PSIBLAST alignment of GI: 255764504 and protein with PDB id: 2z6q

>gi|158431504|pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna Methyltransferase With Unmodified Dna And Adohcy Length = 327
 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RE +Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKREAIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253