PSIBLAST alignment of GI: 255764504 and protein with PDB id: 1mht

gi|1065144|pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna And S-Adenosyl-L-Homocysteine Length = 327
>gi|1942412|pdb|3MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Unmodified Dna And Adohcy Length = 327
 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253