017|gb|EFL54772.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna BVS033A4]
          Length = 315

 Score = 57.6 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+RER++++      +  F        +P L + LE+++ +  T++   + 
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLEKNVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|254410261|ref|ZP_05024041.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196183297|gb|EDX78281.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 384

 Score = 57.6 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 6/62 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL------EEHIDDKSTIS 54
           + + DFGVPQ RER+ I+   N    F          +L + L      E    D  T+ 
Sbjct: 144 LNSKDFGVPQNRERIIIVATKNKQFNFNKLKKNKCVAKLKNFLFNSENFEYLEPDSYTLI 203

Query: 55  NK 56
           +K
Sbjct: 204 DK 205


>gi|261379604|ref|ZP_05984177.1| modification methylase EcoRII [Neisseria subflava NJ9703]
 gi|284798084|gb|EFC53431.1| modification methylase EcoRII [Neisseria subflava NJ9703]
          Length = 320

 Score = 57.6 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 1   MKACDF-GVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDK--STI 53
           M   ++  +PQ RER++I+ F         +F FP  + +   + DIL++   +      
Sbjct: 149 MNTAEYANIPQNRERIFIVAFNKDHNFDTSKFDFPKKIKLTKSIHDILDKEKQEDIYYYD 208

Query: 54  SNKLWEGHQK 63
            +K     ++
Sbjct: 209 KSKYISQLKE 218


>gi|254671396|emb|CBA08870.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha153]
          Length = 157

 Score = 57.6 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +    T S+   + 
Sbjct: 42  LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 96

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 97  LLKKFPPSELYGK 109


>gi|160934346|ref|ZP_02081733.1| hypothetical protein CLOLEP_03217 [Clostridium leptum DSM 753]
 gi|156867019|gb|EDO60391.1| hypothetical protein CLOLEP_03217 [Clostridium leptum DSM 753]
          Length = 433

 Score = 57.6 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RERL  I   N     ++F FP P   KP L DIL
Sbjct: 251 LNAWDYGVAQKRERLITIGIRNDLVQKIKFDFPAPHKYKPVLRDIL 296


>gi|309378580|emb|CBX22758.1| DNA cytosine methyltransferase M.NlaIV [Neisseria lactamica
           Y92-1009]
          Length = 380

 Score = 57.6 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +    T S+   + 
Sbjct: 115 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTPS--PKLKNILESGLP---TESSPFIKK 169

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 170 LLKKFPPSELYGK 182


>gi|161870123|ref|YP_001599293.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
 gi|225075874|ref|ZP_03719073.1| hypothetical protein NEIFLAOT_00897 [Neisseria flavescens
           NRL30031/H210]
 gi|296313674|ref|ZP_06863615.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC
           43768]
 gi|161595676|gb|ABX73336.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
 gi|224952820|gb|EEG34029.1| hypothetical protein NEIFLAOT_00897 [Neisseria flavescens
           NRL30031/H210]
 gi|296839734|gb|EFH23672.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC
           43768]
          Length = 423

 Score = 57.6 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T L   P+L +ILE  +    T S+   + 
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLP---TESSPFIKK 212

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 213 LLKKFPPSELYGK 225


>gi|15676920|ref|NP_274067.1| modification methylase NlaIV [Neisseria meningitidis MC58]
 gi|7226272|gb|AAF41432.1| modification methylase NlaIV [Neisseria meningitidis MC58]
 gi|325136241|gb|EGC58849.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579]
 gi|325202033|gb|ADY97487.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149]
 gi|325208214|gb|ADZ03666.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis
           NZ-05/33]
          Length = 423

 Score = 57.6 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T L   P+L +ILE  +    T S+   + 
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLP---TESSPFIKK 212

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 213 LLKKFPPSELYGK 225


>gi|290343528|ref|YP_003494895.1| hypothetical protein OTV1_055 [Ostreococcus tauri virus 1]
 gi|260160943|emb|CAY39643.1| hypothetical protein OTV1_055 [Ostreococcus tauri virus 1]
          Length = 351

 Score = 57.2 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 25/43 (58%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43
           +KA + GVPQ+RERL+I+   +    F FP P      L DIL
Sbjct: 154 LKAHEHGVPQKRERLFIVGSRDVDFTFDFPEPSANDVGLKDIL 196


>gi|77918034|ref|YP_355849.1| C-5 cytosine-specific DNA methylase [Pelobacter carbinolicus DSM
           2380]
 gi|77544117|gb|ABA87679.1| C-5 cytosine-specific DNA methylase [Pelobacter carbinolicus DSM
           2380]
          Length = 405

 Score = 57.2 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38
           + A ++GVPQ RER++I+   +   EF+FP P    P 
Sbjct: 163 LNAANYGVPQVRERVFIVGSRDGK-EFQFPEPTHQNPE 199


>gi|325130383|gb|EGC53149.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304]
          Length = 425

 Score = 57.2 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T L   P+L +ILE  +    T S+   + 
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETTLS--PKLKNILESGLP---TESSPFIKK 212

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 213 LLKKFPPSELYGK 225


>gi|261838450|gb|ACX98216.1| type II m5C methylase [Helicobacter pylori 51]
          Length = 318

 Score = 57.2 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   ++    +N    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAD-NECYLDTNN--A 201

Query: 60  GHQKR 64
             Q+ 
Sbjct: 202 TFQRY 206


>gi|316984658|gb|EFV63622.1| modification methylase NlaIV [Neisseria meningitidis H44/76]
          Length = 171

 Score = 57.2 bits (138), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ R+R+Y+   L    +  F T     P+L +ILE  +    T S+   + 
Sbjct: 56  LNAKDFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 110

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 111 LLKKFPPSELYGK 123


>gi|330998524|ref|ZP_08322345.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT
           11841]
 gi|329568255|gb|EGG50071.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT
           11841]
          Length = 379

 Score = 57.2 bits (138), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQRRER+ I+   N  +V + FP     +       E  + DK   +   WE
Sbjct: 171 LNAADYGVPQRRERVVIVGIRNDLNVAWNFPEGTHSQ-------EALLWDKYV-TGSYWE 222

Query: 60  GH 61
            H
Sbjct: 223 RH 224


>gi|254411906|ref|ZP_05025682.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196181628|gb|EDX76616.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 456

 Score = 57.2 bits (138), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + + DFG+PQ R+R++I+   N    S  F FP PLG   +L D++
Sbjct: 173 LNSYDFGLPQDRDRVFIVGIRNDIEKSKSFDFPKPLGKPIKLYDVI 218


>gi|15894505|ref|NP_347854.1| DNA-methyltransferase (cytosine-specific) [Clostridium
           acetobutylicum ATCC 824]
 gi|15024146|gb|AAK79194.1|AE007635_8 DNA-methyltransferase (cytosine-specific) [Clostridium
           acetobutylicum ATCC 824]
 gi|325508636|gb|ADZ20272.1| DNA-methyltransferase (cytosine-specific) [Clostridium
           acetobutylicum EA 2018]
          Length = 314

 Score = 56.8 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 1   MKACDFGVPQRRERLY-IIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A DFG+PQRRER++ I        +F       ++P L   L+ ++D+  T++
Sbjct: 154 LNAMDFGLPQRRERVFTISCLDGKKFDFDKLEHRKLRP-LSSFLQTNVDEYYTVT 207


>gi|325979448|ref|YP_004289164.1| DNA (cytosine-5-)-methyltransferase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|325179376|emb|CBZ49420.1| DNA (cytosine-5-)-methyltransferase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 333

 Score = 56.8 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A DFGV Q+RER+ ++   N       F++P     KP L D+L
Sbjct: 151 LNAWDFGVAQKRERMIMVGIRNDLANKTSFEYPEAHAYKPVLRDVL 196


>gi|325478388|gb|EGC81503.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 321

 Score = 56.8 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 7/85 (8%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++      +  F        +P L + LE  + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGANNFSFNKLERKETRP-LSEFLENDVSELYTMTQPYML 209

Query: 60  GHQKRKENNKIAG-----KGFGYGL 79
               +  +N   G     K F Y +
Sbjct: 210 KFLNKGIDNSFRGRLKVIKAFSYTI 234


>gi|291530357|emb|CBK95942.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3]
          Length = 317

 Score = 56.8 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 10/99 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHI-DDKSTISNKLW 58
            ACD+G+PQ R R YI+ F +   SV F FP    ++  + D++++    DKS   +   
Sbjct: 144 DACDYGIPQHRTRTYIVAFRDFAKSVLFDFPQKQQLQKHIFDVIDKRTKADKSFYLDC-- 201

Query: 59  EGHQKRKENNKIAGKG----FG-YGLFFENSATTNTLSA 92
              Q  K    I        F  YG+         TL A
Sbjct: 202 NSRQYYKMKQSIDDNNQIYRFSDYGIQKSKDGICFTLKA 240


>gi|317177871|dbj|BAJ55660.1| Type II DNA modification enzyme [Helicobacter pylori F16]
          Length = 319

 Score = 56.8 bits (137), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   ++    +N    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHSFNFPLGLANDYCFKDFLDAD-NECYLDTNN--A 201

Query: 60  GHQKR 64
             Q+ 
Sbjct: 202 AFQRY 206


>gi|306821027|ref|ZP_07454646.1| possible DNA (cytosine-5-)-methyltransferase [Eubacterium yurii
           subsp. margaretiae ATCC 43715]
 gi|304550968|gb|EFM38940.1| possible DNA (cytosine-5-)-methyltransferase [Eubacterium yurii
           subsp. margaretiae ATCC 43715]
          Length = 317

 Score = 56.8 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51
           + A DFG+PQ+RER++++  L  +  F F     I  + + + LE+ + +  
Sbjct: 156 LNAMDFGIPQKRERIFVVSILGKN-NFDFEKLEKIPTKHISEFLEKEVSEIY 206


>gi|297380299|gb|ADI35186.1| DNA-cytosine methyltransferase [Helicobacter pylori v225d]
          Length = 264

 Score = 56.8 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   ++    +N    
Sbjct: 91  LNSADFQLAQKRERLYIVGFRKDLKHPFDFPLGLANDYCFKDFLDAD-NECYLDTNN--A 147

Query: 60  GHQKR 64
             Q+ 
Sbjct: 148 AFQRY 152


>gi|317014507|gb|ADU81943.1| type II DNA modification (methyltransferase) [Helicobacter pylori
           Gambia94/24]
          Length = 318

 Score = 56.8 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   D++  + +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDA--DNEYYL-DVSNA 201

Query: 60  GHQKR 64
             Q+ 
Sbjct: 202 TFQRY 206


>gi|163937935|ref|YP_001642821.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4]
 gi|163865790|gb|ABY46846.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4]
          Length = 444

 Score = 56.8 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 27/83 (32%), Gaps = 28/83 (33%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP----------------------------SVEFKFPTP 32
           + +  F V Q RER++++                                 S  F FP  
Sbjct: 185 INSKYFDVAQNRERIFVVCVRKDLVQSEEWRIKGKNVVANCKRNLLNLGVQSFNFDFPAQ 244

Query: 33  LGIKPRLGDILEEHIDDKSTISN 55
             +   L DILEE +D +  I  
Sbjct: 245 EDVNVSLIDILEESVDKRFYIKE 267


>gi|119512301|ref|ZP_01631388.1| DNA modification methylase [Nodularia spumigena CCY9414]
 gi|119463081|gb|EAW44031.1| DNA modification methylase [Nodularia spumigena CCY9414]
          Length = 502

 Score = 56.8 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL----EEHIDDKSTIS 54
           + + D+GVPQ R R+YII F       +F  P     K +LGDIL    E+ ID++    
Sbjct: 147 INSFDYGVPQNRIRVYIIGFHKQEYLEKFALPKQTDKKRKLGDILGITSEQKIDNQVIER 206

Query: 55  NKL 57
           +  
Sbjct: 207 DIF 209


>gi|254779148|ref|YP_003057253.1| M. Hpy99XI, type II cytosine specific DNA methyltransferase
           [Helicobacter pylori B38]
 gi|254001059|emb|CAX29005.1| M. Hpy99XI, type II cytosine specific DNA methyltransferase
           [Helicobacter pylori B38]
          Length = 348

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQVRERVILVGVLKRFKQKFHFPKPIKTHFSLKDAL 188


>gi|172036128|ref|YP_001802629.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142]
 gi|171697582|gb|ACB50563.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142]
          Length = 349

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 1   MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A  F +PQ RER+Y++ F    L   V+F FP        +   +E++I+   +IS  
Sbjct: 180 LDAALFDLPQVRERIYLVGFCREYLKERVDFTFPMGQTNDVYIDRFIEKNIEG-YSISKH 238

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96
           L + +  +K++ +         +  + S     T  + Y+K
Sbjct: 239 LQQSYLFKKDDGR-------PQIVDQTSQVKVKTFVSTYHK 272


>gi|109947180|ref|YP_664408.1| C-5 cytosine-specific DNA methylase [Helicobacter acinonychis str.
           Sheeba]
 gi|109714401|emb|CAJ99409.1| C-5 cytosine-specific DNA methylase [Helicobacter acinonychis str.
           Sheeba]
          Length = 315

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F      +F FP  L       D L+   ++    +N    
Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHQFNFPLGLANDYCFKDFLDAD-NECYLNTNN--A 195

Query: 60  GHQKR 64
             Q+ 
Sbjct: 196 AFQRY 200


>gi|67920370|ref|ZP_00513890.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
 gi|67857854|gb|EAM53093.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
          Length = 339

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNK 56
           + + DFGVPQ RERL ++       +F+FP     +      LG++  + + D   ++  
Sbjct: 157 LNSVDFGVPQNRERLMVVG---HRGKFQFPQISAKRITAGEALGELAFQVLPDSKFLTPS 213

Query: 57  LWEGHQKRKE 66
           + +   K ++
Sbjct: 214 MDKYIAKYEK 223


>gi|291525029|emb|CBK90616.1| DNA-methyltransferase (dcm) [Eubacterium rectale DSM 17629]
          Length = 337

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIK-PRLGDILEEHIDDKSTISN 55
            +  + VPQ R+R  ++   N     F FP       P+L D LE+ + +K  + +
Sbjct: 182 NSKYWNVPQNRDRYAVVGTRNKKNLTFTFPKEQHEFVPKLSDYLEKDVPEKYYLPD 237


>gi|239625877|ref|ZP_04668908.1| methyltransferase [Clostridiales bacterium 1_7_47_FAA]
 gi|239520107|gb|EEQ59973.1| methyltransferase [Clostridiales bacterium 1_7_47FAA]
          Length = 338

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIK-PRLGDILEEHIDDKSTISN 55
            +  + VPQ R+R  ++   N     F FP       P+L D LE+ + +K  + +
Sbjct: 182 NSKYWNVPQNRDRYAVVGTRNKKNLTFTFPKEQHEFVPKLSDYLEKDVPEKYYLPD 237


>gi|167043721|gb|ABZ08413.1| putative C-5 cytosine-specific DNA methylase [uncultured marine
           crenarchaeote HF4000_APKG3B16]
          Length = 377

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDK-STISN 55
           + A D+G+PQ R+R++I+        EF+FP P       G  L+ ++  K   I +
Sbjct: 167 LDAKDYGLPQDRQRIFIVGVRKDLEYEFEFPKPTH-----GPGLKPYVTMKDYGIKD 218


>gi|170077805|ref|YP_001734443.1| Type II cytosine-5 DNA methyltransferase [Synechococcus sp. PCC
           7002]
 gi|462645|sp|P34882|MTAA_SYNP2 RecName: Full=Modification methylase AquI subunit alpha;
           Short=M.AquI subunit alpha; Short=M.AquiA; AltName:
           Full=Cytosine-specific methyltransferase AquI subunit
           alpha
 gi|2126509|pir||I39659 modification methylase AquI, alpha protein - Synechococcus sp. (PCC
           7002)
 gi|142180|gb|AAA22067.1| M.AquI alpha protein [Synechococcus sp. PCC 7002]
 gi|169885474|gb|ACA99187.1| DNA-cytosine methyltransferase [Synechococcus sp. PCC 7002]
          Length = 248

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           + A DFGVPQ RER++I+        F+FP P  
Sbjct: 161 LNAADFGVPQFRERVFIVG-NRLGKTFQFPEPTH 193


>gi|308062397|gb|ADO04285.1| type II DNA modification enzyme [Helicobacter pylori Cuz20]
          Length = 318

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   ++    +N    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAD-NECYLDTNN--A 201

Query: 60  GHQKR 64
             Q+ 
Sbjct: 202 AFQRY 206


>gi|167920593|ref|ZP_02507684.1| cytosine-specific DNA methylase [Burkholderia pseudomallei BCC215]
          Length = 454

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 5   DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49
           +FG+PQ RER+YI+    P   F++P  +     +  IL+++ DD
Sbjct: 153 NFGIPQIRERVYIVGSTEPLTSFQWPEMIDATTSIETILDKNPDD 197


>gi|108562472|ref|YP_626788.1| cytosine specific DNA methyltransferase [Helicobacter pylori HPAG1]
 gi|107836245|gb|ABF84114.1| cytosine specific DNA methyltransferase [Helicobacter pylori HPAG1]
          Length = 355

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +FK   P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFKLLEPSQS 187


>gi|261839852|gb|ACX99617.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori 52]
          Length = 319

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q RERLYI+ F       F FP  L       D L+  
Sbjct: 145 LNSADFQLAQNRERLYIVGFRKDLKHHFVFPLGLANDYCFKDFLDAD 191


>gi|325912423|ref|ZP_08174818.1| modification methylase HhaI [Lactobacillus iners UPII 143-D]
 gi|325475765|gb|EGC78936.1| modification methylase HhaI [Lactobacillus iners UPII 143-D]
          Length = 314

 Score = 56.5 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDIL 43
           +   D+GVPQ+RER+Y++ F N      F FP P  +   + D L
Sbjct: 131 LNPVDYGVPQKRERIYMLCFRNDINREVFTFPRPFKLNKFVEDFL 175


>gi|188527268|ref|YP_001909955.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Shi470]
 gi|188143508|gb|ACD47925.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Shi470]
          Length = 348

 Score = 56.1 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDAL 188


>gi|320326171|gb|EFW82226.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea
           str. B076]
          Length = 404

 Score = 56.1 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + A D+GVPQ+RER+++I F +   VE+ FP P      L  I ++ +    
Sbjct: 181 VNAADYGVPQKRERVFLIGFRDDLEVEWSFPAPTHSYDAL--IHDQWVTGSY 230


>gi|317182374|dbj|BAJ60158.1| Type II DNA modification enzyme [Helicobacter pylori F57]
          Length = 318

 Score = 56.1 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   ++    +N    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAD-NECYLDTNN--A 201

Query: 60  GHQKR 64
             Q+ 
Sbjct: 202 AFQRY 206


>gi|309776146|ref|ZP_07671137.1| CPG DNA methylase [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916097|gb|EFP61846.1| CPG DNA methylase [Erysipelotrichaceae bacterium 3_1_53]
          Length = 456

 Score = 56.1 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A D G+PQ RER ++I  L     ++FP    +  ++ D+LEE +D +   +
Sbjct: 224 VDAADHGIPQHRERCFMISILGE-YSYRFPAGRKLHIQMKDLLEEKVDIRYFQT 276


>gi|90592696|ref|YP_529611.1| hypothetical protein CDBPCV119_gp60 [Clostridium phage phi CD119]
 gi|71482543|gb|AAX53484.1| hypothetical protein [Clostridium phage phi CD119]
          Length = 260

 Score = 56.1 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDI 42
           + + +FGVPQ RER++I+  F   S    FP        L  +
Sbjct: 157 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSGKNLEQL 199


>gi|308063322|gb|ADO05209.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Sat464]
          Length = 348

 Score = 56.1 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDAL 188


>gi|332673919|gb|AEE70736.1| C-5 cytosine-specific DNA methylase [Helicobacter pylori 83]
          Length = 319

 Score = 56.1 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+ + ++    +N    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAN-NECYLDTNN--A 201

Query: 60  GHQKR 64
             Q+ 
Sbjct: 202 AFQRY 206


>gi|317180853|dbj|BAJ58639.1| Type II DNA modification enzyme [Helicobacter pylori F32]
          Length = 312

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 30/72 (41%), Gaps = 4/72 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK--L 57
           + + DF + Q+RERLYI+ F       F FP  L       D L+   ++    +N    
Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAD-NECYLDTNNAAF 197

Query: 58  WEGHQKRKENNK 69
                 +  +N+
Sbjct: 198 QRYLHNKYNHNR 209


>gi|331002102|ref|ZP_08325621.1| hypothetical protein HMPREF0491_00483 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330411196|gb|EGG90612.1| hypothetical protein HMPREF0491_00483 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 309

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51
           + A DFG+PQ+RER++++  L  +  F F      KP+ + + LE+ +    
Sbjct: 145 LNAMDFGIPQKRERIFVVSILGKN-NFDFNKLNKTKPKDISEFLEKDVSSVY 195


>gi|254409526|ref|ZP_05023307.1| DNA-cytosine methyltransferase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196183523|gb|EDX78506.1| DNA-cytosine methyltransferase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 437

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 19/76 (25%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF------PT-------------PLGIKPRLGD 41
           + +  FG+PQ R RLY++  L  S +F+       P              PL     + D
Sbjct: 148 LNSAHFGLPQNRVRLYMVGILGASPKFELISDLGPPDSHSYNCQQLSLFNPLTQPVAVAD 207

Query: 42  ILEEHIDDKSTISNKL 57
           ILE++ D K   S + 
Sbjct: 208 ILEDNPDSKYDCSPEF 223


>gi|317057160|ref|YP_004105627.1| XRE family transcriptional regulator [Ruminococcus albus 7]
 gi|315449429|gb|ADU22993.1| transcriptional regulator, XRE family [Ruminococcus albus 7]
          Length = 407

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RERL  I   N     + F FPTP   KP L D+L
Sbjct: 224 LNAWDYGVAQKRERLITIGIRNNLTDKISFSFPTPHEYKPVLRDVL 269


>gi|227539355|ref|ZP_03969404.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227240668|gb|EEI90683.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 386

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/40 (27%), Positives = 18/40 (45%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40
           + + DFGVPQ RER++ +      ++ K   P        
Sbjct: 171 LNSLDFGVPQHRERIFFVGIRRKILDKKIVEPSSFGKWFP 210


>gi|217034658|ref|ZP_03440063.1| hypothetical protein HP9810_901g5 [Helicobacter pylori 98-10]
 gi|216942866|gb|EEC22357.1| hypothetical protein HP9810_901g5 [Helicobacter pylori 98-10]
          Length = 312

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 4/72 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK--L 57
           + + DF + Q+RERLYI+ F       F FP  L       D L+   ++    +N    
Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLVNDYCFKDFLDAD-NECYLDTNNAAF 197

Query: 58  WEGHQKRKENNK 69
               + +  +N+
Sbjct: 198 QRYLRNKYNHNR 209


>gi|42783651|ref|NP_980898.1| DNA-cytosine methyltransferase family protein [Bacillus cereus ATCC
           10987]
 gi|42739580|gb|AAS43506.1| DNA-cytosine methyltransferase family protein [Bacillus cereus ATCC
           10987]
          Length = 362

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36
           + A ++GVPQ+RER++II         F FP P   +
Sbjct: 171 LNAANYGVPQKRERVFIIGVRQDLEKTFVFPEPTHNE 207


>gi|317181803|dbj|BAJ59587.1| Type II DNA modification enzyme [Helicobacter pylori F57]
          Length = 351

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDAL 188


>gi|212639806|ref|YP_002316326.1| Site-specific DNA methylase [Anoxybacillus flavithermus WK1]
 gi|212561286|gb|ACJ34341.1| Site-specific DNA methylase [Anoxybacillus flavithermus WK1]
          Length = 469

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 7/52 (13%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLG------IKPRLGDILEE 45
           +KA D+GVPQ RER+++I    +    F++P P            +GD L +
Sbjct: 212 LKASDYGVPQHRERIFLIGINRDYDATFRYPLPTHGPDRTFPYVTVGDALFD 263


>gi|111607698|gb|ABH10736.1| DNA methyltransferase [Flavobacterium sp. 4H]
          Length = 408

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 6/60 (10%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDK--STISNK 56
           A    VPQ RER++I+ F    V    +F+FP P+ +   + D L++   D       + 
Sbjct: 241 ATHANVPQNRERIFIVAFDPKQVKNYSKFEFPKPIKLTKTIHDFLDKEKQDDIFYYKKDH 300


>gi|315586449|gb|ADU40830.1| possible DNA (cytosine-5-)-methyltransferase [Helicobacter pylori
           35A]
          Length = 351

 Score = 56.1 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDAL 188


>gi|308184861|ref|YP_003928994.1| type II DNA modification enzyme [Helicobacter pylori SJM180]
 gi|308060781|gb|ADO02677.1| type II DNA modification enzyme [Helicobacter pylori SJM180]
          Length = 318

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q RERLYI+ F       F FP  L       D L+  
Sbjct: 145 LNSADFQLAQNRERLYIVGFRKDLKYPFNFPLGLANDYCFNDFLDAD 191


>gi|188526860|ref|YP_001909547.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori
           Shi470]
 gi|188143100|gb|ACD47517.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori
           Shi470]
          Length = 355

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|160939011|ref|ZP_02086362.1| hypothetical protein CLOBOL_03905 [Clostridium bolteae ATCC
          BAA-613]
 gi|158437974|gb|EDP15734.1| hypothetical protein CLOBOL_03905 [Clostridium bolteae ATCC
          BAA-613]
          Length = 226

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 2  KACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIK-PRLGDILEEHIDDKSTISN 55
           +  + VPQ R+R  ++   N     F FP       P+L D LE+ + +K  + +
Sbjct: 3  NSKYWNVPQNRDRYAVVGTRNKKNLSFTFPKEQHEFVPKLSDYLEKDVPEKYYLPD 58


>gi|261837515|gb|ACX97281.1| cytosine-methyltransferase [Helicobacter pylori 51]
          Length = 355

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|317179558|dbj|BAJ57346.1| cytosine specific DNA methyltransferase [Helicobacter pylori F30]
          Length = 355

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|260886138|ref|ZP_05736578.2| modification methylase EcoRII [Prevotella tannerae ATCC 51259]
 gi|260850757|gb|EEX70626.1| modification methylase EcoRII [Prevotella tannerae ATCC 51259]
          Length = 427

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + A DFGVPQ RER+ II  L     F        KP L D L+E  D + 
Sbjct: 247 LNAADFGVPQNRERIIIIGSLKQPFVFSRLVKQPRKP-LVDFLDESGDFEY 296


>gi|261838928|gb|ACX98693.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori
           52]
          Length = 355

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|210134246|ref|YP_002300685.1| cytosine specific DNA methyltransferase [Helicobacter pylori P12]
 gi|210132214|gb|ACJ07205.1| cytosine specific DNA methyltransferase [Helicobacter pylori P12]
          Length = 355

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|308062920|gb|ADO04807.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           Sat464]
          Length = 355

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|17225517|gb|AAL37447.1|AF328915_1 cytosine-specific DNA methyltransferase [Helicobacter pylori]
          Length = 361

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|317176866|dbj|BAJ54655.1| cytosine specific DNA methyltransferase [Helicobacter pylori F16]
          Length = 215

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
          + A D+GVPQ RER +I+     S +F    P   
Sbjct: 13 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 47


>gi|217032842|ref|ZP_03438321.1| hypothetical protein HPB128_165g1 [Helicobacter pylori B128]
 gi|298737011|ref|YP_003729541.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
 gi|216945425|gb|EEC24089.1| hypothetical protein HPB128_165g1 [Helicobacter pylori B128]
 gi|298356205|emb|CBI67077.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
          Length = 361

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|119484300|ref|ZP_01618917.1| modification methylase NlaIV [Lyngbya sp. PCC 8106]
 gi|119457774|gb|EAW38897.1| modification methylase NlaIV [Lyngbya sp. PCC 8106]
          Length = 449

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 19/76 (25%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-------------------PRLGD 41
           + + +FG+PQ R R+Y+I  LN S +F   + LG K                   P++ D
Sbjct: 146 LNSVNFGLPQNRVRVYMIGVLNASPQFNLISDLGPKDSHSYNAVQLNLFSLQHFPPKVKD 205

Query: 42  ILEEHIDDKSTISNKL 57
           ILEE+ D     S + 
Sbjct: 206 ILEENPDSSFDCSPEF 221


>gi|15644682|ref|NP_206852.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori
           26695]
 gi|2313124|gb|AAD07117.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori
           26695]
          Length = 355

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|167630879|ref|YP_001681378.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1]
 gi|167593619|gb|ABZ85367.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1]
          Length = 319

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ R R+  +   N  + +F FPT +   P +G+IL
Sbjct: 145 LNASDYGVPQLRPRVVFVAIRNDLAADFTFPTEIMHAPTVGEIL 188


>gi|317009105|gb|ADU79685.1| type II DNA modification [Helicobacter pylori India7]
          Length = 348

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFYFPKPIKTHFSLKDAL 188


>gi|308061350|gb|ADO03238.1| cytosine specific DNA methyltransferase [Helicobacter pylori Cuz20]
          Length = 355

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|297379273|gb|ADI34160.1| Modification methylase [Helicobacter pylori v225d]
          Length = 222

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
          + A D+GVPQ RER +I+     S +F    P   
Sbjct: 20 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 54


>gi|268607976|ref|ZP_06141707.1| cytosine-specific DNA-methyltransferase Sau96I [Ruminococcus
           flavefaciens FD-1]
          Length = 407

 Score = 55.7 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RERL  I   N     ++F FPTP   KP L D+L
Sbjct: 224 LNAWDYGVAQKRERLITIGIRNDLTNQIKFTFPTPHEYKPVLRDVL 269


>gi|17225496|gb|AAL37432.1|AF328909_1 putative cytosine-specific DNA methyltransferase [Helicobacter
           pylori]
 gi|17225522|gb|AAL37451.1|AF328916_1 cytosine-specific DNA methyltransferase [Helicobacter pylori]
          Length = 361

 Score = 55.3 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|289167263|ref|YP_003445530.1| type II DNA modification enzyme (methyltransferase
           cytosine-specific) [Streptococcus mitis B6]
 gi|288906828|emb|CBJ21662.1| type II DNA modification enzyme (methyltransferase
           cytosine-specific) [Streptococcus mitis B6]
          Length = 387

 Score = 55.3 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 9/51 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFK--FPT------PLGIKPRLGDI 42
           + A D+GVPQ RER+++I   N  ++EF+  FP       P  ++  +GD+
Sbjct: 169 LNAKDYGVPQNRERVFLIGVRNDLNIEFEWSFPEKCTSENPFNLRDAIGDL 219


>gi|308183851|ref|YP_003927984.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           SJM180]
 gi|308059771|gb|ADO01667.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           SJM180]
          Length = 355

 Score = 55.3 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|17225547|gb|AAL37468.1|AF328924_1 cytosine-specific DNA methyltransferase [Helicobacter pylori]
          Length = 234

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
          + A D+GVPQ RER +I+     S +F    P   
Sbjct: 32 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 66


>gi|319412045|emb|CBY91978.1| C-5-cytosine-specific DNA methylase [Streptococcus pneumoniae]
          Length = 452

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFP 30
           + + DFGVPQ RER++II  F        FP
Sbjct: 148 LNSKDFGVPQNRERVFIIGHFRKKGTRLLFP 178


>gi|308172812|ref|YP_003919517.1| DNA (cytosine-5-)-methyltransferase [Bacillus amyloliquefaciens DSM
           7]
 gi|307605676|emb|CBI42047.1| DNA (cytosine-5-)-methyltransferase [Bacillus amyloliquefaciens DSM
           7]
          Length = 406

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 40/102 (39%), Gaps = 24/102 (23%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG-------IKPRLGDILEEHIDDKST 52
           M A D+GV Q+RER++I+         F+FP PL        ++  +GD+ E    D   
Sbjct: 246 MSAWDYGVAQKRERVFIVGIRKDLGFTFEFPKPLEGDYQTRVLRDVIGDLPEPERQDC-- 303

Query: 53  ISNKLW--EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
              K W  +      + N+                 +NT+ A
Sbjct: 304 --GKYWTPKSEYTYGQANR----------VQSLDKPSNTIPA 333


>gi|29028380|gb|AAO64731.1| EcoT38I methyltransferase [Escherichia coli]
          Length = 363

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG----IKPRLGDILEE 45
           + + DFGVPQ RER++ I F + +   +    +     + P +G+I+  
Sbjct: 147 LNSKDFGVPQNRERMFFIGFRSENDVKRVEAAIKKYQYLSPTVGEIIRP 195


>gi|145638078|ref|ZP_01793692.1| putative type II 5-cytosoine methyltransferase [Haemophilus
           influenzae PittHH]
 gi|145268726|gb|EDK08715.1| putative type II 5-cytosoine methyltransferase [Haemophilus
           influenzae PittHH]
          Length = 226

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A D+GVPQ R+R+ I+       ++F+FP     K    D L+  +  K  IS
Sbjct: 147 LNAADYGVPQTRQRVIIVGIRKDLDIQFEFPKQTHSKNG-NDGLKRWVSIKEAIS 200


>gi|12229863|sp|Q59605|MTB5_NEIGO RecName: Full=Modification methylase NgoBV; Short=M.NgoBV; AltName:
           Full=Cytosine-specific methyltransferase NgoBV;
           Short=M.NgoV
 gi|1165242|gb|AAA86268.1| M.NgoV DNA methylase [Neisseria gonorrhoeae]
          Length = 423

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FG+PQ R+R+Y+   L    +  F T     P+L +ILE  +    T S+   + 
Sbjct: 158 LNAKEFGIPQNRKRIYLTGSLKSKPDLSFETSPS--PKLKNILESGLP---TESSPFIKK 212

Query: 61  HQKRKENNKIAGK 73
             K+   +++ GK
Sbjct: 213 LLKKFPPSELYGK 225


>gi|296114087|ref|YP_003628025.1| cytosine-specific methyltransferase [Moraxella catarrhalis RH4]
 gi|295921781|gb|ADG62132.1| cytosine-specific methyltransferase [Moraxella catarrhalis RH4]
 gi|326560672|gb|EGE11040.1| cytosine-specific methyltransferase [Moraxella catarrhalis 46P47B1]
          Length = 318

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 1   MKACDF-GVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEEHIDDK--STIS 54
           M   ++  +PQ RER++II F      S+ F+FP  + +   + DIL+    D+      
Sbjct: 147 MNTSEYANIPQNRERIFIIAFDKNIFKSINFEFPNKIPLTKTIHDILDNKKQDESFYYHK 206

Query: 55  NKLWEGHQKRKENNKIA 71
           +K    HQK K   +  
Sbjct: 207 SK---YHQKLKLEMQNK 220


>gi|212695555|ref|ZP_03303683.1| hypothetical protein ANHYDRO_00072 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212677433|gb|EEB37040.1| hypothetical protein ANHYDRO_00072 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 321

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 1   MKACDFGVPQRRERLYII-DFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLW 58
           + A DFG+PQ+R+R++++      +  F         P L +ILE+++ +  T++   + 
Sbjct: 151 LNAMDFGIPQKRDRIFVVSCLGANNFSFNKLERKETSP-LSEILEKNVSELYTMTQPYML 209

Query: 59  EGHQK 63
           +   K
Sbjct: 210 KFLNK 214


>gi|85703012|ref|ZP_01034116.1| DNA cytosine methyltransferase M.NgoMIII [Roseovarius sp. 217]
 gi|85671940|gb|EAQ26797.1| DNA cytosine methyltransferase M.NgoMIII [Roseovarius sp. 217]
          Length = 387

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIK 36
           + + ++GVPQRRER++++ F   + +E+ FP P   +
Sbjct: 180 LNSANYGVPQRRERVFLVGFRADTGIEWHFPKPTHSR 216


>gi|308182232|ref|YP_003926359.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           PeCan4]
 gi|308064417|gb|ADO06309.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           PeCan4]
          Length = 281

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|311221492|gb|ADP76553.1| DNA methyltransferase [Helicobacter pylori]
          Length = 587

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|217034606|ref|ZP_03440014.1| hypothetical protein HP9810_903g31 [Helicobacter pylori 98-10]
 gi|216942961|gb|EEC22446.1| hypothetical protein HP9810_903g31 [Helicobacter pylori 98-10]
          Length = 281

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|317010732|gb|ADU84479.1| type II DNA modification (methyltransferase) [Helicobacter pylori
           SouthAfrica7]
          Length = 348

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P  +   L D L
Sbjct: 145 LNALDYGVPQMRERVILVGVLKSFKQKFYFPKPTKMHFSLKDAL 188


>gi|9622224|gb|AAF89681.1| cytosine-specific methyltransferase [Bacillus sp. LU11]
          Length = 365

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
           + A D+GVPQRR+R++I+      ++F FP P   +
Sbjct: 146 LNAADYGVPQRRKRIFIVG-TREGIKFNFPLPTHNE 180


>gi|317181351|dbj|BAJ59135.1| cytosine specific DNA methyltransferase [Helicobacter pylori F57]
          Length = 281

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|315586055|gb|ADU40436.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 35A]
          Length = 281

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|308071385|ref|YP_003872990.1| Modification methylase AquI alpha subunit (cytosine-specific
           methyltransferase AquI alpha subunit) [Paenibacillus
           polymyxa E681]
 gi|305860664|gb|ADM72452.1| Modification methylase AquI alpha subunit (Cytosine-specific
           methyltransferase AquI alpha subunit) [Paenibacillus
           polymyxa E681]
          Length = 366

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36
           + A D+GVPQ+RER++++      +  F FP P   +
Sbjct: 172 VNAADYGVPQKRERVFLVGMRRDLNRTFLFPEPTHNE 208


>gi|127420|sp|P19888|MTBA_BACAR RecName: Full=Modification methylase BanI; Short=M.BanI; AltName:
           Full=Cytosine-specific methyltransferase BanI
 gi|216242|dbj|BAA00613.1| BanI modification methylase [Aneurinibacillus aneurinilyticus]
          Length = 428

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 37/102 (36%), Gaps = 27/102 (26%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-----------------IKPRLGDIL 43
           + +  FGVPQ R R+YI+  L    +    + +G                     + DIL
Sbjct: 147 LNSSTFGVPQNRVRIYILGILGSKPKLTLTSNVGAADSHKYKNEQISLFDESYATVKDIL 206

Query: 44  EEHIDDKSTISNKLWEGHQKRKENNKIAGKGF----GYGLFF 81
           E+   +K   S++           +K+ G  F    GY L  
Sbjct: 207 EDSPSEKYRCSDEFIGQL------SKVVGNNFELLHGYRLID 242


>gi|332672853|gb|AEE69670.1| possible DNA (cytosine-5-)-methyltransferase [Helicobacter pylori
           83]
          Length = 281

 Score = 55.3 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|317179856|dbj|BAJ57642.1| cytosine specific DNA methyltransferase [Helicobacter pylori F32]
          Length = 281

 Score = 54.9 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|15645735|ref|NP_207912.1| cytosine specific DNA methyltransferase (BSP6IM) [Helicobacter
           pylori 26695]
 gi|2314272|gb|AAD08164.1| cytosine specific DNA methyltransferase (BSP6IM) [Helicobacter
           pylori 26695]
          Length = 312

 Score = 54.9 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q RERLYI+ F       F FP  L       D L+  
Sbjct: 139 LNSADFQLAQNRERLYIVGFRKDLKHPFNFPLGLANDYYFKDFLDAD 185


>gi|254421659|ref|ZP_05035377.1| C-5 cytosine-specific DNA methylase superfamily [Synechococcus sp.
           PCC 7335]
 gi|196189148|gb|EDX84112.1| C-5 cytosine-specific DNA methylase superfamily [Synechococcus sp.
           PCC 7335]
          Length = 427

 Score = 54.9 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 15/103 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR----LGDILEEHIDDKSTISNK 56
           + A ++G+PQ RERL+++   N +    +P PL   P     LGD+    ++   ++ NK
Sbjct: 161 LNARNYGIPQNRERLFLVGARNNTCLPIYPKPLKHSPTCTHALGDL--PDVEQFHSLINK 218

Query: 57  ------LWEGHQKRKEN---NKIAGKGFGYGLFFENSATTNTL 90
                 L + H             G  +GY   ++ S  TN++
Sbjct: 219 GEVIVCLSQPHSAYAARLRCQSRRGWYYGYRRQWDPSLLTNSI 261


>gi|320326214|gb|EFW82269.1| cytosine-specific DNA-methyltransferase [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 448

 Score = 54.9 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 5   DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49
           +FG+PQ RER+YI+  L P  +F +P        +  +L++H  D
Sbjct: 153 NFGIPQIRERVYIVGSLIPLEDFSWPKKTDAPTSIDTVLDDHPAD 197


>gi|207093118|ref|ZP_03240905.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter
          pylori HPKX_438_AG0C1]
          Length = 199

 Score = 54.9 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
          + A D+GVPQ RER +I+     S +F    P   
Sbjct: 32 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 66


>gi|48243617|gb|AAT40769.1| putative DNA methylase [Haemophilus influenzae]
          Length = 293

 Score = 54.9 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A D+GVPQ R+R+ I+       ++F+FP     K    D L+  +  K  IS
Sbjct: 146 LNAADYGVPQTRQRVIIVGIRKDLDIQFEFPKQTHSKNG-NDGLKRWVSIKEAIS 199


>gi|208435018|ref|YP_002266684.1| type II DNA modification enzyme [Helicobacter pylori G27]
 gi|208432947|gb|ACI27818.1| type II DNA modification enzyme [Helicobacter pylori G27]
          Length = 318

 Score = 54.9 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 2/71 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LW 58
           + + DF + Q+RERLYI+ F       F FP  L       D L+   +    I+N    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDADNECYLDINNVAFQ 204

Query: 59  EGHQKRKENNK 69
                R  +N+
Sbjct: 205 RYLHNRYNHNR 215


>gi|313667088|gb|ADR72987.1| M2.BsmFI [Geobacillus stearothermophilus]
          Length = 365

 Score = 54.9 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
           + A D+GVPQRR+R++I+      V+F FP P   +
Sbjct: 146 LNAADYGVPQRRKRIFIVG-TREGVKFNFPLPTHNE 180


>gi|188527903|ref|YP_001910590.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Shi470]
 gi|188144143|gb|ACD48560.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Shi470]
 gi|308063905|gb|ADO05792.1| type II DNA modification enzyme [Helicobacter pylori Sat464]
          Length = 320

 Score = 54.9 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q+RERLYI+ F       F FP  L       D L+  
Sbjct: 147 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANNYCFKDFLDAD 193


>gi|317011319|gb|ADU85066.1| type II DNA modification enzyme [Helicobacter pylori SouthAfrica7]
          Length = 321

 Score = 54.5 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q+RERLYI+ F       F FP  L       D L+  
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHSFHFPLGLANDYCFKDFLDAD 191


>gi|210610944|ref|ZP_03288669.1| hypothetical protein CLONEX_00859 [Clostridium nexile DSM 1787]
 gi|210152244|gb|EEA83251.1| hypothetical protein CLONEX_00859 [Clostridium nexile DSM 1787]
          Length = 278

 Score = 54.5 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHID 48
           + A D+GVPQ+RERL  I   N     ++F FP     KP L D+L +  D
Sbjct: 95  LNAWDYGVPQKRERLITIGIRNDLVNRIKFHFPEAHDYKPVLRDVLLDCPD 145


>gi|307637790|gb|ADN80240.1| DNA-cytosine methyl transferase [Helicobacter pylori 908]
 gi|325996388|gb|ADZ51793.1| DNA-cytosine methyltransferase [Helicobacter pylori 2018]
 gi|325997976|gb|ADZ50184.1| Type II DNA modification enzyme/ methyltransferase [Helicobacter
           pylori 2017]
          Length = 318

 Score = 54.5 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q+RERLYI+ F       F FP  L       D L+  
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKRPFSFPLGLANDYCFNDFLDAD 191


>gi|321156918|emb|CBW38908.1| putative DNA methylase [Streptococcus pneumoniae]
          Length = 452

 Score = 54.5 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 34/92 (36%), Gaps = 18/92 (19%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50
           + + DFGVPQ RER++II      S    FP     +    +IL         +  +  K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKSTRLLFPFRREGQATNSEILKTLGNLNPSKSGMSGK 207

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82
              S  L     +        GKG G+ +   
Sbjct: 208 VYYSEGLAPTLVR--------GKGEGFKIAIP 231


>gi|208434405|ref|YP_002266071.1| type II DNA modification enzyme [Helicobacter pylori G27]
 gi|208432334|gb|ACI27205.1| type II DNA modification enzyme [Helicobacter pylori G27]
          Length = 348

 Score = 54.5 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGTLKRFKQKFHFPKPIKTHFSLKDAL 188


>gi|315587009|gb|ADU41390.1| C-5 cytosine-specific DNA methylase [Helicobacter pylori 35A]
          Length = 313

 Score = 54.5 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   ++    +N    
Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAG-NECYLDTNN--A 195

Query: 60  GHQKR 64
             Q+ 
Sbjct: 196 AFQRY 200


>gi|308183225|ref|YP_003927352.1| type II DNA modification enzyme [Helicobacter pylori PeCan4]
 gi|308065410|gb|ADO07302.1| type II DNA modification enzyme [Helicobacter pylori PeCan4]
          Length = 318

 Score = 54.5 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q+RERLYI+ F       F FP  L       D L+  
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKRPFNFPLGLANDYCFKDFLDAD 191


>gi|327474139|gb|EGF19549.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           sanguinis SK408]
          Length = 480

 Score = 54.5 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 34/92 (36%), Gaps = 18/92 (19%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50
           + + DFGVPQ RER++II      S    FP     +    +IL         +  +  K
Sbjct: 176 LNSKDFGVPQNRERVFIIGHSRKKSTRLLFPFRREGQATNSEILKTLGNLNPSKSGMSGK 235

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82
              S  L     +        GKG G+ +   
Sbjct: 236 VYYSEGLAPTLVR--------GKGEGFKIAIP 259


>gi|317012898|gb|ADU83506.1| type II DNA modification enzyme [Helicobacter pylori Lithuania75]
          Length = 318

 Score = 54.5 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q+RERLYI+ F       F FP  L       D L+  
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHHFVFPLGLANDYCFKDFLDAD 191


>gi|254779672|ref|YP_003057778.1| M.HpyAVIII, a type II cytosine specific DNA methyltransferase
           [Helicobacter pylori B38]
 gi|254001584|emb|CAX29633.1| M.HpyAVIII, a type II cytosine specific DNA methyltransferase
           [Helicobacter pylori B38]
          Length = 318

 Score = 54.5 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q+RERLYI+ F       F FP  L       D L+  
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFNDFLDAD 191


>gi|227540760|ref|ZP_03970809.1| DNA-cytosine methyltransferase [Corynebacterium glucuronolyticum
           ATCC 51866]
 gi|227183472|gb|EEI64444.1| DNA-cytosine methyltransferase [Corynebacterium glucuronolyticum
           ATCC 51866]
          Length = 387

 Score = 54.1 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRL 39
           + A D+GVPQ R R++I+ F  + +  + FP P      L
Sbjct: 180 VDAADYGVPQHRHRVFIVGFRSDINAGWNFPQPTHSGAAL 219


>gi|296126560|ref|YP_003633812.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563]
 gi|296018376|gb|ADG71613.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563]
          Length = 311

 Score = 54.1 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 1   MKACDF-GVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDK--STI 53
           + + ++  +PQ RER++I  F    V     FKFP P+ +   + D ++    D      
Sbjct: 141 LNSAEYSNIPQNRERIFIAAFSKEKVCSYSNFKFPEPVELTKTIHDFIDHEKQDDIYYYN 200

Query: 54  SNKLWE 59
           S K ++
Sbjct: 201 STKYYK 206


>gi|315222617|ref|ZP_07864506.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211]
 gi|315188303|gb|EFU22029.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211]
          Length = 348

 Score = 54.1 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45
           + A D+GVPQ R+R++ + F    +++F+ P P   K    D + +
Sbjct: 150 LNASDYGVPQDRKRVFYVGFRKDLNIKFEPPKPYESKLTFKDAIFD 195


>gi|323487872|ref|ZP_08093130.1| cytosine-specific methyltransferase [Planococcus donghaensis
           MPA1U2]
 gi|323398606|gb|EGA91394.1| cytosine-specific methyltransferase [Planococcus donghaensis
           MPA1U2]
          Length = 367

 Score = 54.1 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 20/26 (76%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE 26
           + + DFGVPQ+RER++ I FLN  ++
Sbjct: 149 LNSADFGVPQKRERVFFIGFLNKDID 174


>gi|169826094|ref|YP_001696252.1| modification methylase BsuRI [Lysinibacillus sphaericus C3-41]
 gi|168990582|gb|ACA38122.1| Modification methylase BsuRI [Lysinibacillus sphaericus C3-41]
          Length = 426

 Score = 54.1 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHI 47
           + + DFGVPQ RER+++I      +     FK+P P   +P  GD L+ ++
Sbjct: 227 VNSRDFGVPQLRERVFLIGVHKEKIAEKYGFKYPKP---QPTHGDGLKPYV 274


>gi|15612115|ref|NP_223767.1| type II DNA modification (methyltransferase [Helicobacter pylori
           J99]
 gi|4155654|gb|AAD06642.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter
           pylori J99]
          Length = 321

 Score = 54.1 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q+RERLYI+ F       F FP  L       D L+  
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKRPFNFPLGLANDYCFKDFLDAD 191


>gi|317127845|ref|YP_004094127.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522]
 gi|315472793|gb|ADU29396.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522]
          Length = 363

 Score = 54.1 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 3/64 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID-DKSTISNKLWE 59
           + A D+GVPQ R R++ +  L+    F+FP          D L +    +K   S+  +E
Sbjct: 152 LNAADYGVPQHRHRVFFVGVLD--GAFEFPRKKNEVISTKDALSDLPSLEKFEGSDVEFE 209

Query: 60  GHQK 63
            H K
Sbjct: 210 YHVK 213


>gi|328947436|ref|YP_004364773.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
 gi|328447760|gb|AEB13476.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
          Length = 439

 Score = 54.1 bits (130), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 12/90 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL--- 57
           + + DF +PQ+RER Y + FL+   +F FP    I   L DI++    D+S    K    
Sbjct: 240 LSSLDFELPQKRERWYCVGFLS-KTDFVFPAGTKIHKNLRDIIDLDNQDESLKLPKFELD 298

Query: 58  -WEGHQKRKENNKIAGKGFGYGLFFENSAT 86
               H +  +N     K        +NS  
Sbjct: 299 RIAYHFEMAKNKTDRVK-------HDNSKY 321


>gi|291544225|emb|CBL17334.1| DNA-methyltransferase (dcm) [Ruminococcus sp. 18P13]
          Length = 407

 Score = 54.1 bits (130), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A ++GV Q+RERL  I   N     ++F FPTP   KP L D+L
Sbjct: 224 LNAWNYGVAQKRERLITIGIRNDLTNQIKFTFPTPHEYKPVLRDVL 269


>gi|125974805|ref|YP_001038715.1| DNA-cytosine methyltransferase [Clostridium thermocellum ATCC
           27405]
 gi|125715030|gb|ABN53522.1| DNA-cytosine methyltransferase [Clostridium thermocellum ATCC
           27405]
          Length = 334

 Score = 54.1 bits (130), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 5/75 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNK-L 57
           + A D+GVPQ R R+ +  F       +FKFP P   K  L + + +  + K   S+   
Sbjct: 155 VNAADYGVPQDRWRVILYGFRKDLEVKDFKFPEPFPYKVTLREAIGDMPEPK--QSDICH 212

Query: 58  WEGHQKRKENNKIAG 72
                +    N+  G
Sbjct: 213 ASYSSRYMSRNRKRG 227


>gi|158320884|ref|YP_001513391.1| DNA-cytosine methyltransferase [Alkaliphilus oremlandii OhILAs]
 gi|158141083|gb|ABW19395.1| DNA-cytosine methyltransferase [Alkaliphilus oremlandii OhILAs]
          Length = 329

 Score = 53.8 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGD 41
           + A DF VPQ R+R++ I F       +FKFP P+  +  L D
Sbjct: 145 LNANDFQVPQDRKRVFYIGFRKDLGIADFKFPKPIEPRLTLKD 187


>gi|289423024|ref|ZP_06424844.1| putative site-specific DNA-methyltransferase [Peptostreptococcus
           anaerobius 653-L]
 gi|289156598|gb|EFD05243.1| putative site-specific DNA-methyltransferase [Peptostreptococcus
           anaerobius 653-L]
          Length = 706

 Score = 53.8 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 8/62 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKP------RLGDILEEHIDDKSTI 53
           + A +FGVPQ RER+ I+  LN  + +F       I+       ++ D  E    +  TI
Sbjct: 147 LNARNFGVPQNRERIIIVGNLNGRAFDFTKLKTNTIETMKPFLDKVAD-FEILPKESYTI 205

Query: 54  SN 55
            +
Sbjct: 206 LD 207


>gi|317180646|dbj|BAJ58432.1| Type II DNA modification enzyme [Helicobacter pylori F32]
          Length = 348

 Score = 53.8 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDAL 188


>gi|317483873|ref|ZP_07942812.1| C-5 cytosine-specific DNA methylase [Bilophila wadsworthia 3_1_6]
 gi|316924890|gb|EFV46037.1| C-5 cytosine-specific DNA methylase [Bilophila wadsworthia 3_1_6]
          Length = 401

 Score = 53.8 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGI 35
           + A D+G+PQRRER++I+ F +   V + FP     
Sbjct: 178 VNAADYGIPQRRERVFIVGFRHDLGVRWSFPETTHS 213


>gi|317179147|dbj|BAJ56935.1| Type II DNA modification enzyme [Helicobacter pylori F30]
          Length = 351

 Score = 53.8 bits (129), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDAL 188


>gi|308061739|gb|ADO03627.1| DNA-cytosine methyltransferase [Helicobacter pylori Cuz20]
          Length = 704

 Score = 53.8 bits (129), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 30/73 (41%), Gaps = 14/73 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLG---------DILEEHIDDK 50
           + A +F VPQ RER+ I+ +L   V F F P        +          +ILE +   +
Sbjct: 143 LNAKNFSVPQNRERIIIVGYLGSQV-FDFNPIKTNPITDMQNFLDKSGHFEILEPY---E 198

Query: 51  STISNKLWEGHQK 63
            T+ +      Q 
Sbjct: 199 YTLLDNQLLKRQN 211


>gi|328766176|gb|EGF76234.1| hypothetical protein BATDEDRAFT_28720 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 373

 Score = 53.4 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36
           + A D+GVPQ+RER++II   N    E+ FP P   +
Sbjct: 181 VNARDYGVPQQRERVFIIGIRNDIEFEYDFPAPTHGE 217


>gi|261839303|gb|ACX99068.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori 52]
          Length = 348

 Score = 53.4 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDAL 188


>gi|291618717|ref|YP_003521459.1| HsdRM [Pantoea ananatis LMG 20103]
 gi|291153747|gb|ADD78331.1| HsdRM [Pantoea ananatis LMG 20103]
          Length = 313

 Score = 53.4 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLG 34
           + A D+GVPQ R+R++I+    N +VE+ FP P  
Sbjct: 141 LNAMDYGVPQERKRIFIVGIKDNINVEYSFPEPTH 175


>gi|317009733|gb|ADU80313.1| type II DNA modification enzyme [Helicobacter pylori India7]
          Length = 318

 Score = 53.4 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45
           + + DF + Q+RERLYI+ F       F FP  L       D L+ 
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFNDFLDA 190


>gi|160947479|ref|ZP_02094646.1| hypothetical protein PEPMIC_01413 [Parvimonas micra ATCC 33270]
 gi|158446613|gb|EDP23608.1| hypothetical protein PEPMIC_01413 [Parvimonas micra ATCC 33270]
          Length = 348

 Score = 53.4 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEE 45
           + A D+GVPQ R+R++ + F     V+F+ P P   K    D + +
Sbjct: 150 LNASDYGVPQDRKRVFYVGFRKDLKVKFEPPKPYETKLTFKDTIFD 195


>gi|227485931|ref|ZP_03916247.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus lactolyticus ATCC
           51172]
 gi|227235976|gb|EEI85991.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus lactolyticus ATCC
           51172]
          Length = 318

 Score = 53.4 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 25/58 (43%), Gaps = 4/58 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK----FPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A ++G+PQ R R Y +       E      FP    ++  L D+++    +   IS
Sbjct: 142 LNAKNYGIPQNRNRWYCVGVDKNHKELNLDDVFPGICELRYTLKDVIDCEYKEDYQIS 199


>gi|217033040|ref|ZP_03438509.1| hypothetical protein HPB128_193g7 [Helicobacter pylori B128]
 gi|298736593|ref|YP_003729119.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
 gi|216945239|gb|EEC23921.1| hypothetical protein HPB128_193g7 [Helicobacter pylori B128]
 gi|298355783|emb|CBI66655.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
          Length = 351

 Score = 53.4 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDAL 188


>gi|321312120|ref|YP_004204407.1| cytosine-specific methyltransferase [Bacillus subtilis BSn5]
 gi|320018394|gb|ADV93380.1| cytosine-specific methyltransferase [Bacillus subtilis BSn5]
          Length = 380

 Score = 53.4 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 19/26 (73%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE 26
           + +  FGVPQ+RER++ + FL  +V+
Sbjct: 149 LNSSHFGVPQKRERIFFVGFLEKNVD 174


>gi|322376648|ref|ZP_08051141.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           sp. M334]
 gi|321282455|gb|EFX59462.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           sp. M334]
          Length = 452

 Score = 53.4 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 31/85 (36%), Gaps = 16/85 (18%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50
           + + DFGVPQ RER++II           FP     +    +IL         +  +  K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSEILKTLGNLNPSKSGMSGK 207

Query: 51  STISNKLWEGHQKRKENNKIAGKGF 75
              S  L     +        G+GF
Sbjct: 208 VYYSEGLAPTLVR------GKGEGF 226


>gi|261837889|gb|ACX97655.1| type II m5C methylase [Helicobacter pylori 51]
          Length = 348

 Score = 53.4 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGTLKSFKQKFHFPKPIKAHFSLKDAL 188


>gi|332530473|ref|ZP_08406414.1| DNA cytosine methyltransferase M.NgoMIII [Hylemonella gracilis ATCC
           19624]
 gi|332040042|gb|EGI76427.1| DNA cytosine methyltransferase M.NgoMIII [Hylemonella gracilis ATCC
           19624]
          Length = 413

 Score = 53.4 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 15/76 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLW 58
           + A ++GVPQRRER++I+ F     +++ FP        L  +L +  +  +       W
Sbjct: 187 VNAANYGVPQRRERVFIVGFRRDLPIQWSFPRETHS---LDALLHDQWVTGEY------W 237

Query: 59  EGH----QKRKENNKI 70
           E H    + R + +K 
Sbjct: 238 ERHGVAKRARPQPHKS 253


>gi|317010127|gb|ADU80707.1| DNA-cytosine methyltransferase [Helicobacter pylori India7]
          Length = 703

 Score = 53.4 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLGDILEE 45
           + A DF VPQ RER+ I+ +L   V F F P        + + L++
Sbjct: 143 LNAKDFSVPQNRERIIIVGYLGSQV-FDFNPIKKNPIISMQNFLDK 187


>gi|207091758|ref|ZP_03239545.1| putative site-specific DNA-methyltransferase [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 703

 Score = 53.4 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLGDILEE 45
           + A DF VPQ RER+ I+ +L   V F F P        + + L++
Sbjct: 143 LNAKDFSVPQNRERIIIVGYLGSQV-FDFNPIKKNPIISMQNFLDK 187


>gi|312872570|ref|ZP_07732638.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2062A-h1]
 gi|311091932|gb|EFQ50308.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2062A-h1]
          Length = 336

 Score = 53.4 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + D L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVEDFLLPD 199


>gi|309803758|ref|ZP_07697844.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           11V1-d]
 gi|308164167|gb|EFO66428.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           11V1-d]
          Length = 336

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + D L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERELFVFPQPFKLNRFVEDFLLPD 199


>gi|241666957|ref|YP_002985041.1| DNA-cytosine methyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862414|gb|ACS60079.1| DNA-cytosine methyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 393

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 10/67 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A + GVPQRRER+  + F  +  +++ FP        L  +L + +          W+
Sbjct: 181 LNAANHGVPQRRERVVFVGFRSDLDIKWAFPAETHS---LDALLWDQVHGDY------WD 231

Query: 60  GHQKRKE 66
            H+ RK 
Sbjct: 232 RHRVRKA 238


>gi|329920363|ref|ZP_08277095.1| modification methylase HhaI [Lactobacillus iners SPIN 1401G]
 gi|328936039|gb|EGG32492.1| modification methylase HhaI [Lactobacillus iners SPIN 1401G]
          Length = 336

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + D L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDVERESFVFPQPFKLNRFVEDFLLPD 199


>gi|309807025|ref|ZP_07701007.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           03V1-b]
 gi|308166645|gb|EFO68842.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           03V1-b]
          Length = 336

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + D L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERELFVFPQPFKLNRFVEDFLLPD 199


>gi|315604954|ref|ZP_07880010.1| modification methylase [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315313349|gb|EFU61410.1| modification methylase [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 322

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTP-LGIKPRLGDILEE 45
           + A DFGVPQ R R+  + F + +   F++P+P     P +G+ L +
Sbjct: 147 LNASDFGVPQLRPRVIAVGFRHDTAPSFEYPSPFQNAAPTVGETLAD 193


>gi|309804726|ref|ZP_07698791.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           09V1-c]
 gi|312871535|ref|ZP_07731628.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           3008A-a]
 gi|325913106|ref|ZP_08175476.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B]
 gi|308166118|gb|EFO68336.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           09V1-c]
 gi|311092930|gb|EFQ51281.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           3008A-a]
 gi|325477527|gb|EGC80669.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B]
          Length = 336

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + D L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERELFVFPQPFKLNRFVEDFLLPD 199


>gi|256819660|ref|YP_003140939.1| DNA-cytosine methyltransferase [Capnocytophaga ochracea DSM 7271]
 gi|256581243|gb|ACU92378.1| DNA-cytosine methyltransferase [Capnocytophaga ochracea DSM 7271]
          Length = 318

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 5/57 (8%)

Query: 1   MKACDF-GVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKST 52
           +   ++  +PQ RER++I+ F    V    EF+FP  + +   +   LE+   +   
Sbjct: 148 LNTMEYANIPQNRERIFIVAFDPKQVPNYKEFQFPEKIKLTKTIHSFLEKGKQNDYF 204


>gi|297379680|gb|ADI34567.1| DNA-cytosine methyltransferase [Helicobacter pylori v225d]
          Length = 265

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 59  LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDAL 102


>gi|196037189|ref|ZP_03104504.1| modification methylase HaeIII [Bacillus cereus W]
 gi|195990293|gb|EDX54346.1| modification methylase HaeIII [Bacillus cereus W]
          Length = 415

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + + D+GVPQ RER++I+   N       F++  P   +P  G+    ++  K TISN
Sbjct: 231 VNSRDYGVPQLRERVFIVGIRNDIHEKYGFEYEVP---EPTHGEGKIPYVTLKDTISN 285


>gi|237742048|ref|ZP_04572529.1| site-specific DNA-methyltransferase [Fusobacterium sp. 4_1_13]
 gi|229429696|gb|EEO39908.1| site-specific DNA-methyltransferase [Fusobacterium sp. 4_1_13]
          Length = 440

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 5/72 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A ++GVPQ R RL +I F N   E K+P     K  L + L +  +    + NK    
Sbjct: 189 LNASNYGVPQNRHRLILIGFRNDMKEPKYPKEFKQKVTLREALSDLTN--YELDNK---K 243

Query: 61  HQKRKENNKIAG 72
           +Q   +  +   
Sbjct: 244 YQNSSKKGRTKN 255


>gi|331677320|ref|ZP_08377999.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
 gi|331075055|gb|EGI46371.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
          Length = 415

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 17/72 (23%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-----------------IKPRLGDIL 43
           +   +FGVPQ R R+YII  L   V    P  LG                  + ++ DIL
Sbjct: 146 LNTSNFGVPQNRVRIYIIASLEKEVTLTIPNDLGAKDTHNYKPSKGGHDFYTESKVSDIL 205

Query: 44  EEHIDDKSTISN 55
           E+  D+    S+
Sbjct: 206 EDSPDESYDCSD 217


>gi|269114810|ref|YP_003302573.1| Cytosine-specific DNA methyltransferase/Type II site-specific
           deoxyribonuclease [Mycoplasma hominis]
 gi|268322435|emb|CAX37170.1| Cytosine-specific DNA methyltransferase/Type II site-specific
           deoxyribonuclease [Mycoplasma hominis ATCC 23114]
          Length = 553

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDI 42
           + A DFGVPQ+RERL  I         + F+FP     KP + D+
Sbjct: 151 LNAWDFGVPQKRERLITIGVRQDLLSKISFEFPMEHSYKPTMRDV 195


>gi|171911881|ref|ZP_02927351.1| DNA-cytosine methyltransferase [Verrucomicrobium spinosum DSM 4136]
          Length = 330

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 28/70 (40%), Gaps = 7/70 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE----EHIDDKSTISNK 56
           + +  FGVPQ+RERL ++        F FP P        D LE        +   ++  
Sbjct: 156 LNSVHFGVPQKRERLVVVG---HLGGFVFPAPSAKVWTSADALEGMLYATPPESRFLTPS 212

Query: 57  LWEGHQKRKE 66
           + +     ++
Sbjct: 213 MDKYIANYEK 222


>gi|291528318|emb|CBK93904.1| DNA-methyltransferase (dcm) [Eubacterium rectale M104/1]
          Length = 344

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHID 48
           + A ++GVPQ+RERL  I   N      E++FP     KP L D+L +  D
Sbjct: 152 LNAWNYGVPQKRERLITIGIRNDLVGKTEYRFPKAHSYKPVLRDVLLDCPD 202


>gi|208434021|ref|YP_002265687.1| cytosine specific DNA methyltransferase (putative type II)
           [Helicobacter pylori G27]
 gi|208431950|gb|ACI26821.1| cytosine specific DNA methyltransferase (putative type II)
           [Helicobacter pylori G27]
          Length = 281

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           +   D+GVPQ RER +I+     S +FK   P   
Sbjct: 79  LNVKDYGVPQNRERAFIVGASRFSFDFKLLEPSQS 113


>gi|323650698|gb|ADX97433.1| M1.BspACI [Bacillus psychrodurans]
          Length = 320

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 25/59 (42%), Gaps = 5/59 (8%)

Query: 1   MKACDFGVPQRRERLYIID-----FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           M A  +GVPQ R R Y +      F    +   FP    ++  +   +E+++     +S
Sbjct: 144 MNAKYYGVPQNRNRWYCVGYDASQFSKIDIHNIFPEEENLETFIDSYIEKNVSQDYQMS 202


>gi|218135211|ref|ZP_03464015.1| hypothetical protein BACPEC_03116 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990596|gb|EEC56607.1| hypothetical protein BACPEC_03116 [Bacteroides pectinophilus ATCC
           43243]
          Length = 344

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHID 48
           + A ++GVPQ+RERL  I   N      E++FP     KP L D+L +  D
Sbjct: 152 LNAWNYGVPQKRERLITIGIRNDLVGKTEYRFPKAHSYKPVLRDVLLDCPD 202


>gi|319639604|ref|ZP_07994351.1| cytosine-specific methyltransferase [Neisseria mucosa C102]
 gi|317399175|gb|EFV79849.1| cytosine-specific methyltransferase [Neisseria mucosa C102]
          Length = 348

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 6/54 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-----LGIKPRLGDILEEHIDD 49
           + A D+GVPQ R+R + + F N ++ F+FP       + +K  + D+ +  +DD
Sbjct: 155 LMASDYGVPQNRKRAFFVGFKNGTI-FEFPKQTVNQYVTVKQAISDLPDYSVDD 207


>gi|15611502|ref|NP_223153.1| type II DNA modification (methyltransferase [Helicobacter pylori
           J99]
 gi|4154963|gb|AAD06007.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter
           pylori J99]
          Length = 351

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQVRERVILVGALKSFKQKFYFPKPIKTHFSLKDAL 188


>gi|252957|gb|AAA09969.1| methyltransferase [Herpetosiphon aurantiacus]
          Length = 437

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE 44
           + + D+GV Q R+R++II         +F FP     + RL DIL+
Sbjct: 146 LNSFDYGVAQNRDRVFIIGIQQKLGVPDFSFPEYSESEQRLYDILD 191


>gi|302383143|ref|YP_003818966.1| DNA-cytosine methyltransferase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193771|gb|ADL01343.1| DNA-cytosine methyltransferase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 377

 Score = 53.0 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLG 40
           + A + GVPQ+RER++I+ F  + S E+ FP        L 
Sbjct: 170 LNAANHGVPQKRERVFIVGFRSDLSTEWNFPAETHSARALA 210


>gi|119716511|ref|YP_923476.1| DNA-cytosine methyltransferase [Nocardioides sp. JS614]
 gi|119537172|gb|ABL81789.1| DNA-cytosine methyltransferase [Nocardioides sp. JS614]
          Length = 399

 Score = 53.0 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A D+GVPQ R R+ ++ F     + + FP P       G +L   +  +   S++ 
Sbjct: 202 VNAADYGVPQNRWRVVLVGFRKDLGISWSFPDPTHSA---GALLRAQLSGEY--SDRH 254


>gi|227540659|ref|ZP_03970708.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227239483|gb|EEI89498.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 386

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE 26
           + + DFGVPQ RER++ +      ++
Sbjct: 171 LNSLDFGVPQHRERIFFVGIRKEFLD 196


>gi|282899236|ref|ZP_06307209.1| C-5 cytosine-specific DNA methylase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195872|gb|EFA70796.1| C-5 cytosine-specific DNA methylase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 422

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 32/81 (39%), Gaps = 23/81 (28%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK----------------------FPTPLGIKPR 38
           + + +FGVPQ R R+YI+  L  +                          FP    +  +
Sbjct: 146 LNSSNFGVPQNRVRIYILGLLGKNPRLTINSDKGATDSHSFKEQFYQLSLFPDSYSV-VK 204

Query: 39  LGDILEEHIDDKSTISNKLWE 59
           + +ILE+ + +   +S +  +
Sbjct: 205 VKNILEQKVSENYYLSKRFQQ 225


>gi|321310707|ref|YP_004193036.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
 gi|319802551|emb|CBY93197.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
          Length = 340

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILEEHIDD 49
           + + D+GV Q+RERL +I         + FK+P     KP L D+L +  + 
Sbjct: 156 LNSWDYGVAQKRERLILIGIRSDFREKISFKYPKKHRYKPVLSDVLNDVPES 207


>gi|127435|sp|P25264|MTC2_HERAU RecName: Full=Modification methylase HgiCII; Short=M.HgiCII;
           AltName: Full=Cytosine-specific methyltransferase HgiCII
 gi|43464|emb|CAA38935.1| methyltransferase [Herpetosiphon aurantiacus]
          Length = 437

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE 44
           + + D+GV Q R+R++II         +F FP     + RL DIL+
Sbjct: 146 LNSFDYGVAQNRDRVFIIGIQQKLGVPDFSFPEYSESEQRLYDILD 191


>gi|317178577|dbj|BAJ56365.1| Type II DNA modification enzyme [Helicobacter pylori F30]
          Length = 318

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   ++    +N    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYYFEDFLDAG-NECYLDTNN--N 201

Query: 60  GHQKR 64
             Q+ 
Sbjct: 202 AFQRY 206


>gi|317013900|gb|ADU81336.1| type II DNA modification (methyltransferase) [Helicobacter pylori
           Gambia94/24]
          Length = 351

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFYFPKPIKTHFSLKDAL 188


>gi|967022|emb|CAA62381.1| DNA (cytosine-5-)-methyltransferase [Geobacillus
           stearothermophilus]
 gi|1262297|gb|AAA96793.1| m5C-multispecific methyltransferase [Geobacillus
           stearothermophilus]
 gi|1589631|prf||2211376A cytosine-C5-DNA methyltransferase
          Length = 534

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPR-------LGDILEE 45
           + A D+GV Q+RER++I+    +    F+FP P     R       +GD+ E 
Sbjct: 155 INAWDYGVAQKRERVFIVGIRADLGFAFEFPEPRPGDYRTQVLRDVIGDLPEP 207


>gi|207109252|ref|ZP_03243414.1| putative site-specific DNA-methyltransferase [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 210

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF 29
           + A DF VPQ RER+ I+ +L   V F F
Sbjct: 171 LNAKDFSVPQNRERIIIVGYLGSQV-FDF 198


>gi|127486|sp|P23737|MTS9_STAAU RecName: Full=Modification methylase Sau96I; Short=M.Sau96I;
           AltName: Full=Cytosine-specific methyltransferase Sau96I
 gi|581567|emb|CAA37260.1| Sau96I DNA methyltransferase [Staphylococcus aureus]
 gi|329730456|gb|EGG66846.1| DNA-binding helix-turn-helix protein [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 430

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 6/62 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEEHIDDKST-IS 54
           + + ++ V Q+RER+ II      V+     F+FP     KP L D+L++    K T  S
Sbjct: 245 LNSWNYDVAQKRERIVIIGIREDLVKEQKYPFRFPLAQVYKPVLKDVLKDVPKSKVTAYS 304

Query: 55  NK 56
           +K
Sbjct: 305 DK 306


>gi|213053466|ref|ZP_03346344.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
          Length = 320

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 7/45 (15%)

Query: 8   VPQRRERLYIIDFL---NPSVEFKFPTP----LGIKPRLGDILEE 45
           +PQ RER+ ++ F    N   +F            +P L ++LE 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEP 320


>gi|207108548|ref|ZP_03242710.1| type II DNA modification enzyme [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 171

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q RERLYI+ F       F FP  L       D L+  
Sbjct: 99  LNSADFQLAQNRERLYIVGFRKDLKHHFVFPLGLANDYHFEDFLDAD 145


>gi|168207191|ref|ZP_02633196.1| modification methylase ScrFIB [Clostridium perfringens E str.
           JGS1987]
 gi|170661387|gb|EDT14070.1| modification methylase ScrFIB [Clostridium perfringens E str.
           JGS1987]
          Length = 310

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-PRLGDILEEHIDDKST 52
           + A DFG+PQ R R++ I  L  ++ F F      + P + + LEE +D+K  
Sbjct: 149 LNAMDFGLPQDRNRVFTISILGENL-FDFDKLEKKETPHIKEFLEEIVDEKYI 200


>gi|119511191|ref|ZP_01630308.1| C-5 cytosine-specific DNA methylase [Nodularia spumigena CCY9414]
 gi|119464179|gb|EAW45099.1| C-5 cytosine-specific DNA methylase [Nodularia spumigena CCY9414]
          Length = 432

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL--GIKPRLGDILEEHIDDKSTISNKLW 58
           + A  FGVPQ RERL+I+   N      +P  +    KP+    L   ++    +S  +W
Sbjct: 157 LNAAHFGVPQNRERLFILGCRNDLELPNYPEAITQRAKPK-KSGLPHELN----LSPTVW 211

Query: 59  EGHQK 63
           E  Q 
Sbjct: 212 EALQD 216


>gi|302347057|ref|YP_003815355.1| putative modification methylase HhaI [Prevotella melaninogenica
           ATCC 25845]
 gi|302150379|gb|ADK96640.1| putative modification methylase HhaI [Prevotella melaninogenica
           ATCC 25845]
          Length = 453

 Score = 52.6 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 6/62 (9%)

Query: 5   DFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           +FG+PQ R+R+YI+           F FP        + DI+E +  D   I+    E H
Sbjct: 154 EFGIPQHRKRIYIVCIRKDLGLLDNFTFPKGNKPVCDVNDIIEANAKD---ITPIKEETH 210

Query: 62  QK 63
            +
Sbjct: 211 YQ 212


>gi|258593909|emb|CAA33765.2| DNA(cytosine-5)methyltransferase [Lysinibacillus sphaericus]
          Length = 396

 Score = 52.2 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 8/55 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL-----GIKPRLGDILEEHIDD 49
           + A D+GVPQ RER+ I+   N     +++P        G+KP +   LEE I D
Sbjct: 198 LNARDYGVPQIRERVIIVGVRNDIDFNYEYPEITHGNEEGLKPYVT--LEEAIGD 250


>gi|282899425|ref|ZP_06307392.1| DNA-cytosine methyltransferase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195689|gb|EFA70619.1| DNA-cytosine methyltransferase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 384

 Score = 52.2 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 29/74 (39%), Gaps = 20/74 (27%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A ++G+PQRRER++I+      ++ + FP P      L                 LW 
Sbjct: 176 LDAANYGIPQRRERVFIVGIRQDLNINWSFPQPSHSYDSL-----------------LWS 218

Query: 60  GH--QKRKENNKIA 71
                   E ++I 
Sbjct: 219 QFVSYDYWERHQIK 232


>gi|315644199|ref|ZP_07897369.1| DNA-cytosine methyltransferase [Paenibacillus vortex V453]
 gi|315280574|gb|EFU43863.1| DNA-cytosine methyltransferase [Paenibacillus vortex V453]
          Length = 485

 Score = 52.2 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-------LGIKPRLGDILEEHIDD 49
           + + D+GVPQ RER+ ++   N    ++++P P       L     L D + + ++D
Sbjct: 225 LNSRDYGVPQLRERVILVGVRNDIDFDYEYPEPSHGEGLGLNPYVTLRDAIGDLVED 281


>gi|294678239|ref|YP_003578854.1| cytosine-specific DNA-methyltransferase [Rhodobacter capsulatus SB
           1003]
 gi|294477059|gb|ADE86447.1| site-specific DNA-methyltransferase (cytosine-specific)
           [Rhodobacter capsulatus SB 1003]
          Length = 451

 Score = 52.2 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 24/58 (41%), Gaps = 2/58 (3%)

Query: 6   FGVPQRRERLYIIDFLNPSVEFKFPTPLGI--KPRLGDILEEHIDDKSTISNKLWEGH 61
           FGVPQ RER  I+        F +P P     +  +  +L+E   +   +  +  +  
Sbjct: 149 FGVPQVRERAIIVGSRTGLRHFSWPEPTHQLDQVTIKSVLDEKPKEARPLGPRFIQYL 206


>gi|224543136|ref|ZP_03683675.1| hypothetical protein CATMIT_02336 [Catenibacterium mitsuokai DSM
           15897]
 gi|224523923|gb|EEF93028.1| hypothetical protein CATMIT_02336 [Catenibacterium mitsuokai DSM
           15897]
          Length = 430

 Score = 52.2 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 32/83 (38%), Gaps = 14/83 (16%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNKL 57
           + A  FG+PQ R+R+YI+         +      +   L D+LE     +D K T   +L
Sbjct: 159 LNAKYFGIPQERKRIYIVGTKKEKPNLE--KFHRLDCSLADVLETGIPTMDSKFT---RL 213

Query: 58  WEGHQK------RKENNKIAGKG 74
              H        +   +K  G  
Sbjct: 214 LLKHYSVEELFGKAIKDKRGGNN 236


>gi|331002097|ref|ZP_08325616.1| hypothetical protein HMPREF0491_00478 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330411191|gb|EGG90607.1| hypothetical protein HMPREF0491_00478 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 706

 Score = 52.2 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 8/60 (13%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHID------DKSTI 53
           + A +FGVPQ RER+ I+        +F       ++  +   L++  D      D  TI
Sbjct: 147 LNARNFGVPQNRERIIIVGNIDGRIFDFTKLKMNTVET-MKPFLDKAADFEILPRDSYTI 205


>gi|119510471|ref|ZP_01629604.1| DNA cytosine methylase [Nodularia spumigena CCY9414]
 gi|119464893|gb|EAW45797.1| DNA cytosine methylase [Nodularia spumigena CCY9414]
          Length = 727

 Score = 52.2 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 20/43 (46%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43
           + + DFG+PQ RER+  +   +    FK        P L + L
Sbjct: 146 VNSRDFGLPQNRERVVFVATKDKKFNFKTLQKSHPVPTLREFL 188


>gi|293371777|ref|ZP_06618187.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f]
 gi|292633229|gb|EFF51800.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f]
          Length = 459

 Score = 52.2 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 6/51 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG-----IKPRLGDILEE 45
           + A D+ +PQ R R++I+ F+   +  FKFP P       ++  +GDI EE
Sbjct: 143 LNAADYCIPQDRFRVFIVGFIKELNGAFKFPEPSQKPLVTLQKAIGDITEE 193


>gi|298286911|sp|P13906|MTB1_BACSH RecName: Full=Modification methylase BspRI; Short=M.BspRI; AltName:
           Full=Cytosine-specific methyltransferase BspRI
 gi|258593908|emb|CAA33764.2| DNA(cytosine-5)methyltransferase [Lysinibacillus sphaericus]
          Length = 424

 Score = 52.2 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 8/55 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL-----GIKPRLGDILEEHIDD 49
           + A D+GVPQ RER+ I+   N     +++P        G+KP +   LEE I D
Sbjct: 226 LNARDYGVPQIRERVIIVGVRNDIDFNYEYPEITHGNEEGLKPYVT--LEEAIGD 278


>gi|632681|gb|AAB31678.1| DNA (cytosine-5)-methyltransferase, m5C-MTase {BspRI
           restriction-modification system} [Escherichia coli,
           Peptide, 424 aa]
          Length = 424

 Score = 52.2 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 8/55 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL-----GIKPRLGDILEEHIDD 49
           + A D+GVPQ RER+ I+   N     +++P        G+KP +   LEE I D
Sbjct: 226 LNARDYGVPQIRERVIIVGVRNDIDFNYEYPEITHGNEEGLKPYVT--LEEAIGD 278


>gi|6272296|gb|AAF06073.1|AF072715_4 putative methylase [Mycoplasma mycoides subsp. capri]
          Length = 390

 Score = 52.2 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + + D+G  Q RER++ I +L+    F FP PL  K  +  I++   D K    N L + 
Sbjct: 229 VNSTDYGSCQNRERVFCISYLDKQKNFTFPKPLITKKEIDSIIKNDDDMKEC--NHLLKY 286

Query: 61  H 61
            
Sbjct: 287 L 287


>gi|226324849|ref|ZP_03800367.1| hypothetical protein COPCOM_02636 [Coprococcus comes ATCC 27758]
 gi|225207297|gb|EEG89651.1| hypothetical protein COPCOM_02636 [Coprococcus comes ATCC 27758]
          Length = 473

 Score = 52.2 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30
           + + DFGVPQ RER +I+  L      K FP
Sbjct: 176 LNSKDFGVPQNRERCFIVGHLRGRGSAKVFP 206


>gi|270686639|ref|ZP_06222860.1| modification methylase DsaV [Haemophilus influenzae HK1212]
 gi|270316163|gb|EFA28145.1| modification methylase DsaV [Haemophilus influenzae HK1212]
          Length = 225

 Score = 52.2 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDI 42
          +KA D+G+PQ R R ++I F +  V   F FP P+ +K  + D+
Sbjct: 18 LKASDYGLPQLRPRAFMIGFRDDHVLGNFSFPEPIPLKFTMSDV 61


>gi|257062089|ref|YP_003139977.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|256592255|gb|ACV03142.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 456

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILE 44
           + + DFG+ Q R+R++I+          +F FP PL + P+L + +E
Sbjct: 173 LNSYDFGLSQDRDRVFIVGIHQQIENAAQFSFPEPLNLSPKLYEFIE 219


>gi|328946815|gb|EGG40952.1| modification methylase DdeI [Streptococcus sanguinis SK1087]
          Length = 387

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP--LGIKPRLGDILEE 45
           + A DFGVPQ RER+++I          E+ FP    L  +  L D + +
Sbjct: 169 INAKDFGVPQNRERVFLIGIRKDLKIKFEWTFPEETTLNNEITLRDAISD 218


>gi|225862883|ref|YP_002748261.1| DNA (cytosine-5-)-methyltransferase [Bacillus cereus 03BB102]
 gi|225787129|gb|ACO27346.1| DNA (cytosine-5-)-methyltransferase [Bacillus cereus 03BB102]
          Length = 367

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
           + A D+GVPQ R+R++ +  L+    F++P     K
Sbjct: 152 LNAADYGVPQNRQRVFFVGVLD--GHFEYPELDENK 185


>gi|535137|emb|CAA56493.1| type II DNA-methyltransferase [Bacillus phage phi3T]
          Length = 326

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34
           + A D+GV Q+RER++I+   N    +F FP PL 
Sbjct: 155 VNAWDYGVAQKRERVFIVGVRNDLGFKFDFPNPLE 189


>gi|317010333|gb|ADU84080.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           SouthAfrica7]
          Length = 361

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+   + S +F    P   
Sbjct: 153 LNAKDYGVPQSRERAFIVGATHFSFDFDLLEPSQS 187


>gi|315611977|ref|ZP_07886895.1| C-5 cytosine-specific DNA methylase [Streptococcus sanguinis ATCC
           49296]
 gi|315315966|gb|EFU64000.1| C-5 cytosine-specific DNA methylase [Streptococcus sanguinis ATCC
           49296]
          Length = 359

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 10/19 (52%), Positives = 15/19 (78%)

Query: 1   MKACDFGVPQRRERLYIID 19
           + + DFGVPQ RER++I+ 
Sbjct: 147 LNSKDFGVPQNRERVFIVG 165


>gi|157961098|ref|YP_001501132.1| DNA-cytosine methyltransferase [Shewanella pealeana ATCC 700345]
 gi|157846098|gb|ABV86597.1| DNA-cytosine methyltransferase [Shewanella pealeana ATCC 700345]
          Length = 406

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42
           + A  +GVPQ RER++I+        FK P+P     +   +
Sbjct: 161 VNASSYGVPQHRERVFIVA-NRDGGTFKMPSPTHSDSKDPTL 201


>gi|260579295|ref|ZP_05847178.1| modification methylase NaeI (cytosine-specificmethyltransferase
           NaeI) (M.NaeI) [Corynebacterium jeikeium ATCC 43734]
 gi|258602594|gb|EEW15888.1| modification methylase NaeI (cytosine-specificmethyltransferase
           NaeI) (M.NaeI) [Corynebacterium jeikeium ATCC 43734]
          Length = 372

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEE 45
           A DFGVPQ R R  ++    P  + F +P PL  +  +G+ L  
Sbjct: 180 AADFGVPQLRPRFVLVALREPYADYFAWPEPLDTRVTVGEALHS 223


>gi|68536951|ref|YP_251655.1| putative DNA restriction-modification system, DNA methylase
           [Corynebacterium jeikeium K411]
 gi|68264550|emb|CAI38038.1| putative DNA restriction-modification system, DNA methylase
           [Corynebacterium jeikeium K411]
          Length = 341

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEE 45
           A DFGVPQ R R  ++    P  + F +P PL  +  +G+ L  
Sbjct: 149 AADFGVPQLRPRFVLVALREPYADYFAWPEPLDTRVTVGEALHS 192


>gi|325955715|ref|YP_004293189.1| modification methylase BsuRI [Lactobacillus acidophilus 30SC]
 gi|325334695|gb|ADZ08248.1| modification methylase BsuRI [Lactobacillus acidophilus 30SC]
          Length = 406

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 3/37 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKF--PTPLG 34
           + A D+GVPQ RER++++   N   + F++  P P  
Sbjct: 224 VNAKDYGVPQSRERVFLVGVRNDIADKFQYTVPEPTN 260


>gi|225856779|ref|YP_002738290.1| methyl transferase [Streptococcus pneumoniae P1031]
 gi|225724445|gb|ACO20297.1| methyl transferase [Streptococcus pneumoniae P1031]
          Length = 452

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL 43
           + + DFGVPQ RER++II           FP     +    + L
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQTTNSETL 191


>gi|127417|sp|P25262|MTB1_HERAU RecName: Full=Modification methylase HgiBI; Short=M.HgiBI; AltName:
           Full=Cytosine-specific methyltransferase HgiBI
 gi|43478|emb|CAA38927.1| methyltransferase [Herpetosiphon aurantiacus]
          Length = 437

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE 44
           + + DFGV Q R+R++I+          F FP     + RL  IL+
Sbjct: 146 LNSFDFGVAQNRDRVFIVGIQQKLDLNGFSFPEYTESEQRLYHILD 191


>gi|183217290|gb|ACC59209.1| methyltransferase [Streptococcus pneumoniae]
 gi|321156848|emb|CBW38835.1| putative DNA methylase [Streptococcus pneumoniae]
          Length = 452

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 32/92 (34%), Gaps = 18/92 (19%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP---TPLGIKPRLGDIL------EEHIDDK 50
           + + DFGVPQ RER++II           FP         P    IL      +  +  K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQATNPETLKILGNLNPSKSGMSGK 207

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82
              S  L     +        GKG G+ +   
Sbjct: 208 VYYSEGLAPTLVR--------GKGEGFKIAIP 231


>gi|313884351|ref|ZP_07818113.1| putative modification methylase BanI [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312620429|gb|EFR31856.1| putative modification methylase BanI [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 335

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + A  FGV Q+R+RL +I         ++F++P   G    L D+L++  D   
Sbjct: 146 LNAAYFGVGQKRQRLIVIGIRSDLKDKIDFEYPKEDGEMTILRDVLKDVPDSPY 199


>gi|67458529|ref|YP_246153.1| site-specific DNA methylase [Rickettsia felis URRWXCal2]
 gi|67004062|gb|AAY60988.1| Site-specific DNA methylase [Rickettsia felis URRWXCal2]
          Length = 171

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 5/59 (8%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPR--LGDILEEHIDDKSTIS 54
          + A  FGVPQ RER+Y +            K+  P     R  LGDILE+ +D    I+
Sbjct: 2  LNASLFGVPQARERVYFVCLRKDFSSEYILKYVKPKESYERIFLGDILEKEVDKSLYIN 60


>gi|218249004|ref|YP_002374375.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|218169482|gb|ACK68219.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
          Length = 456

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILE 44
           + + DFG+ Q R+R++I+          +F FP PL + P+L + +E
Sbjct: 173 LNSYDFGLSQDRDRVFIVGIHQQIENAAQFSFPEPLNLSPKLYEFIE 219


>gi|295110826|emb|CBL24779.1| DNA-methyltransferase (dcm) [Ruminococcus obeum A2-162]
          Length = 312

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 31/76 (40%), Gaps = 22/76 (28%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK---------------------PR 38
           + A D+GVPQ R+R+ II   N  + E+ +P P   K                     P 
Sbjct: 142 LNAADYGVPQTRQRVIIIGVRNDINFEYIYPLPTNSKNGKDGLPEWISVSEAMAHIPDPD 201

Query: 39  LGDILEEHIDDKSTIS 54
           L + L  H+  K  ++
Sbjct: 202 LPNDLPNHVYSKYKLN 217


>gi|52788777|gb|AAU87368.1| MnlI m5C-methyltransferase [Moraxella nonliquefaciens]
          Length = 351

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK 28
           + A D+GVPQ RER++II   N   +F 
Sbjct: 150 LNAKDYGVPQSRERIFIIATKNQPFDFD 177


>gi|23428398|gb|AAL15430.1| DNA methyltransferase A [Moraxella nonliquefaciens]
          Length = 351

 Score = 51.8 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK 28
           + A D+GVPQ RER++II   N   +F 
Sbjct: 150 LNAKDYGVPQSRERIFIIATKNQPFDFD 177


>gi|323650438|gb|ADX97294.1| M.Cac8I [Clostridium acetobutylicum]
          Length = 398

 Score = 51.5 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDK 50
           + A +FGVPQ RER+ I+   N   + +  P    +K +   +  +    K
Sbjct: 181 LNAYNFGVPQNRERVIIVGIRNDLRDRYIIPQKPAVKNKRKTLFVKPTHSK 231


>gi|228473386|ref|ZP_04058140.1| Cytosine-specific methyltransferase HphIA [Capnocytophaga
           gingivalis ATCC 33624]
 gi|228275288|gb|EEK14086.1| Cytosine-specific methyltransferase HphIA [Capnocytophaga
           gingivalis ATCC 33624]
          Length = 358

 Score = 51.5 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41
           + A D+GVPQ R R +++      +EF+FP P   K  + +
Sbjct: 149 LWASDYGVPQNRNRFFMVG-NRHGIEFEFPEPFEKKITVEE 188


>gi|284803522|emb|CBJ23522.1| putative methyltransferase [Streptococcus pneumoniae]
          Length = 372

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 32/92 (34%), Gaps = 18/92 (19%)

Query: 1  MKACDFGVPQRRERLYIIDF-LNPSVEFKFP---TPLGIKPRLGDIL------EEHIDDK 50
          + + DFGVPQ RER++II           FP         P    IL      +  +  K
Sbjct: 2  LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQATNPETLKILGNLNPSKSGMSGK 61

Query: 51 STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82
             S  L     +        GKG G+ +   
Sbjct: 62 VYYSEGLAPTLVR--------GKGEGFKIAIP 85


>gi|228478395|ref|ZP_04063003.1| modification methylase HaeIII [Streptococcus salivarius SK126]
 gi|228250074|gb|EEK09344.1| modification methylase HaeIII [Streptococcus salivarius SK126]
          Length = 387

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 5/65 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFGVPQ RER+++I          E+ FP    +   +   L + I D   + N  
Sbjct: 169 INAKDFGVPQNRERVFLIGVRKDLKIKSEWIFPEETSLNNEIT--LRDAISDLPILGNNE 226

Query: 58  WEGHQ 62
            + + 
Sbjct: 227 QKYNY 231


>gi|4063721|gb|AAC98421.1| methyl transferase [Streptococcus pneumoniae]
          Length = 452

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 32/92 (34%), Gaps = 18/92 (19%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP---TPLGIKPRLGDIL------EEHIDDK 50
           + + DFGVPQ RER++II           FP         P    IL      +  +  K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLGFPFRREGQATNPETLKILGNLNPSKSGMSGK 207

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82
              S  L     +        GKG G+ +   
Sbjct: 208 VYYSEGLAPTLVR--------GKGEGFKIAIP 231


>gi|307294815|ref|ZP_07574657.1| DNA-cytosine methyltransferase [Sphingobium chlorophenolicum L-1]
 gi|306879289|gb|EFN10507.1| DNA-cytosine methyltransferase [Sphingobium chlorophenolicum L-1]
          Length = 394

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGI 35
           + A ++GVPQRRER+    F  +  +E+ FP P   
Sbjct: 187 LNAANYGVPQRRERVVFAGFRADLGIEWSFPEPTHS 222


>gi|239627884|ref|ZP_04670915.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239518030|gb|EEQ57896.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 325

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 1/54 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53
           +KA D+G    R+R+Y + F      +F FP        + D L + +D+   I
Sbjct: 144 LKASDYGCATIRKRIYFVCFRKDLKAKFSFPESFESNIAVEDFLNQEVDEHYYI 197


>gi|49476997|ref|YP_035183.1| modification methylase DdeI; cytosine-specific methyltransferase
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|49328553|gb|AAT59199.1| modification methylase DdeI; possible cytosine-specific
           methyltransferase [Bacillus thuringiensis serovar
           konkukian str. 97-27]
          Length = 450

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 2/36 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLG 34
           +   ++GVPQ RER++I+   N   +  F +P    
Sbjct: 193 LNCANYGVPQNRERVFIVGINNKYENTYFSYPQQTH 228


>gi|298735876|ref|YP_003728401.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
 gi|298355065|emb|CBI65937.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
          Length = 312

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q+RERLYI+ F       F FP  L       D L+  
Sbjct: 139 LNSTDFQLAQKRERLYIVGFRKDLKHPFHFPLGLANDYYFEDFLDAD 185


>gi|257438608|ref|ZP_05614363.1| modification methylase NgoMIV [Faecalibacterium prausnitzii A2-165]
 gi|257198937|gb|EEU97221.1| modification methylase NgoMIV [Faecalibacterium prausnitzii A2-165]
          Length = 293

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFP-TPLGIKPRLGDIL 43
           + A D+GVPQ R R+ I+         F++P       P +G+ L
Sbjct: 124 LNASDYGVPQLRPRVVIVGIRKDQAGAFEYPQEHPRESPTVGETL 168


>gi|256545597|ref|ZP_05472956.1| modification methylase HaeIII (cytosine-specificmethyltransferase
           HaeIII) [Anaerococcus vaginalis ATCC 51170]
 gi|256398722|gb|EEU12340.1| modification methylase HaeIII (cytosine-specificmethyltransferase
           HaeIII) [Anaerococcus vaginalis ATCC 51170]
          Length = 340

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 29/74 (39%), Gaps = 13/74 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R+R++ + F    ++ F   P P   K    D +         + +   
Sbjct: 142 LNASDYGVPQDRKRVFYVGFRKDLNISFDLPPKPYDYKLTFRDAI-------YDLKDNAI 194

Query: 59  EGHQKRKENNKIAG 72
                  E NK  G
Sbjct: 195 PAL----EKNKTNG 204


>gi|281491831|ref|YP_003353811.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
 gi|281375542|gb|ADA65048.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
          Length = 347

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40
           + A DFGVPQ+R R+  +   N   +F FP    +   + 
Sbjct: 153 LVASDFGVPQKRRRIVFVGLQNDVFDFNFPEFGMVTTEMA 192


>gi|237728463|ref|ZP_04558944.1| DNA-cytosine methyltransferase [Citrobacter sp. 30_2]
 gi|226909941|gb|EEH95859.1| DNA-cytosine methyltransferase [Citrobacter sp. 30_2]
          Length = 318

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK-PRLGDILEE 45
           + A D+GV Q R R+  +      +  F +P PL  + P +G++L +
Sbjct: 145 LNASDYGVSQLRPRVVFVGIRKDLAAGFSWPEPLKTEPPTVGELLHD 191


>gi|462651|sp|P34906|MTF1_FUSNU RecName: Full=Modification methylase FnuDI; Short=M.FnuDI; AltName:
           Full=Cytosine-specific methyltransferase FnuDI
 gi|2961231|gb|AAC05695.1| FnuDI DNA modification methyltransferase [Fusobacterium nucleatum]
          Length = 344

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 31/75 (41%), Gaps = 15/75 (20%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GV Q RER++ + F        F+FP P+  K R           K  + + +W
Sbjct: 142 LNAFDYGVAQDRERVFYVGFRKDLNISNFEFPYPISEKER-----------KY-LKDSIW 189

Query: 59  EGHQKRKENNKIAGK 73
           +  +      K   K
Sbjct: 190 D-LKDNALPGKDKNK 203


>gi|322510870|gb|ADX06184.1| putative C-5 cytosine-specific DNA methyltransferase [Organic Lake
           phycodnavirus 1]
          Length = 465

 Score = 51.5 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDIL 43
           + A  + VPQ+RER++I+  L N    F+FP     K  L D+L
Sbjct: 288 LDASKYDVPQKRERVFIVGVLKNIDRSFEFPNESLTKKVLKDVL 331


>gi|182684309|ref|YP_001836056.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           pneumoniae CGSP14]
 gi|221232093|ref|YP_002511246.1| DNA methylase [Streptococcus pneumoniae ATCC 700669]
 gi|182629643|gb|ACB90591.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           pneumoniae CGSP14]
 gi|220674554|emb|CAR69117.1| putative DNA methylase [Streptococcus pneumoniae ATCC 700669]
          Length = 452

 Score = 51.1 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 33/92 (35%), Gaps = 18/92 (19%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50
           + + DFGVPQ RER++II       +   FP     +    + L         +  +  K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGIRLLFPFRREGQATNSETLKTLGNLNPSKSGMSGK 207

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82
              S  L     +        GKG G+ +   
Sbjct: 208 VYYSEGLAPTLVR--------GKGEGFKIAIP 231


>gi|168185144|ref|ZP_02619808.1| modification methylase SinI [Clostridium botulinum Bf]
 gi|182671812|gb|EDT83773.1| modification methylase SinI [Clostridium botulinum Bf]
          Length = 363

 Score = 51.1 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36
           + A D+G+ Q+RER++I+      + +F+FP     K
Sbjct: 172 INAADYGIAQKRERVFIVGIRKDLNKKFEFPEKTHNK 208


>gi|325912401|ref|ZP_08174796.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII
           143-D]
 gi|325475743|gb|EGC78914.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII
           143-D]
          Length = 336

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIKRESFVFPQPFKLNRFVENFLLPD 199


>gi|309809622|ref|ZP_07703479.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners SPIN
           2503V10-D]
 gi|308170103|gb|EFO72139.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners SPIN
           2503V10-D]
          Length = 336

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVENFLLPD 199


>gi|259500984|ref|ZP_05743886.1| modification methylase EcoRII [Lactobacillus iners DSM 13335]
 gi|302190566|ref|ZP_07266820.1| DNA-cytosine methyltransferase [Lactobacillus iners AB-1]
 gi|259167678|gb|EEW52173.1| modification methylase EcoRII [Lactobacillus iners DSM 13335]
          Length = 336

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVENFLLPD 199


>gi|169832810|ref|YP_001694558.1| methyl transferase [Streptococcus pneumoniae Hungary19A-6]
 gi|168995312|gb|ACA35924.1| methyl transferase [Streptococcus pneumoniae Hungary19A-6]
          Length = 452

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 30/85 (35%), Gaps = 16/85 (18%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50
           + + DFGVPQ RER++II           FP     +    + L         +  +  K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKILGNLNPSKSGMSGK 207

Query: 51  STISNKLWEGHQKRKENNKIAGKGF 75
              S  L     +        G+GF
Sbjct: 208 VYYSEGLAPTLVR------SKGEGF 226


>gi|315222611|ref|ZP_07864500.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211]
 gi|315188297|gb|EFU22023.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211]
          Length = 317

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51
           + A DFG+PQ+RER++++  L  +  F F +   I+ + +   LEE + +  
Sbjct: 153 LNAMDFGIPQKRERIFVVSILGENY-FNFSSLEKIEAKDISKFLEEDVSNLY 203


>gi|293975|gb|AAB59071.1| cytosine methylase [Neisseria gonorrhoeae]
          Length = 341

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GV Q R+R++ I F     ++F FP         G  +E+   DK T+ + +W+
Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPK--------GSTVEDK--DKITLKDVIWD 204


>gi|289423000|ref|ZP_06424820.1| modification methylase ScrFIB [Peptostreptococcus anaerobius 653-L]
 gi|289156574|gb|EFD05219.1| modification methylase ScrFIB [Peptostreptococcus anaerobius 653-L]
          Length = 329

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 32/76 (42%), Gaps = 6/76 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLWE 59
           + A +FG+PQ+RER++++  L  +  F F      + R + + LE+   +         E
Sbjct: 165 LNAIEFGIPQKRERIFVVSIL-GNNSFDFAKLEKTQTRDISEFLEKDASNLY---EVRQE 220

Query: 60  GHQKRKENNKIAGKGF 75
              +     +     F
Sbjct: 221 SMLRY-IRGEPKNNNF 235


>gi|322372404|ref|ZP_08046940.1| modification methylase DdeI [Streptococcus sp. C150]
 gi|321277446|gb|EFX54515.1| modification methylase DdeI [Streptococcus sp. C150]
          Length = 387

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 5/65 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFGVPQ RER+++I          E+ FP  + +   +   L + I D   + N  
Sbjct: 169 INAKDFGVPQNRERVFLIGVRKDLKIKSEWIFPEAMTLNNEIT--LRDAISDLPILGNNE 226

Query: 58  WEGHQ 62
            + + 
Sbjct: 227 QKYNY 231


>gi|212632918|ref|YP_002309443.1| site-specific DNA-methyltransferase [Shewanella piezotolerans WP3]
 gi|212554402|gb|ACJ26856.1| Site-specific DNA-methyltransferase (cytosine-specific) [Shewanella
           piezotolerans WP3]
          Length = 412

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEH--IDDKSTISN 55
           +KA  + VPQ+RERL ++        S +F +P+P      L D  E+    D K   S 
Sbjct: 221 LKAIFYKVPQKRERLILVGVRKDLATSAKFSWPSPYKRIMTLKDAFEKGELFDSKVEESP 280

Query: 56  KLWEGHQKRKE 66
              E  Q++KE
Sbjct: 281 G-QEYPQRKKE 290


>gi|254003164|ref|YP_003052630.1| C-5 cytosine-specific DNA methylase [Methylovorus sp. SIP3-4]
 gi|253987247|gb|ACT52103.1| C-5 cytosine-specific DNA methylase [Methylovorus sp. SIP3-4]
          Length = 550

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 45/101 (44%), Gaps = 10/101 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP-RLGDILEEHIDDKSTISNKLW 58
           +   ++G  + R+R  ++   +    +F    P   +P RLGD+LEE       + +  W
Sbjct: 285 LNGKEWGTLENRDRWVMVAVTHGIEFDFSQLIPPDARPMRLGDVLEEVP-----LDDPRW 339

Query: 59  ---EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
              +  + ++  +   GK F   +F E+S    TL+  Y K
Sbjct: 340 NKMQYLKDKEVRDAAEGKNFKMQIFTEDSEHIGTLTKGYAK 380


>gi|83854666|ref|ZP_00948196.1| DNA modification methylase M.NGOI [Sulfitobacter sp. NAS-14.1]
 gi|83842509|gb|EAP81676.1| DNA modification methylase M.NGOI [Sulfitobacter sp. NAS-14.1]
          Length = 254

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDILEE 45
           + A D+GVPQ R R+ I+       + F +P P     P +G+ L++
Sbjct: 80  LNASDYGVPQLRPRVVIVALPKDRADFFDWPEPNPHNPPTVGETLKD 126


>gi|281420197|ref|ZP_06251196.1| modification methylase HgiDII [Prevotella copri DSM 18205]
 gi|281405692|gb|EFB36372.1| modification methylase HgiDII [Prevotella copri DSM 18205]
          Length = 353

 Score = 51.1 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGD 41
           + A D+GVPQRR+R+ I+          F++P P   K  + +
Sbjct: 157 LDAQDYGVPQRRKRVVIVGERKDHKIPLFEYPKPQEHKITVRE 199


>gi|323691274|ref|ZP_08105549.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14673]
 gi|323504614|gb|EGB20401.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14673]
          Length = 324

 Score = 51.1 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51
           + A +FG+PQ RER++ +  LN   +F+F   +    R L + LE+ + D  
Sbjct: 164 LDAREFGLPQARERVFTVSVLNGE-KFEFDDLIRTPMRNLQEFLEDDVPDIY 214


>gi|330891417|gb|EGH24078.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 201

 Score = 51.1 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDILEE 45
           + A DFGV Q R R+  +       E F +P P L I P +G++L +
Sbjct: 152 LNASDFGVTQLRPRVVFVGIRKDLAEGFSWPEPKLIIPPTVGELLHD 198


>gi|315653956|ref|ZP_07906872.1| modification methylase EcoRII [Lactobacillus iners ATCC 55195]
 gi|315488652|gb|EFU78298.1| modification methylase EcoRII [Lactobacillus iners ATCC 55195]
          Length = 336

 Score = 51.1 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIKRESFVFPQPFKLNRFVENFLLPD 199


>gi|312874304|ref|ZP_07734336.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2052A-d]
 gi|311090177|gb|EFQ48589.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2052A-d]
          Length = 336

 Score = 51.1 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVENFLLPD 199


>gi|59802113|ref|YP_208825.1| DcmB [Neisseria gonorrhoeae FA 1090]
 gi|268593822|ref|ZP_06127989.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria
           gonorrhoeae 35/02]
 gi|268597735|ref|ZP_06131902.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria
           gonorrhoeae FA19]
 gi|291042825|ref|ZP_06568566.1| site-specific DNA-methyltransferase M.NgoPII [Neisseria gonorrhoeae
           DGI2]
 gi|293398154|ref|ZP_06642359.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|44873|emb|CAA30038.1| unnamed protein product [Neisseria gonorrhoeae]
 gi|44888|emb|CAA36888.1| NgoPII restriction and modification [Neisseria gonorrhoeae]
 gi|293960|gb|AAA17019.1| cytosine methylase [Neisseria gonorrhoeae]
 gi|59719008|gb|AAW90413.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria
           gonorrhoeae FA 1090]
 gi|268547211|gb|EEZ42629.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria
           gonorrhoeae 35/02]
 gi|268551523|gb|EEZ46542.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria
           gonorrhoeae FA19]
 gi|291013259|gb|EFE05225.1| site-specific DNA-methyltransferase M.NgoPII [Neisseria gonorrhoeae
           DGI2]
 gi|291611417|gb|EFF40487.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|227054|prf||1613419B NgoPII methylase
          Length = 341

 Score = 51.1 bits (122), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GV Q R+R++ I F     ++F FP         G  +E+   DK T+ + +W+
Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPK--------GSTVEDK--DKITLKDVIWD 204


>gi|312874943|ref|ZP_07734962.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2053A-b]
 gi|311089688|gb|EFQ48113.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2053A-b]
          Length = 336

 Score = 50.7 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEH 46
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L   
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIKRESFVFPQPFKLNRFVENFLLPD 199


>gi|1399076|gb|AAB03209.1| NgoII cytosine methylase M.NgoII [Neisseria gonorrhoeae]
          Length = 341

 Score = 50.7 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GV Q R+R++ I F     ++F FP         G  +E+   DK T+ + +W+
Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPK--------GSTVEDK--DKITLKDVIWD 204


>gi|17548155|ref|NP_521557.1| DNA modification cytosine-specific methyltransferase [Ralstonia
           solanacearum GMI1000]
 gi|17430462|emb|CAD16935.1| probable site-specific dna methylase protein [Ralstonia
           solanacearum GMI1000]
          Length = 364

 Score = 50.7 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 29/70 (41%), Gaps = 6/70 (8%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKF--PTPLGIKPRLGDILEEHIDDKST---IS 54
           + A ++ VPQ RERL ++ F  +   +  +  P P   +  + + +    +       ++
Sbjct: 154 LNAANYSVPQNRERLIMVGFNRDLYPDLTWLPPGPKNARLTVREAIGALPEPTYFQRNLT 213

Query: 55  NKLWEGHQKR 64
           NK    H   
Sbjct: 214 NKDIPHHPNH 223


>gi|225863800|ref|YP_002749178.1| cytosine-specific methyltransferase NlaX [Bacillus cereus 03BB102]
 gi|225788166|gb|ACO28383.1| cytosine-specific methyltransferase NlaX [Bacillus cereus 03BB102]
          Length = 576

 Score = 50.7 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FP---TPLGIKPRLGDILEEHIDDKSTISNK 56
           + + DFGVPQ RER++II  L  +   + FP      G    +G + E + D    +  K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHLRGTCGREVFPIRRKNEGSINIVGYLSEGYKDVNYVLDPK 207


>gi|219871000|ref|YP_002475375.1| cytosine specific DNA methyltransferase (BSP6IM) [Haemophilus
           parasuis SH0165]
 gi|219691204|gb|ACL32427.1| cytosine specific DNA methyltransferase (BSP6IM) [Haemophilus
           parasuis SH0165]
          Length = 295

 Score = 50.7 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 10/75 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTI----S 54
           + +  +GVPQ RER+Y +          F+FPTP  IK    DI E  I+++  I    +
Sbjct: 121 LDSQFYGVPQMRERIYFVGIRKDIKHKPFEFPTPEPIK----DIAECLIEERDYIFDENN 176

Query: 55  NKLWEGHQKRKENNK 69
               +    +  NNK
Sbjct: 177 PTFQKYLHNKYNNNK 191


>gi|194099965|ref|YP_002003104.1| Modification methylase NgoPII [Neisseria gonorrhoeae NCCP11945]
 gi|239997973|ref|ZP_04717897.1| Modification methylase NgoPII [Neisseria gonorrhoeae 35/02]
 gi|240015049|ref|ZP_04721962.1| Modification methylase NgoPII [Neisseria gonorrhoeae DGI18]
 gi|240017498|ref|ZP_04724038.1| Modification methylase NgoPII [Neisseria gonorrhoeae FA6140]
 gi|240122118|ref|ZP_04735080.1| Modification methylase NgoPII [Neisseria gonorrhoeae PID24-1]
 gi|240124411|ref|ZP_04737367.1| Modification methylase NgoPII [Neisseria gonorrhoeae PID332]
 gi|240124717|ref|ZP_04737603.1| Modification methylase NgoPII [Neisseria gonorrhoeae SK-92-679]
 gi|254494673|ref|ZP_05107844.1| modification methylase HaeIII [Neisseria gonorrhoeae 1291]
 gi|260439589|ref|ZP_05793405.1| Modification methylase NgoPII [Neisseria gonorrhoeae DGI2]
 gi|268599983|ref|ZP_06134150.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           MS11]
 gi|268602320|ref|ZP_06136487.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           PID18]
 gi|268683040|ref|ZP_06149902.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           PID332]
 gi|268683292|ref|ZP_06150154.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           SK-92-679]
 gi|268687469|ref|ZP_06154331.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|462655|sp|P08455|MTP2_NEIGO RecName: Full=Modification methylase NgoPII; Short=M.NgoPII;
           AltName: Full=Cytosine-specific methyltransferase NgoPII
 gi|193935255|gb|ACF31079.1| Modification methylase NgoPII [Neisseria gonorrhoeae NCCP11945]
 gi|226513713|gb|EEH63058.1| modification methylase HaeIII [Neisseria gonorrhoeae 1291]
 gi|268584114|gb|EEZ48790.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           MS11]
 gi|268586451|gb|EEZ51127.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           PID18]
 gi|268623324|gb|EEZ55724.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           PID332]
 gi|268623576|gb|EEZ55976.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           SK-92-679]
 gi|268627753|gb|EEZ60153.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|317165417|gb|ADV08958.1| DcmB [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 330

 Score = 50.7 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GV Q R+R++ I F     ++F FP         G  +E+   DK T+ + +W+
Sbjct: 145 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPK--------GSTVEDK--DKITLKDVIWD 193


>gi|240081638|ref|ZP_04726181.1| DcmB [Neisseria gonorrhoeae FA19]
 gi|240113919|ref|ZP_04728409.1| DcmB [Neisseria gonorrhoeae MS11]
 gi|240116652|ref|ZP_04730714.1| DcmB [Neisseria gonorrhoeae PID18]
 gi|240129088|ref|ZP_04741749.1| DcmB [Neisseria gonorrhoeae SK-93-1035]
          Length = 325

 Score = 50.7 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GV Q R+R++ I F     ++F FP         G  +E+   DK T+ + +W+
Sbjct: 140 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPK--------GSTVEDK--DKITLKDVIWD 188


>gi|332075476|gb|EGI85945.1| modification methylase HpaII [Streptococcus pneumoniae GA41301]
          Length = 452

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 32/92 (34%), Gaps = 18/92 (19%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL---------EEHIDDK 50
           + + DFGVPQ RER++II           FP     +    + L         +  +  K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKTLGNLNPSKSGMSGK 207

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFE 82
              S  L     +        GKG G+ +   
Sbjct: 208 VYYSEGLAPTLVR--------GKGEGFKIAIP 231


>gi|217032692|ref|ZP_03438178.1| hypothetical protein HPB128_202g26 [Helicobacter pylori B128]
 gi|216945622|gb|EEC24273.1| hypothetical protein HPB128_202g26 [Helicobacter pylori B128]
          Length = 211

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH 46
           + + DF + Q+RERLYI+ F       F FP  L       D L+  
Sbjct: 139 LNSTDFQLAQKRERLYIVGFRKDLKHPFHFPLGLANDYYFEDFLDAD 185


>gi|217964683|ref|YP_002350361.1| cytosine-specific methyltransferase [Listeria monocytogenes HCC23]
 gi|217333953|gb|ACK39747.1| cytosine-specific methyltransferase [Listeria monocytogenes HCC23]
          Length = 340

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKP 37
           + + DFGVPQ RER++II  L  +   + FP     + 
Sbjct: 148 LNSKDFGVPQNRERVFIIGHLRGAGGREIFPLAEASRT 185


>gi|332361999|gb|EGJ39801.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           sanguinis SK49]
          Length = 480

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEE 45
           + + DFGVPQ RER++II           FP     +    + L+E
Sbjct: 176 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKE 221


>gi|319639602|ref|ZP_07994349.1| cytosine-specific methyltransferase [Neisseria mucosa C102]
 gi|317399173|gb|EFV79847.1| cytosine-specific methyltransferase [Neisseria mucosa C102]
          Length = 327

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 43/104 (41%), Gaps = 19/104 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFP-TPLGIKPRLGD----ILEEHI------D 48
           + A +FG+PQ+RER++++         + FP      +P L       LE+ I      +
Sbjct: 157 LLAANFGIPQKRERVFMVGVRKDIQKHYTFPMETHAEQPNLYQKPFVKLEKIITTLAIDN 216

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            K   S K   G +   +NN   G      L+ +      T++A
Sbjct: 217 PKYYFSEKAVLGMKN-AKNNMKRG------LYQDLQGQCLTITA 253


>gi|148555377|ref|YP_001262959.1| DNA-cytosine methyltransferase [Sphingomonas wittichii RW1]
 gi|148500567|gb|ABQ68821.1| DNA-cytosine methyltransferase [Sphingomonas wittichii RW1]
          Length = 412

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           + A  FGVPQ RER++I+        FKFP P  
Sbjct: 169 LNAASFGVPQLRERVFIVASREGK-NFKFPQPTH 201


>gi|329768652|ref|ZP_08260136.1| hypothetical protein HMPREF0428_01833 [Gemella haemolysans M341]
 gi|328836366|gb|EGF86031.1| hypothetical protein HMPREF0428_01833 [Gemella haemolysans M341]
          Length = 427

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 8/51 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDK 50
           + + +FGVPQ RER++I+  L     +K FP     K       E   + K
Sbjct: 148 LNSKNFGVPQNRERVFIVGHLRGGCTYKVFPIQGENK-------EPDFEPK 191


>gi|308229518|gb|ADO24171.1| M.AciI [Arthrobacter citreus]
          Length = 703

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 9/63 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--------SVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           M A D+GVPQ R R Y +   N         + EF FP    +   +   +E        
Sbjct: 525 MNAKDYGVPQNRNRWYCVGINNDLGVVSTSMNSEF-FPEKEELTTFIDSFIETTFLPTYE 583

Query: 53  ISN 55
           +S 
Sbjct: 584 VSE 586



 Score = 39.9 bits (93), Expect = 0.12,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 31/86 (36%), Gaps = 29/86 (33%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLG------------------- 40
           + + + G+PQ R+R YI+   + P+ +F+          L                    
Sbjct: 165 INSNEAGLPQNRDRTYIVGIKDFPTEKFEEDKRSKKISCLKKELNELEFHGFNFFNNVNF 224

Query: 41  --------DILEEHIDDKSTI-SNKL 57
                   DIL++ +D K    S K+
Sbjct: 225 YNESQIISDILDDIVDKKYYFNSEKM 250


>gi|268604583|ref|ZP_06138750.1| cytosine methylase [Neisseria gonorrhoeae PID1]
 gi|268588714|gb|EEZ53390.1| cytosine methylase [Neisseria gonorrhoeae PID1]
          Length = 341

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 11/59 (18%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GV Q R+R++ I F     ++F FP    ++ +          DK T+ + +W+
Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVENK----------DKITLKDVIWD 204


>gi|307570754|emb|CAR83933.1| C-5 cytosine-specific DNA methylase [Listeria monocytogenes L99]
 gi|307572166|emb|CAR85345.1| C-5 cytosine-specific DNA methylase [Listeria monocytogenes L99]
          Length = 426

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKP 37
           + + DFGVPQ RER++II  L  +   + FP     + 
Sbjct: 148 LNSKDFGVPQNRERVFIIGHLRGAGGREIFPLAEASRT 185


>gi|268680341|ref|YP_003304772.1| DNA-cytosine methyltransferase [Sulfurospirillum deleyianum DSM
           6946]
 gi|268618372|gb|ACZ12737.1| DNA-cytosine methyltransferase [Sulfurospirillum deleyianum DSM
           6946]
          Length = 335

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           + A D+ VPQ R+RL+ + F    ++ F+FP    +K  L D++
Sbjct: 143 LNAHDYKVPQDRQRLFFVGFRKDLNMTFEFPKAFPLKRYLKDVI 186


>gi|10955252|ref|NP_052188.1| DNA-methyltransferase [Escherichia coli]
 gi|1237268|gb|AAC37145.1| eco29kIM [Escherichia coli]
 gi|2660513|emb|CAA04944.1| DNA-methyltransferase [Escherichia coli]
          Length = 382

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + A D+GVPQ RER+ I+    + + ++ FP+    + +L  + E+H+    
Sbjct: 170 INAADYGVPQIRERVIIVGVRSDLNKKWSFPSVTHTQEKL--LWEQHVTGDY 219


>gi|19718332|ref|NP_604405.1| plasmid encoded methyltransferase Pem [Salmonella enteritidis]
 gi|19526586|gb|AAL87019.1| plasmid encoded methyltransferase Pem [Salmonella enterica subsp.
           enterica serovar Enteritidis]
          Length = 382

 Score = 50.7 bits (121), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + A D+GVPQ RER+ I+    + + ++ FP+    + +L  + E+H+    
Sbjct: 170 INAADYGVPQIRERVIIVGVRSDLNKKWSFPSVTHTQEKL--LWEQHVTGDY 219


>gi|296313785|ref|ZP_06863726.1| modification methylase NgoPII [Neisseria polysaccharea ATCC 43768]
 gi|296839714|gb|EFH23652.1| modification methylase NgoPII [Neisseria polysaccharea ATCC 43768]
          Length = 330

 Score = 50.7 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 19/91 (20%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW- 58
           + A D+GV Q R+R++ I F     ++F FPT       + D      +DK T+ + +W 
Sbjct: 144 VNAKDYGVAQERKRVFYIGFRKDLKIKFSFPTGS----TVKD------EDKITLKDIIWD 193

Query: 59  -------EGHQKRKENNKIAGKGFGYGLFFE 82
                     Q +   N I    +  G F  
Sbjct: 194 LQDTAVPAAFQNKANPNAINNNEYFIGSFSP 224


>gi|240118874|ref|ZP_04732936.1| DcmB [Neisseria gonorrhoeae PID1]
          Length = 325

 Score = 50.3 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 11/59 (18%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GV Q R+R++ I F     ++F FP    ++ +          DK T+ + +W+
Sbjct: 140 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVENK----------DKITLKDVIWD 188


>gi|312386601|emb|CBY05924.1| putative DNA methylase [Streptococcus pneumoniae]
          Length = 452

 Score = 50.3 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DFGVPQ RER++II           FP
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFP 178


>gi|297621903|ref|YP_003710040.1| C-5 cytosine-specific DNA methylase [Waddlia chondrophila WSU
           86-1044]
 gi|297377204|gb|ADI39034.1| C-5 cytosine-specific DNA methylase [Waddlia chondrophila WSU
           86-1044]
          Length = 410

 Score = 50.3 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56
           +K+  + VPQ+RERL+I+   N      +FK+P+P      L D L++  + D    ++ 
Sbjct: 220 LKSIFYQVPQKRERLFIVGVRNDLVKKAKFKWPSPFKKVLTLKDALKQGSLYDSDVPTSN 279

Query: 57  LWEGHQKRKE 66
                Q++KE
Sbjct: 280 GQLYPQRKKE 289


>gi|313891845|ref|ZP_07825450.1| putative modification methylase HhaI [Dialister microaerophilus
           UPII 345-E]
 gi|313119839|gb|EFR43026.1| putative modification methylase HhaI [Dialister microaerophilus
           UPII 345-E]
          Length = 394

 Score = 50.3 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKST 52
            + D+GVPQ RER+YI+  L      +  P     +  L  +++    D+  
Sbjct: 153 NSKDYGVPQNRERVYIVGHLGERCGRELLPVARKSERALKKVIDGSQGDRVY 204


>gi|167854495|ref|ZP_02477276.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           parasuis 29755]
 gi|219872138|ref|YP_002476513.1| DNA-cytosine methyltransferase/C-5 cytosine-specific DNA methylase
           [Haemophilus parasuis SH0165]
 gi|167854250|gb|EDS25483.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           parasuis 29755]
 gi|219692342|gb|ACL33565.1| DNA-cytosine methyltransferase/C-5 cytosine-specific DNA methylase
           [Haemophilus parasuis SH0165]
          Length = 320

 Score = 50.3 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFP 30
           +   ++GVPQ RER+ I+   N  + EF FP
Sbjct: 158 LNTANYGVPQTRERVIIVGVRNDLTSEFFFP 188


>gi|315917403|ref|ZP_07913643.1| type II restriction-modification system methylation subunit
           [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691278|gb|EFS28113.1| type II restriction-modification system methylation subunit
           [Fusobacterium gonidiaformans ATCC 25563]
          Length = 320

 Score = 50.3 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51
           + A DFG+PQ+RER++++  L  +  F F      + R + + +E+   +  
Sbjct: 154 LNAMDFGIPQKRERIFVVSIL-GNNSFDFAKLEKTQTRDISEFIEKDASNLY 204


>gi|257466246|ref|ZP_05630557.1| Type II restriction-modification system methylation subunit
           [Fusobacterium gonidiaformans ATCC 25563]
          Length = 327

 Score = 50.3 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKS 51
           + A DFG+PQ+RER++++  L  +  F F      + R + + +E+   +  
Sbjct: 161 LNAMDFGIPQKRERIFVVSIL-GNNSFDFAKLEKTQTRDISEFIEKDASNLY 211


>gi|289167633|ref|YP_003445902.1| methyl transferase [Streptococcus mitis B6]
 gi|288907200|emb|CBJ22035.1| methyl transferase [Streptococcus mitis B6]
          Length = 452

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DFGVPQ RER++II           FP
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFP 178


>gi|118577457|ref|YP_899696.1| DNA-cytosine methyltransferase [Pelobacter propionicus DSM 2379]
 gi|118504962|gb|ABL01443.1| DNA-cytosine methyltransferase [Pelobacter propionicus DSM 2379]
          Length = 313

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
           A D+GVPQ RER++I+       +F  P P+  K
Sbjct: 162 AADYGVPQTRERVFIVGTRPDVQKFIPPKPVCSK 195


>gi|91201234|emb|CAJ74294.1| similar to site-specific DNA-methyltransferase (cytosine-specific)
           [Candidatus Kuenenia stuttgartiensis]
          Length = 313

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
           A D+GVPQ RER++I+        F  P P+  K
Sbjct: 162 AEDYGVPQTRERVFIVGTRPDVSRFTPPEPVCDK 195


>gi|326563801|gb|EGE14052.1| type II DNA modification enzyme [Moraxella catarrhalis 46P47B1]
 gi|326566814|gb|EGE16953.1| type II DNA modification enzyme [Moraxella catarrhalis 103P14B1]
 gi|326576727|gb|EGE26634.1| type II DNA modification enzyme [Moraxella catarrhalis 101P30B1]
          Length = 327

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKS-TISNKL 57
           + +  +GVPQ R+R+Y +          FKFP P+  KP + D L +  D +    +   
Sbjct: 144 LDSQYYGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTF 202

Query: 58  WEGHQKRKENNK 69
            +    +   N+
Sbjct: 203 QKYLASKYNKNQ 214


>gi|322412375|gb|EFY03283.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 401

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DF VPQ RER++II         F FP
Sbjct: 98  LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 128


>gi|218900599|ref|YP_002449010.1| modification methylase HaeIII [Bacillus cereus G9842]
 gi|218543463|gb|ACK95857.1| modification methylase HaeIII [Bacillus cereus G9842]
          Length = 313

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 16/106 (15%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKST-ISNKLWE 59
              D+GVPQ+RER+  I   N  + E++FP P   +    D+  ++   +   IS  L  
Sbjct: 143 NLADYGVPQKRERVIFIGVRNDMNFEYEFPMPTHEENPTFDLFNQNALQRWVSISEVL-A 201

Query: 60  GHQKRKENNK-----------IAGKGF-GYGLFFENSATTNTLSAR 93
           G  +  E++K           I  K F G+ +   +   + T+ AR
Sbjct: 202 GLPEPSEDSKILNHVCSNYKIIENKNFTGHRMINPDKP-SPTILAR 246


>gi|109946722|ref|YP_663950.1| cytosine specific DNA methyltransferase fragment 2 [Helicobacter
          acinonychis str. Sheeba]
 gi|109713943|emb|CAJ98951.1| cytosine specific DNA methyltransferase fragment 2 [Helicobacter
          acinonychis str. Sheeba]
          Length = 101

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
          + A D+GVPQ RER +I+   + S +F    P   
Sbjct: 45 LNAKDYGVPQSRERAFIVGATHFSFDFNLLEPSQS 79


>gi|332523411|ref|ZP_08399663.1| modification methylase HpaII [Streptococcus porcinus str. Jelinkova
           176]
 gi|332314675|gb|EGJ27660.1| modification methylase HpaII [Streptococcus porcinus str. Jelinkova
           176]
          Length = 451

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DF VPQ RER++II         F FP
Sbjct: 148 LNSKDFQVPQNRERIFIIGHSRRFRPRFLFP 178


>gi|86137701|ref|ZP_01056277.1| DNA modification methylase M.NGOI [Roseobacter sp. MED193]
 gi|85825293|gb|EAQ45492.1| DNA modification methylase M.NGOI [Roseobacter sp. MED193]
          Length = 319

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDIL 43
           + A DFGVPQ R R+ I+       + F +P P     P +G+ L
Sbjct: 145 LNASDFGVPQLRPRVAIVALRKEYSDQFNWPDPLPHNPPTVGETL 189


>gi|326567346|gb|EGE17461.1| type II DNA modification enzyme [Moraxella catarrhalis BC1]
          Length = 327

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKS-TISNKL 57
           + +  +GVPQ R+R+Y +          FKFP P+  KP + D L +  D +    +   
Sbjct: 144 LDSQYYGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTF 202

Query: 58  WEGHQKRKENNK 69
            +    +   N+
Sbjct: 203 QKYLASKYNKNQ 214


>gi|326560963|gb|EGE11328.1| type II DNA modification enzyme [Moraxella catarrhalis 7169]
 gi|326575187|gb|EGE25115.1| type II DNA modification enzyme [Moraxella catarrhalis CO72]
          Length = 322

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKS-TISNKL 57
           + +  +GVPQ R+R+Y +          FKFP P+  KP + D L +  D +    +   
Sbjct: 139 LDSQYYGVPQMRQRVYFVGIRKDIKHMPFKFPQPILSKP-IDDFLSDDRDYEFDVNNPTF 197

Query: 58  WEGHQKRKENNK 69
            +    +   N+
Sbjct: 198 QKYLASKYNKNQ 209


>gi|306833678|ref|ZP_07466805.1| DNA (cytosine-5-)-methyltransferase [Streptococcus bovis ATCC
           700338]
 gi|304424448|gb|EFM27587.1| DNA (cytosine-5-)-methyltransferase [Streptococcus bovis ATCC
           700338]
          Length = 451

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42
           + + DF VPQ RER++II         F FP      P    RLG+I
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRNRSRFLFPLRGEDSPAHLERLGNI 194


>gi|258406639|ref|YP_003199380.1| transcriptional regulator, XRE family [Desulfohalobium retbaense
           DSM 5692]
 gi|257798866|gb|ACV69802.1| transcriptional regulator, XRE family [Desulfohalobium retbaense
           DSM 5692]
          Length = 468

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 14/23 (60%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP 23
           + A D+GVPQ RER+  +   N 
Sbjct: 268 INAKDYGVPQHRERIIFVAVRND 290


>gi|291320302|ref|YP_003515564.1| cytosine specific methyltransferase [Mycoplasma agalactiae]
 gi|290752635|emb|CBH40608.1| Cytosine specific methyltransferase [Mycoplasma agalactiae]
          Length = 339

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDIL 43
           + A D+ V Q+RERL +I   N     ++F FPT    K  L DIL
Sbjct: 153 LNALDYNVAQKRERLIVIGIRNDIVNKIKFSFPTKSKNKLVLKDIL 198


>gi|194396841|ref|YP_002037999.1| Tn5253 C-5 cytosine-specific DNA methylase [Streptococcus
           pneumoniae G54]
 gi|194356508|gb|ACF54956.1| Tn5253 C-5 cytosine-specific DNA methylase [Streptococcus
           pneumoniae G54]
          Length = 452

 Score = 50.3 bits (120), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DFGVPQ RER++II           FP
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFP 178


>gi|127447|sp|P25266|MTE1_HERAU RecName: Full=Modification methylase HgiEI; Short=M.HgiEI; AltName:
           Full=Cytosine-specific methyltransferase HgiEI
 gi|43471|emb|CAA38944.1| methyltransferase [Herpetosiphon aurantiacus]
          Length = 437

 Score = 50.3 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE 44
           + + DFGV Q R+R++I+          F FP       RL  IL+
Sbjct: 146 LNSFDFGVAQNRDRVFIVGIQQKLDLNGFSFPEYAESDQRLYHILD 191


>gi|258514794|ref|YP_003191016.1| DNA-cytosine methyltransferase [Desulfotomaculum acetoxidans DSM
           771]
 gi|257778499|gb|ACV62393.1| DNA-cytosine methyltransferase [Desulfotomaculum acetoxidans DSM
           771]
          Length = 402

 Score = 50.3 bits (120), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 13/70 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKST--ISNKL 57
           + A D+GVPQ R R+ I+ F N  +  + FP     +  L          + +  IS + 
Sbjct: 180 VNAADYGVPQSRHRVIIVGFRNDLNANWSFPDATHSQDAL----------RYSKWISGEY 229

Query: 58  WEGHQKRKEN 67
           WE H+  K  
Sbjct: 230 WEEHKIAKAK 239


>gi|309809233|ref|ZP_07703103.1| modification methylase HaeIII [Lactobacillus iners SPIN 2503V10-D]
 gi|308170467|gb|EFO72490.1| modification methylase HaeIII [Lactobacillus iners SPIN 2503V10-D]
          Length = 340

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 29/74 (39%), Gaps = 13/74 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R+R++ + F    ++ F   P P   K    D +         + +   
Sbjct: 142 LNASDYGVPQDRKRVFYVGFRKDLNINFDIPPKPYDYKLTFRDAI-------YDLKDNAI 194

Query: 59  EGHQKRKENNKIAG 72
                  E NK  G
Sbjct: 195 PAL----EKNKTNG 204


>gi|294673665|ref|YP_003574281.1| prophage PRU01 DNA methylase, C-5 cytosine-specific family
           [Prevotella ruminicola 23]
 gi|294471747|gb|ADE81136.1| prophage PRU01, DNA methylase, C-5 cytosine-specific family
           [Prevotella ruminicola 23]
          Length = 330

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDIL 43
           + A D+GV Q R+R++ I F N  +++FKFP         K  L DI+
Sbjct: 144 VNAKDYGVAQERKRVFYIGFRNDLNIDFKFPEGSTRDDKKKITLRDII 191


>gi|319757724|gb|ADV69666.1| DNA-cytosine methyltransferase [Streptococcus suis JS14]
          Length = 451

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42
           + + DF VPQ RER++II         F FP      P    RLG+I
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFLFPLKRENSPAHLERLGNI 194


>gi|332361316|gb|EGJ39120.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           sanguinis SK1056]
          Length = 454

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DF VPQ RER++II         F FP
Sbjct: 151 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 181


>gi|168490143|ref|ZP_02714342.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae SP195]
 gi|183571468|gb|EDT91996.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae SP195]
 gi|321157174|emb|CBW39159.1| Cytosine-specific DNA methyltransferase [Streptococcus phage 11865]
          Length = 360

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF 29
           + + +FGVPQ RER++II  L      +F
Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRRERTRRF 175


>gi|269214273|ref|ZP_05986228.2| modification methylase NgoPII [Neisseria lactamica ATCC 23970]
 gi|269210330|gb|EEZ76785.1| modification methylase NgoPII [Neisseria lactamica ATCC 23970]
          Length = 330

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 11/59 (18%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GV Q R+R++ I F     ++F FP         G  +E+   DK T+ + +W+
Sbjct: 145 NAKDYGVAQERKRVFYIGFRKDLEIQFSFPK--------GSTVEDK--DKITLRDVIWD 193


>gi|304311589|ref|YP_003811187.1| C-5 cytosine-specific DNA methylase [gamma proteobacterium HdN1]
 gi|301797322|emb|CBL45542.1| C-5 cytosine-specific DNA methylase [gamma proteobacterium HdN1]
          Length = 387

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ II    + ++ + FP P   + RL  + + H+  +       WE
Sbjct: 170 INAADYGVPQVRERVIIIGLRSDLNLNWSFPEPTHSQDRL--LWDIHVSGEY------WE 221

Query: 60  GHQKRKEN 67
            H+   + 
Sbjct: 222 QHRVSAKE 229


>gi|240143270|ref|ZP_04741871.1| modification methylase BspRI [Roseburia intestinalis L1-82]
 gi|257204748|gb|EEV03033.1| modification methylase BspRI [Roseburia intestinalis L1-82]
          Length = 432

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 16/80 (20%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF--PTPLG------------IKPRLGDILEEH 46
           + + ++GVPQ RER+ ++   N  ++F++  P P              ++  +GD LE++
Sbjct: 226 LNSAEYGVPQIRERVILVGVRND-IDFEYVHPEPTHGYGVEGLKEVVTLRDAIGD-LEDN 283

Query: 47  IDDKSTISNKLWEGHQKRKE 66
             D  T S       + RK+
Sbjct: 284 PGDYFTGSYSTIFMSRNRKK 303


>gi|219724141|ref|YP_002477179.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Borrelia
           burgdorferi 156a]
 gi|225575842|ref|YP_002724642.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 118a]
 gi|219693145|gb|ACL34349.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Borrelia
           burgdorferi 156a]
 gi|225546742|gb|ACN92742.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 118a]
          Length = 311

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 5/58 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-----EFKFPTPLGIKPRLGDILEEHIDDKSTI 53
           + A +FGVPQ RER+Y       +      ++  P     K  L DILE+ +     I
Sbjct: 142 LNASNFGVPQARERVYFACLRKDTGTSEKLKYSKPKETFKKIYLEDILEKDVPKSMYI 199


>gi|224796590|ref|YP_002641667.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 64b]
 gi|223929176|gb|ACN23896.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 64b]
 gi|312149869|gb|ADQ29935.1| DNA-cytosine methyltransferase [Borrelia burgdorferi N40]
          Length = 324

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 5/58 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-----EFKFPTPLGIKPRLGDILEEHIDDKSTI 53
           + A +FGVPQ RER+Y       +      ++  P     K  L DILE+ +     I
Sbjct: 155 LNASNFGVPQARERVYFACLRKDTGTSEKLKYSKPKETFKKIYLEDILEKDVPKSMYI 212


>gi|319778406|ref|YP_004129319.1| DNA (cytosine-5-)-methyltransferase [Taylorella equigenitalis MCE9]
 gi|317108430|gb|ADU91176.1| DNA (cytosine-5-)-methyltransferase [Taylorella equigenitalis MCE9]
          Length = 160

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 10/20 (50%), Positives = 16/20 (80%)

Query: 1   MKACDFGVPQRRERLYIIDF 20
           + + +FGVPQ R+R+YI+ F
Sbjct: 141 LNSKNFGVPQNRKRIYIVAF 160


>gi|146318633|ref|YP_001198345.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 05ZYH33]
 gi|146320840|ref|YP_001200551.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 98HAH33]
 gi|253751755|ref|YP_003024896.1| C-5 cytosine-specific DNA methylase [Streptococcus suis SC84]
 gi|253755540|ref|YP_003028680.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407]
 gi|145689439|gb|ABP89945.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 05ZYH33]
 gi|145691646|gb|ABP92151.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 98HAH33]
 gi|251816044|emb|CAZ51664.1| C-5 cytosine-specific DNA methylase [Streptococcus suis SC84]
 gi|251818004|emb|CAZ55786.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407]
          Length = 451

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42
           + + DF VPQ RER++II         F FP      P    RLG+I
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRPRFLFPLRRENSPAHLERLGNI 194


>gi|319744417|gb|EFV96775.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           agalactiae ATCC 13813]
          Length = 450

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DF VPQ RER++II         F FP
Sbjct: 151 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 181


>gi|288906872|emb|CBJ21706.1| type II DNA modification methyltransferase [Streptococcus mitis B6]
          Length = 380

 Score = 49.9 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30
           + + +FGVPQ RER++II  L  +   K FP
Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRGTSGRKVFP 177


>gi|225869346|ref|YP_002745294.1| C-5 cytosine-specific DNA methylase [Streptococcus equi subsp.
           zooepidemicus]
 gi|225702622|emb|CAX00673.1| C-5 cytosine-specific DNA methylase [Streptococcus equi subsp.
           zooepidemicus]
          Length = 451

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DF VPQ RER++II         F FP
Sbjct: 148 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 178


>gi|294651999|ref|ZP_06729281.1| DNA (cytosine-5-)-methyltransferase [Acinetobacter haemolyticus
           ATCC 19194]
 gi|292822115|gb|EFF81036.1| DNA (cytosine-5-)-methyltransferase [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 336

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDK 50
           + A D+G+ Q R+R+  + F    +V + FP P+  K  L DI+ + ++DK
Sbjct: 145 LNATDYGIAQDRKRVIFLGFRKDLNVHYTFPEPIVKKLVLKDII-KDLEDK 194


>gi|168494837|ref|ZP_02718980.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|168494899|ref|ZP_02719042.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|168494952|ref|ZP_02719095.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|168494999|ref|ZP_02719142.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|183575153|gb|EDT95681.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|183575203|gb|EDT95731.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|183575231|gb|EDT95759.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|183575300|gb|EDT95828.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
          Length = 360

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFP 30
           + + +FGVPQ RER++II           FP
Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRRERTRRIFP 177


>gi|229187780|ref|ZP_04314910.1| Cytosine-specific methyltransferase [Bacillus cereus BGSC 6E1]
 gi|228595683|gb|EEK53373.1| Cytosine-specific methyltransferase [Bacillus cereus BGSC 6E1]
          Length = 365

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/19 (57%), Positives = 15/19 (78%)

Query: 1   MKACDFGVPQRRERLYIID 19
           + + DFGVPQ RER++II 
Sbjct: 150 LNSKDFGVPQNRERVFIIG 168


>gi|227874220|ref|ZP_03992420.1| DNA (cytosine-5-)-methyltransferase [Oribacterium sinus F0268]
 gi|227839928|gb|EEJ50358.1| DNA (cytosine-5-)-methyltransferase [Oribacterium sinus F0268]
          Length = 336

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDIL 43
           + A D+GV Q+RERL  I         ++++FP     KP L DIL
Sbjct: 152 LNAWDYGVAQKRERLITIGIRKDLEDKIKYEFPKVYEYKPLLKDIL 197


>gi|225858823|ref|YP_002740333.1| methyl transferase [Streptococcus pneumoniae 70585]
 gi|225720620|gb|ACO16474.1| methyl transferase [Streptococcus pneumoniae 70585]
          Length = 451

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42
           + + DF VPQ RER++II         F FP      P    RLG+I
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFLFPLRRENSPAHLERLGNI 194


>gi|186683211|ref|YP_001866407.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102]
 gi|14594714|gb|AAK68647.1| cytosine-specific DNA methyltransferase [Nostoc punctiforme PCC
           73102]
 gi|186465663|gb|ACC81464.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102]
          Length = 421

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A ++GVPQ RERL++I         K+P P+  KP L + L         +S  +W+
Sbjct: 161 LNAANYGVPQSRERLFLIGAREDVELPKYPQPI-TKPALPNNLTSKKISNIPLSPTVWD 218


>gi|223933016|ref|ZP_03625010.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591]
 gi|223898333|gb|EEF64700.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591]
          Length = 451

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42
           + + DF VPQ RER++II         F FP      P    RLG+I
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRPRFLFPLRGENSPAHLERLGNI 194


>gi|322411604|gb|EFY02512.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 451

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DF VPQ RER++II         F FP
Sbjct: 148 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 178


>gi|226223282|ref|YP_002757389.1| type II DNA modification enzyme (methyltransferase) [Listeria
           monocytogenes Clip81459]
 gi|225875744|emb|CAS04447.1| Putative type II DNA modification enzyme (methyltransferase)
           [Listeria monocytogenes serotype 4b str. CLIP 80459]
          Length = 389

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPL 33
           + A  FGVPQ RER++++           ++FP  L
Sbjct: 169 LNAKHFGVPQNRERVFLLGIRKDLEIKQNWEFPERL 204


>gi|1709163|sp|P50188|MTN1_NOCAE RecName: Full=Modification methylase NaeI; Short=M.NaeI; AltName:
           Full=Cytosine-specific methyltransferase NaeI
 gi|775103|gb|AAC43325.1| NaeI modification methyltransferase [Lechevalieria aerocolonigenes]
          Length = 413

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEE 45
           + A DFGVPQ R R  ++   N     F +P P G  P +G+ L++
Sbjct: 148 LHASDFGVPQLRPRFVLVALQNKFAPYFTWPEPTGAAPTVGETLKD 193


>gi|268610192|ref|ZP_06143919.1| cytosine-specific DNA methylase [Ruminococcus flavefaciens FD-1]
          Length = 475

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 22/95 (23%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-------------SVEFKFPTPLGIKPRLGD---ILE 44
           +   DFG+PQ RER+YI+                    + +       K ++GD   ILE
Sbjct: 204 LSPSDFGIPQIRERVYILGIRRDIRNQQILTNGFIHIEDLQLDKHFK-KCKMGDAWSILE 262

Query: 45  EHIDDKSTISNK----LWEGHQKRKENNKIAGKGF 75
           + +DD   IS +    +    + RK  N I   GF
Sbjct: 263 DEVDDSYIISEEKEQMILAWEEFRKATN-IKVIGF 296


>gi|223932228|ref|ZP_03624232.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591]
 gi|223899209|gb|EEF65566.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591]
          Length = 451

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42
           + + DF VPQ RER++II         F FP      P    RLG+I
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRRENSPAHLERLGNI 194


>gi|319744643|gb|EFV96990.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           agalactiae ATCC 13813]
          Length = 451

 Score = 49.5 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42
           + + DF VPQ RER++II         F FP      P    RLG+I
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRRENSPAHLERLGNI 194


>gi|157419765|gb|ABV55454.1| DNA methylase [Streptococcus dysgalactiae subsp. equisimilis]
          Length = 451

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42
           + + DF VPQ RER++II         F FP      P    RLG+I
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRREDSPAHLERLGNI 194


>gi|22537444|ref|NP_688295.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae
           2603V/R]
 gi|76797962|ref|ZP_00780222.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae
           18RS21]
 gi|77406085|ref|ZP_00783160.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae H36B]
 gi|313890485|ref|ZP_07824113.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|22534321|gb|AAN00168.1|AE014251_12 C-5 cytosine-specific DNA methylase [Streptococcus agalactiae
           2603V/R]
 gi|76586686|gb|EAO63184.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae
           18RS21]
 gi|77175318|gb|EAO78112.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae H36B]
 gi|313121002|gb|EFR44113.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|323127117|gb|ADX24414.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
          Length = 451

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42
           + + DF VPQ RER++II         F FP      P    RLG+I
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRREDSPAHLERLGNI 194


>gi|332673536|gb|AEE70353.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 83]
          Length = 434

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30
           + A DFGV Q RERLYI+  L+ +++   FP
Sbjct: 175 LNAKDFGVAQNRERLYIVGNLSCTIDLDHFP 205


>gi|308235652|ref|ZP_07666389.1| DcmB [Gardnerella vaginalis ATCC 14018]
 gi|311115197|ref|YP_003986418.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis ATCC
           14019]
 gi|310946691|gb|ADP39395.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis ATCC
           14019]
          Length = 333

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 11/60 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GV Q R+R++ I F    +++F FP              E  + K T+ + +W+
Sbjct: 148 VNAKDYGVAQDRKRVFYIGFRKDLNIKFSFPKGST----------EDDEKKLTLKDVIWD 197


>gi|67924690|ref|ZP_00518097.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
 gi|67853467|gb|EAM48819.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
          Length = 420

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/91 (17%), Positives = 32/91 (35%), Gaps = 25/91 (27%)

Query: 1   MKACDFGVPQRRERLYIID---------------------FLNPSVEFKFPTPLGIKPR- 38
           + + +F VPQ R R+YI+                      F    ++     P+    + 
Sbjct: 146 LNSSNFNVPQNRVRIYIVGKKGSQPNLTIKSDKGAIDSHSFKKNIIQGDLFAPINYPTKP 205

Query: 39  --LGDILEEHIDDKSTISNKLWEGHQKRKEN 67
             + DIL++ +++K   S +       R   
Sbjct: 206 LTVKDILKDIVEEKYFCSQEF-TNLLNRAVR 235


>gi|153940750|ref|YP_001392502.1| hypothetical protein CLI_3290 [Clostridium botulinum F str.
           Langeland]
 gi|152936646|gb|ABS42144.1| conserved domain protein [Clostridium botulinum F str. Langeland]
          Length = 338

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFP 30
           + + DFGVPQ RER++II      S    FP
Sbjct: 151 INSRDFGVPQNRERVFIIGHLRERSTRKIFP 181


>gi|309808410|ref|ZP_07702309.1| putative modification methylase HhaI [Lactobacillus iners LactinV
           01V1-a]
 gi|308168238|gb|EFO70357.1| putative modification methylase HhaI [Lactobacillus iners LactinV
           01V1-a]
          Length = 198

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGI 35
           +   ++G+PQ+RER+Y++ F N      F FP P  +
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKL 188


>gi|253755079|ref|YP_003028219.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407]
 gi|251817543|emb|CAZ55290.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407]
          Length = 451

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKP----RLGDI 42
           + + DF VPQ RER++II         F FP      P    RLG+I
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRGENSPAHLERLGNI 194


>gi|254467362|ref|ZP_05080773.1| DNA-cytosine methyltransferase [Rhodobacterales bacterium Y4I]
 gi|206688270|gb|EDZ48752.1| DNA-cytosine methyltransferase [Rhodobacterales bacterium Y4I]
          Length = 319

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR 38
           + A DFGVPQ R R+ I+      S +F +P PL   P 
Sbjct: 145 LNASDFGVPQLRPRVAIVALRKEFSGQFNWPEPLPHNPP 183


>gi|302387870|ref|YP_003823692.1| DNA-cytosine methyltransferase [Clostridium saccharolyticum WM1]
 gi|302198498|gb|ADL06069.1| DNA-cytosine methyltransferase [Clostridium saccharolyticum WM1]
          Length = 569

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 20/44 (45%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDIL 43
           + +  FGVPQ RER+Y++  F        FP        +  ++
Sbjct: 178 VNSKHFGVPQHRERVYLVGHFGGIRGRKVFPIGGANTAPVKQLI 221


>gi|194337838|ref|YP_002019632.1| DNA-cytosine methyltransferase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194310315|gb|ACF45015.1| DNA-cytosine methyltransferase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 409

 Score = 49.5 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 28/65 (43%), Gaps = 7/65 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ RER+ I+      +   +  P+        + + ++  +       WE 
Sbjct: 170 INAADYGVPQTRERVVIVG-TRADISLPWSFPIETHSEDRLLWDMYVTGEY------WER 222

Query: 61  HQKRK 65
           H+  K
Sbjct: 223 HKVHK 227


>gi|148252729|ref|YP_001237314.1| putative 5-methylcytosine methyltransferase [Bradyrhizobium sp.
           BTAi1]
 gi|146404902|gb|ABQ33408.1| putative 5-methylcytosine methyltransferase [Bradyrhizobium sp.
           BTAi1]
          Length = 381

 Score = 49.1 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE 26
           + A DFGVPQ R R++I+ F    V+
Sbjct: 179 INARDFGVPQNRRRVFILGFDRRRVD 204


>gi|227874774|ref|ZP_03992927.1| DNA methyltransferase Cfr42I [Mobiluncus mulieris ATCC 35243]
 gi|227844549|gb|EEJ54705.1| DNA methyltransferase Cfr42I [Mobiluncus mulieris ATCC 35243]
          Length = 420

 Score = 49.1 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 17/75 (22%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQRR R++++ F +     + FP P      L    E         S + W 
Sbjct: 198 VDAADYGVPQRRHRVFMVGFRSDVDAGWNFPAPTHSASALRAAQE---------SGEYW- 247

Query: 60  GHQKRKENNKIAGKG 74
                 E ++IA KG
Sbjct: 248 ------ERHRIAIKG 256


>gi|305666023|ref|YP_003862310.1| putative DNA modification methylase [Maribacter sp. HTCC2170]
 gi|88710798|gb|EAR03030.1| putative DNA modification methylase (N.MgoV) [Maribacter sp.
           HTCC2170]
          Length = 493

 Score = 49.1 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + + D+G+PQ R R+YII F +      FK P       +L   LE+    + 
Sbjct: 145 INSHDYGLPQNRIRVYIIGFKDKRYLDSFKLPDKPLNGHKLFQHLEDLPKPQF 197


>gi|313683546|ref|YP_004061284.1| DNA-cytosine methyltransferase [Sulfuricurvum kujiense DSM 16994]
 gi|313156406|gb|ADR35084.1| DNA-cytosine methyltransferase [Sulfuricurvum kujiense DSM 16994]
          Length = 332

 Score = 49.1 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDIL 43
           + A DFGVPQ R R+ ++         F +P      P +G+ L
Sbjct: 154 INAKDFGVPQLRPRVILVGLRKNIFPYFSWPDSYLEAPTVGEAL 197


>gi|317012300|gb|ADU82908.