PSIBLAST alignment of GI: 255764504 and protein with PDB id: 2uyc

>gi|189096047|pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer Gcgc-Gmgc Oligonucleotide And Sah Length = 327
 Score = 64.6 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+ ER+Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKNERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253