PSIBLAST alignment of GI: 255764504 and protein with PDB id: 1fjx

>gi|12084381|pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase Mutant (T250g) In Complex With Dna And Adohcy Length = 327
>gi|85544394|pdb|2C7R|A Chain A, Hhai Dna Methyltransferase (T250g Mutant) Complex With Oligonucleotide Containing 2-Aminopurine As A Target Base (Gpgc:gmgc) And Sah Length = 327
 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L    + +  + ++
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDR 209