BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI
[Candidatus Liberibacter asiaticus str. psy62]
         (101 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|78777762|ref|YP_394077.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM
           1251]
 gi|78498302|gb|ABB44842.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM
           1251]
          Length = 328

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 78/101 (77%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ RER+YI+ FL+  VEF+FP P+    ++GDILE+ +D+K TIS+KLW G
Sbjct: 163 LNAKDYGVPQNRERIYIVGFLDNEVEFEFPKPIEKYVKVGDILEDKVDEKYTISDKLWAG 222

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  +K  G GFGY +F ENS  T+T+SARYYKDGSEI
Sbjct: 223 HQRRKIEHKAKGNGFGYSMFNENSIYTSTISARYYKDGSEI 263


>gi|150026187|ref|YP_001297013.1| type II modification methyltransferase [Flavobacterium
           psychrophilum JIP02/86]
 gi|149772728|emb|CAL44211.1| Probable type II modification methyltransferase [Flavobacterium
           psychrophilum JIP02/86]
          Length = 335

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 63/101 (62%), Positives = 83/101 (82%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA +FG+PQ RER+YI+ FL+ S++FKFPTP  +  ++GDILE+ +D+K TIS++LWEG
Sbjct: 152 LKAKEFGLPQNRERIYIVGFLDNSIKFKFPTPTKLPTKVGDILEQKVDEKYTISDRLWEG 211

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  NK  GKGFG+G+  ENS  TNT+SARYYKDGSEI
Sbjct: 212 HQRRKIANKEKGKGFGFGIVNENSEYTNTISARYYKDGSEI 252


>gi|313667524|ref|YP_004047808.1| cytosine-specific methyltransferase [Neisseria lactamica ST-640]
 gi|309378245|emb|CBX23130.1| DNA cytosine methyltransferase M.NlaX [Neisseria lactamica
           Y92-1009]
 gi|313004986|emb|CBN86414.1| cytosine-specific methyltransferase [Neisseria lactamica 020-06]
          Length = 313

 Score =  145 bits (365), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFG+PQ RER+Y++ FLN  V+F+FP P+G    +GDILE + D+K TIS+KLW+G
Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  N+ AGKGFGYGLF   SA TNT+SARYYKDGSEI
Sbjct: 205 HQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245


>gi|224418923|ref|ZP_03656929.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|253827874|ref|ZP_04870759.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|313142438|ref|ZP_07804631.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|253511280|gb|EES89939.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
 gi|313131469|gb|EFR49086.1| DNA (cytosine-5-)-methyltransferase [Helicobacter canadensis MIT
           98-5491]
          Length = 328

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 60/101 (59%), Positives = 73/101 (72%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ RER+ I+ F + +V F FP P     +LGDILE+  D+K TISN+LWE 
Sbjct: 164 LNARDYGVPQNRERIIIVGFKDHNVHFDFPKPYNYSVKLGDILEKTPDEKYTISNRLWES 223

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RKE  K  G GFGY LF ENS  T+T+SARYYKDGSEI
Sbjct: 224 HQQRKELQKAKGNGFGYRLFDENSPYTSTISARYYKDGSEI 264


>gi|127471|sp|P24581|MTNX_NEILA RecName: Full=Cytosine-specific methyltransferase NlaX;
           Short=M.NlaX
 gi|45004|emb|CAA38357.1| cytosine-specific methyltransferase of NlaIII [Neisseria lactamica]
          Length = 313

 Score =  143 bits (360), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFG+PQ RER+Y++ FLN  V+F+FP P+G    +GDILE + D+K TIS+KLW+G
Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +Q+RK  N+ AGKGFGYGLF   SA TNT+SARYYKDGSEI
Sbjct: 205 YQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245


>gi|261400948|ref|ZP_05987073.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
 gi|269209191|gb|EEZ75646.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
          Length = 313

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/101 (63%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFG+PQ RER+Y++ FLN  V+F+FP P+G    +GDILE + D+K TIS+KLW+G
Sbjct: 145 LKARDFGIPQNRERIYLVGFLNHDVDFRFPQPIGQATAVGDILEAYPDEKYTISDKLWQG 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +Q+RK  N+ AGKGFGYGLF   SA TNT+SARYYKDGSEI
Sbjct: 205 YQRRKAENRAAGKGFGYGLFNAESAYTNTISARYYKDGSEI 245


>gi|315637499|ref|ZP_07892709.1| modification methylase EcoRII [Arcobacter butzleri JV22]
 gi|315478217|gb|EFU68940.1| modification methylase EcoRII [Arcobacter butzleri JV22]
          Length = 326

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/101 (64%), Positives = 81/101 (80%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ RER+YII FL+ S++FK+P PL  K RLGDIL++++DDK TIS+KLW G
Sbjct: 163 LNAKDFGVPQNRERIYIIAFLDHSIDFKYPKPLNKKNRLGDILDDNVDDKYTISDKLWAG 222

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK+ +K  G GFGY LF  NS  T+T+SARYYKDGSEI
Sbjct: 223 HQRRKKEHKEKGNGFGYSLFTHNSEYTSTISARYYKDGSEI 263


>gi|50914506|ref|YP_060478.1| Type II restriction-modification system methylation subunit
           [Streptococcus pyogenes MGAS10394]
 gi|40218542|gb|AAR83196.1| type II modification methylase [Streptococcus pyogenes]
 gi|50261587|gb|AAT72355.1| methylase [Streptococcus pyogenes]
 gi|50903580|gb|AAT87295.1| Type II restriction-modification system methylation subunit
           [Streptococcus pyogenes MGAS10394]
 gi|114386439|gb|ABI74454.1| DNA methyltransferase [Streptococcus pyogenes]
          Length = 408

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/104 (58%), Positives = 75/104 (72%), Gaps = 4/104 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           KA DFGVPQ RER+YI+ F    V     F+FP P  ++ +LG+IL+  +D+K TIS+KL
Sbjct: 243 KARDFGVPQNRERIYIVGFDKTCVNNFSEFRFPEPFHLETKLGNILQTDVDEKYTISDKL 302

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           WEGHQ+RK  +K  G GFGY LF  +S  TNTLSARYYKDGSEI
Sbjct: 303 WEGHQRRKAEHKTKGNGFGYSLFNADSPYTNTLSARYYKDGSEI 346


>gi|319407456|emb|CBI81106.1| Cytosine-specific methyltransferase NlaX [Bartonella sp. 1-1C]
          Length = 307

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 68/101 (67%), Positives = 80/101 (79%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KA DFGVPQ RER+YI+ FL+ S  FKFP+P+ IK R+GDIL+  +D+K TISN LW G
Sbjct: 147 LKARDFGVPQNRERIYIVGFLDHSTNFKFPSPMNIKTRVGDILDNDVDEKYTISNTLWHG 206

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK  NK+ GKGFGYGLF   S  TNTLSARYYKDGSEI
Sbjct: 207 HQRRKAQNKLNGKGFGYGLFNMESPYTNTLSARYYKDGSEI 247


>gi|119026301|ref|YP_910146.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC
           15703]
 gi|118765885|dbj|BAF40064.1| DNA-methyltransferase MKpn2kI [Bifidobacterium adolescentis ATCC
           15703]
          Length = 383

 Score =  137 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 66/105 (62%), Positives = 79/105 (75%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A DFGVPQ RER+YI+ F    V    +FK+P P  I  RLGDILE+++DDK TIS+ 
Sbjct: 214 LAAKDFGVPQNRERIYIVGFDKEQVPNWADFKYPEPPCIPTRLGDILEKNVDDKYTISDA 273

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW GHQ+RK+ NK AGKGFGYGLF E+S   NT+SARYYKDGSEI
Sbjct: 274 LWAGHQRRKQENKKAGKGFGYGLFDEDSPYANTISARYYKDGSEI 318


>gi|299536257|ref|ZP_07049570.1| DNA-methyltransferase MKpn2kI [Lysinibacillus fusiformis ZC1]
 gi|298728243|gb|EFI68805.1| DNA-methyltransferase MKpn2kI [Lysinibacillus fusiformis ZC1]
          Length = 403

 Score =  136 bits (343), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLN----PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           ++A DFGVPQ RER++++ F        V FKFP PL     LGDIL + +D+K TIS+K
Sbjct: 212 LRAADFGVPQNRERVFMVGFNKRIGGELVPFKFPKPLSTPTNLGDILFKKVDEKYTISDK 271

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           L+EGH +RKE +K  G GFG+ LF ENS+ TNTLSARYYKDGSEI
Sbjct: 272 LYEGHLRRKEMHKQKGNGFGFSLFDENSSYTNTLSARYYKDGSEI 316


>gi|255066464|ref|ZP_05318319.1| modification methylase EcoRII [Neisseria sicca ATCC 29256]
 gi|298369378|ref|ZP_06980696.1| modification methylase EcoRII [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|255049344|gb|EET44808.1| modification methylase EcoRII [Neisseria sicca ATCC 29256]
 gi|298283381|gb|EFI24868.1| modification methylase EcoRII [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 357

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 56/101 (55%), Positives = 70/101 (69%), Gaps = 2/101 (1%)

Query: 3   ACDFGVPQRRERLYIIDFL--NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           A DF +PQ RER+YI+ F     + +F+FP PL    ++GDILE   D K TIS++LW+G
Sbjct: 192 AKDFNLPQNRERIYIVGFRSAKDAAQFEFPHPLPKTVKVGDILESFPDAKYTISDRLWQG 251

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           H +RK  +K  G GFGYGLF   S  TNT+SARYYKDGSEI
Sbjct: 252 HLRRKAEHKQKGNGFGYGLFNAQSEYTNTISARYYKDGSEI 292


>gi|157737722|ref|YP_001490405.1| DNA (cytosine-5-)-methyltransferase [Arcobacter butzleri RM4018]
 gi|157699576|gb|ABV67736.1| DNA (Cytosine-5-)-methyltransferase [Arcobacter butzleri RM4018]
          Length = 326

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 62/101 (61%), Positives = 78/101 (77%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FGVPQ RER+YII FL+ S++FK+P  L  K RLGDIL+ ++DDK TIS+KLW G
Sbjct: 163 LNARNFGVPQNRERIYIIAFLDHSIDFKYPKSLNKKNRLGDILDNNVDDKYTISDKLWAG 222

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQ+RK+ +K  G GFGY LF   S  T+T+SARYYKDGSEI
Sbjct: 223 HQRRKKEHKEKGNGFGYSLFTHESEYTSTISARYYKDGSEI 263


>gi|294788070|ref|ZP_06753314.1| modification methylase EcoRII [Simonsiella muelleri ATCC 29453]
 gi|294484363|gb|EFG32046.1| modification methylase EcoRII [Simonsiella muelleri ATCC 29453]
          Length = 355

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 69/106 (65%), Gaps = 5/106 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-----SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FGVPQ RER+YI+   N      +++F       +  ++GDIL+  +D+K TIS+
Sbjct: 184 LNAKNFGVPQNRERIYIVAIRNDFNPTFNLDFDKLKNTKVNCQVGDILQNQVDEKYTISD 243

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW GHQ+RK  +   G GFGY LF   S  T+T+SARYYKDGSEI
Sbjct: 244 KLWAGHQRRKAEHIEKGNGFGYSLFNAQSPYTSTISARYYKDGSEI 289


>gi|1709152|sp|P50185|MTD5_DACSA RecName: Full=Modification methylase DsaV; Short=M.DsaV; AltName:
           Full=Cytosine-specific methyltransferase DsaV
 gi|505694|gb|AAA86046.1| DsaV methyltransferase [Dactylococcopsis salina]
          Length = 351

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 76/104 (73%), Gaps = 3/104 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DF +PQ+RER++I+ F + + +   F FP P+ +  ++GD+LE+ +D+K TI++++
Sbjct: 146 ISATDFNLPQKRERIFIVGFQDKNNKNLIFDFPKPIELTAKVGDLLEKEVDEKYTITDRM 205

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           WEGHQ RK+ ++  G GFG+ L   NS+ T T+SARYYKDGSE+
Sbjct: 206 WEGHQNRKKAHRKRGNGFGFSLVNRNSSYTRTISARYYKDGSEV 249


>gi|170729237|ref|YP_001763263.1| DNA-cytosine methyltransferase [Shewanella woodyi ATCC 51908]
 gi|169814584|gb|ACA89168.1| DNA-cytosine methyltransferase [Shewanella woodyi ATCC 51908]
          Length = 416

 Score =  135 bits (339), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 73/102 (71%), Gaps = 1/102 (0%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M++ DFGVPQ R+R+YII + +  +E F++P P G   ++ DILE    +K TIS+KLW 
Sbjct: 255 MRSVDFGVPQNRQRIYIILWKDGLIEQFQYPKPSGKDTKVADILESEPCEKLTISDKLWA 314

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           GH++RK  NK  GKGFGYGL    S  TNT+SARYYKDGSEI
Sbjct: 315 GHKRRKIENKAKGKGFGYGLVSPESEYTNTISARYYKDGSEI 356


>gi|321310755|ref|YP_004193084.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
 gi|319802599|emb|CBY93245.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
          Length = 362

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 62/105 (59%), Positives = 71/105 (67%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           ++A DFGVPQ RER+YI+ F   +V     FKFP        LGDILE  +DDK TISN 
Sbjct: 196 LRARDFGVPQNRERIYIVGFDKDAVQGYRNFKFPEATHKNTCLGDILESEVDDKYTISNT 255

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LWEGH++RK  NK  GKGFGY LF   S   NTLSARYYKDGSE+
Sbjct: 256 LWEGHKRRKVENKKKGKGFGYSLFNFESPYANTLSARYYKDGSEV 300


>gi|1657420|gb|AAC45971.1| DNA cytosine methyltransferase M.SenPI [Salmonella enterica subsp.
           enterica serovar Enteritidis]
          Length = 379

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317


>gi|1871451|dbj|BAA11167.1| C5-cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|3421011|emb|CAA76526.1| M.Ecl18kI (DNA-methyltransferase) [Enterobacter cloacae]
          Length = 379

 Score =  133 bits (336), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317


>gi|32470131|ref|NP_863573.1| DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae]
 gi|462656|sp|P34879|MTS2_SHISO RecName: Full=Modification methylase SsoII; Short=M.SsoII; AltName:
           Full=Cytosine-specific methyltransferase SsoII
 gi|11559818|gb|AAG38101.1|AF300473_2 DNA-methyltransferase MKpn2kI [Klebsiella pneumoniae]
 gi|294244|gb|AAA98279.1| C5-cytosine methylase [Plasmid P4]
          Length = 379

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 274

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 275 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 317


>gi|323495143|ref|ZP_08100228.1| DNA-methyltransferase MKpn2kI [Vibrio brasiliensis LMG 20546]
 gi|323310583|gb|EGA63762.1| DNA-methyltransferase MKpn2kI [Vibrio brasiliensis LMG 20546]
          Length = 443

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 70/118 (59%), Gaps = 17/118 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-------FKFPTPLGIKPRLGDILEEHID----- 48
           ++A DFGVPQ RER++II F             F +P P     ++GDIL+   +     
Sbjct: 248 LRAADFGVPQNRERIFIIGFDKDYYTGVDFDQVFNWPEPPKTPTKVGDILQSDQELEAEA 307

Query: 49  -----DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                D  TIS++LWEGHQKRKE +K  G GFGY L+   S  TNT+SARYYKDGSEI
Sbjct: 308 KVIGKDCYTISDRLWEGHQKRKEGHKTKGNGFGYTLYNAESEYTNTISARYYKDGSEI 365


>gi|283471715|emb|CAQ50926.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 397

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 59/105 (56%), Positives = 73/105 (69%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           ++A DFG PQ RER+YI+ F    +     F FP PL I+  LG ILE +++DK TIS++
Sbjct: 227 LRARDFGCPQNRERIYIVGFDKQQIKNAENFSFPEPLPIETSLGSILESNVNDKYTISDR 286

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW GHQ+RK  +K  G GFGY +F E S  TNTLSARYYKDGSEI
Sbjct: 287 LWYGHQRRKREHKAKGNGFGYSIFNETSPYTNTLSARYYKDGSEI 331


>gi|323968851|gb|EGB64187.1| DNA-cytosine methyltransferase [Escherichia coli TA007]
          Length = 282

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 66/103 (64%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+ LW
Sbjct: 118 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSDALW 177

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            GHQ+RK  N  AGKGFGYGLF ENS  TNT+SARYYKDGSEI
Sbjct: 178 NGHQRRKLVNAAAGKGFGYGLFNENSPYTNTISARYYKDGSEI 220


>gi|152998369|ref|YP_001343204.1| DNA-cytosine methyltransferase [Marinomonas sp. MWYL1]
 gi|150839293|gb|ABR73269.1| DNA-cytosine methyltransferase [Marinomonas sp. MWYL1]
          Length = 417

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 79/102 (77%), Gaps = 1/102 (0%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +K+ DFGVPQ R+R+YI+ + +  ++ F +P  +G+  R+GDILE + + K TIS++LWE
Sbjct: 255 LKSVDFGVPQNRQRIYIVLWKDGEIDKFDYPESMGLDTRVGDILEANPNPKLTISDRLWE 314

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           GHQ+RK  NKI GKGFGYG+  E+S  TNT+SARYYKDGSE+
Sbjct: 315 GHQRRKMQNKINGKGFGYGIVTEDSPYTNTISARYYKDGSEV 356


>gi|262402975|ref|ZP_06079535.1| DNA-methyltransferase MKpn2kI [Vibrio sp. RC586]
 gi|262350474|gb|EEY99607.1| DNA-methyltransferase MKpn2kI [Vibrio sp. RC586]
          Length = 410

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 71/118 (60%), Gaps = 17/118 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-------FKFPTPLGIKPRLGDILEEHI------ 47
           ++A DFGVPQ RER++I+ F             F +P       R+GDILE         
Sbjct: 216 LRAADFGVPQNRERIFIVGFDKNYFRGVNFDSLFSWPEAPKTPTRVGDILEPQHVLDEEK 275

Query: 48  ----DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                D+ TIS+KLW+GH+KRKE +KI G GFGY LF  +S  TNT+SARYYKDGSEI
Sbjct: 276 QALGKDRYTISDKLWDGHKKRKEEHKIKGNGFGYSLFNADSEYTNTISARYYKDGSEI 333


>gi|124024750|ref|YP_001013866.1| site-specific DNA methylase [Prochlorococcus marinus str. NATL1A]
 gi|123959818|gb|ABM74601.1| Site-specific DNA methylase [Prochlorococcus marinus str. NATL1A]
          Length = 305

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 50/101 (49%), Positives = 75/101 (74%), Gaps = 1/101 (0%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ RER++I  ++   + F+FP P  ++ ++GDIL++++ DK T+S+K+W  
Sbjct: 146 LNAKDFGVPQNRERIFIFGYI-DFIFFEFPEPSKVQTKVGDILDDNVPDKFTLSDKMWTN 204

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             +RKENN+  G GFG+ LF ++S  T+T+SARYYKDGSEI
Sbjct: 205 AIRRKENNRKRGYGFGFSLFDKDSEYTSTISARYYKDGSEI 245


>gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254547855|gb|ACT56990.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 101

 Score =  130 bits (326), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG
Sbjct: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI
Sbjct: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101


>gi|256760956|ref|ZP_05501536.1| type II restriction-modification system methylation subunit
           [Enterococcus faecalis T3]
 gi|256682207|gb|EEU21902.1| type II restriction-modification system methylation subunit
           [Enterococcus faecalis T3]
          Length = 405

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 58/104 (55%), Positives = 74/104 (71%), Gaps = 4/104 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           KA DFG PQ RER+YI+ F   S++    F+FPT    K  +GDILE+ +D+K TIS+ L
Sbjct: 237 KARDFGAPQNRERIYIVGFDKLSLKNIDLFEFPTAPKPKTCVGDILEDSVDEKYTISDTL 296

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           WEGH++RK  +K  G GFG+ LF  +S  TNT+SARYYKDGSEI
Sbjct: 297 WEGHKRRKLEHKEKGNGFGFSLFNSSSPYTNTISARYYKDGSEI 340


>gi|260554958|ref|ZP_05827179.1| DNA-methyltransferase MKpn2kI [Acinetobacter baumannii ATCC 19606]
 gi|260411500|gb|EEX04797.1| DNA-methyltransferase MKpn2kI [Acinetobacter baumannii ATCC 19606]
          Length = 413

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 72/114 (63%), Gaps = 13/114 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--------FKFPTPLGIKPRLGDILEEHIDDK-- 50
           ++A DFGVPQ RER++++ F              F +P P   + RLGDILE+    K  
Sbjct: 222 LRAADFGVPQNRERIFLVGFDKNYFGEECNFDQLFSWPVPPKKQTRLGDILEDVSKLKKS 281

Query: 51  ---STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
               TIS++LW+GHQ+RKE + I G GFGY L+  +S  TNTLSARYYKDGSEI
Sbjct: 282 EDVYTISDRLWQGHQRRKEEHGIKGNGFGYTLYTGDSPYTNTLSARYYKDGSEI 335


>gi|325989685|ref|YP_004249384.1| cytosine-specific methyltransferase [Mycoplasma suis KI3806]
 gi|323574770|emb|CBZ40430.1| Cytosine-specific methyltransferase [Mycoplasma suis]
          Length = 326

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 57/105 (54%), Positives = 77/105 (73%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +K+ DFG+PQ RER+YI+ F    V     F  P+P      +GDILE+ +++K TIS+ 
Sbjct: 160 LKSRDFGIPQNRERIYIVGFNKDLVESYENFSMPSPTLKATCVGDILEKEVNNKYTISDL 219

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LWEGH++RKE +K+ G+GFG+ LF ENS+ TNT+SARYYKDGSEI
Sbjct: 220 LWEGHKRRKEEHKLKGRGFGFSLFSENSSYTNTISARYYKDGSEI 264


>gi|325973250|ref|YP_004250314.1| cytosine-specific DNA modification methylase, HpaII-like protein
           [Mycoplasma suis str. Illinois]
 gi|323651852|gb|ADX97934.1| cytosine-specific DNA modification methylase, HpaII-like protein
           [Mycoplasma suis str. Illinois]
          Length = 326

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 57/105 (54%), Positives = 77/105 (73%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +K+ DFG+PQ RER+YI+ F    V     F  P+P      +GDILE+ +++K TIS+ 
Sbjct: 160 LKSRDFGIPQNRERIYIVGFNKDLVESYENFSMPSPTLKATCVGDILEKEVNNKYTISDL 219

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LWEGH++RKE +K+ G+GFG+ LF ENS+ TNT+SARYYKDGSEI
Sbjct: 220 LWEGHKRRKEEHKLKGRGFGFSLFSENSSYTNTISARYYKDGSEI 264


>gi|319893523|ref|YP_004150398.1| DNA-cytosine methyltransferase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317163219|gb|ADV06762.1| DNA-cytosine methyltransferase [Staphylococcus pseudintermedius
           HKU10-03]
          Length = 394

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/105 (52%), Positives = 73/105 (69%), Gaps = 4/105 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +KA DFGVPQ RER+YI+ F    +    ++  P P   +  LG ILE+++D+K TIS+K
Sbjct: 227 LKAKDFGVPQNRERIYIVGFDKRRIKKWRDYIPPKPPKSQTLLGKILEKNVDEKYTISDK 286

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW GH++RK  +K+ G GFG+ L+   S  TNTLSARYYKDGSEI
Sbjct: 287 LWSGHKRRKAEHKLKGNGFGFTLYNGESPYTNTLSARYYKDGSEI 331


>gi|462657|sp|P34877|MTSA_LACLC RecName: Full=Modification methylase ScrFIA; Short=M.ScrFI-A;
           Short=M.ScrFIA; AltName: Full=Cytosine-specific
           methyltransferase ScrFIA
 gi|149493|gb|AAA25220.1| SCRFI methylase [Lactococcus lactis]
 gi|2327034|gb|AAB66696.1| 5-methyl-cytosine methyltransferase [Lactococcus lactis subsp.
           cremoris]
          Length = 389

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 65/104 (62%), Positives = 79/104 (75%), Gaps = 4/104 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           KA DFG+PQ RER+YI+ F   S+    +F+ PTPL  K R+G+ILE  +DDK TIS+KL
Sbjct: 221 KARDFGLPQNRERIYIVGFDRKSISNYSDFQMPTPLQEKTRVGNILESVVDDKYTISDKL 280

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           W+GHQ+RK  NK  GKGFGY LF ++S  TNTLSARYYKDGSEI
Sbjct: 281 WDGHQRRKTENKKNGKGFGYTLFNQDSEYTNTLSARYYKDGSEI 324


>gi|229530048|ref|ZP_04419438.1| type II restriction-modification system methylation subunit [Vibrio
           cholerae 12129(1)]
 gi|229333822|gb|EEN99308.1| type II restriction-modification system methylation subunit [Vibrio
           cholerae 12129(1)]
          Length = 270

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 69/118 (58%), Gaps = 17/118 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-------FKFPTPLGIKPRLGDILEEHID----- 48
           ++A DFG PQ RER++II F             F +P       R+GDIL+   +     
Sbjct: 76  LRAADFGSPQNRERIFIIGFNKDEFPNIDFDKLFSWPKAPKTPTRVGDILQTQQELELDK 135

Query: 49  -----DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                D+ TIS+KLWEGHQKRK  +K  G GFGY LF  +S  TNT+SARYYKDGSEI
Sbjct: 136 KLHGKDRFTISDKLWEGHQKRKAEHKTKGNGFGYSLFNADSEYTNTISARYYKDGSEI 193


>gi|315931535|gb|EFV10502.1| DNA (cytosine-5) methyltransferase [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 284

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 57/106 (53%), Positives = 73/106 (68%), Gaps = 5/106 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FG+PQ RER+YI+ FL          F     + IK +LGDILE+++D+K TIS+
Sbjct: 151 LNARNFGIPQNRERIYIVAFLKNKFKNISFNFNELKNIEIKSKLGDILEKNVDEKYTISD 210

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW GHQ+RK  +K  G GFGY LF  NS  T+T+SARYYKDGSEI
Sbjct: 211 KLWAGHQRRKLEHKKKGNGFGYSLFNHNSDYTSTISARYYKDGSEI 256


>gi|157414453|ref|YP_001481709.1| hypothetical protein C8J_0133 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|283955585|ref|ZP_06373079.1| hypothetical protein C1336_000030018 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|157385417|gb|ABV51732.1| hypothetical protein C8J_0133 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|283792928|gb|EFC31703.1| hypothetical protein C1336_000030018 [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 321

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 57/106 (53%), Positives = 73/106 (68%), Gaps = 5/106 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FG+PQ RER+YI+ FL          F     + IK +LGDILE+++D+K TIS+
Sbjct: 151 LNARNFGIPQNRERIYIVAFLKNKFKNISFNFNELKNIEIKSKLGDILEKNVDEKYTISD 210

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW GHQ+RK  +K  G GFGY LF  NS  T+T+SARYYKDGSEI
Sbjct: 211 KLWAGHQRRKLEHKKKGNGFGYSLFNHNSDYTSTISARYYKDGSEI 256


>gi|308126237|ref|ZP_05908633.2| DNA (cytosine-5-)-methyltransferase [Vibrio parahaemolyticus
           AQ4037]
 gi|308107574|gb|EFO45114.1| DNA (cytosine-5-)-methyltransferase [Vibrio parahaemolyticus
           AQ4037]
          Length = 426

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 64/108 (59%), Gaps = 8/108 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-------FKFPTPLGIKPRLGDILEE-HIDDKST 52
           ++A DFG PQ RER+Y++ F             F+FP P     ++GDILE     D  T
Sbjct: 248 LRAADFGAPQNRERIYLVGFDKDYFGDLDFNSIFQFPEPTMKPTKVGDILETSDYVDSFT 307

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           IS+K+W  HQKRK  +K  G GFG+ L    +  TNT+SARYYKDGSE
Sbjct: 308 ISDKIWASHQKRKAGHKNKGNGFGFTLVNSETKYTNTISARYYKDGSE 355


>gi|317497297|ref|ZP_07955620.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316895366|gb|EFV17525.1| DNA-cytosine methyltransferase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 385

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 70/106 (66%), Gaps = 6/106 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-----VEFKFPT-PLGIKPRLGDILEEHIDDKSTIS 54
           + A  FG+PQ RER+ I+ F          +FK+P   +  K  +GDILE+ + ++ TIS
Sbjct: 213 LNAYHFGIPQNRERIIIVGFNKDYLPKKFKDFKYPVGKIDKKVCVGDILEKEVGERFTIS 272

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           +KLWEGHQ RK  +K  G GFG+ LF ++S  T+T+SARYYKDGSE
Sbjct: 273 DKLWEGHQARKRMHKKKGNGFGFCLFNKDSKYTSTISARYYKDGSE 318


>gi|17863973|gb|AAL46998.1|AF448250_2 putative C-5 cytosine-specific DNA methylase [Bacteroides coprosuis
           DSM 18011]
          Length = 401

 Score =  122 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 67/110 (60%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--------FKFPTPLGIKPRLGDILEEHI--DDK 50
           + A DFG PQ RER+YI+ F              F+FP P   K  + D+LE+    D  
Sbjct: 237 LNAKDFGSPQNRERIYIVGFNKNHFTKIDDFNEIFQFPEPSKEKVSVKDVLEKIPANDTI 296

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
            TIS ++W+GHQKRK  ++  G GFG+ LF ENS  TNT+SARYYKDGSE
Sbjct: 297 YTISERIWQGHQKRKLKHQNKGNGFGFSLFNENSEYTNTISARYYKDGSE 346


>gi|15677157|ref|NP_274310.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis MC58]
 gi|161870164|ref|YP_001599334.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis 053442]
 gi|218768314|ref|YP_002342826.1| putative modification methylase [Neisseria meningitidis Z2491]
 gi|7226530|gb|AAF41666.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis MC58]
 gi|121052322|emb|CAM08652.1| putative modification methylase [Neisseria meningitidis Z2491]
 gi|161595717|gb|ABX73377.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis 053442]
 gi|254670478|emb|CBA06174.1| putative DNA modification methylase [Neisseria meningitidis
           alpha153]
 gi|308389411|gb|ADO31731.1| C-5 cytosine-specific DNA-methylase [Neisseria meningitidis
           alpha710]
 gi|316984080|gb|EFV63058.1| modification methylase SsoII [Neisseria meningitidis H44/76]
 gi|319410559|emb|CBY90927.1| putative type II restriction-modification system enzyme Mod
           [Neisseria meningitidis WUE 2594]
 gi|325134466|gb|EGC57111.1| modification methylase EcoRII [Neisseria meningitidis M13399]
 gi|325136204|gb|EGC58812.1| modification methylase EcoRII [Neisseria meningitidis M0579]
 gi|325140483|gb|EGC63004.1| modification methylase EcoRII [Neisseria meningitidis CU385]
 gi|325144567|gb|EGC66866.1| modification methylase EcoRII [Neisseria meningitidis M01-240013]
 gi|325200082|gb|ADY95537.1| modification methylase EcoRII [Neisseria meningitidis H44/76]
 gi|325201996|gb|ADY97450.1| modification methylase EcoRII [Neisseria meningitidis M01-240149]
 gi|325205934|gb|ADZ01387.1| modification methylase EcoRII [Neisseria meningitidis M04-240196]
 gi|325208252|gb|ADZ03704.1| modification methylase EcoRII [Neisseria meningitidis NZ-05/33]
          Length = 337

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 63/105 (60%), Gaps = 6/105 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFL----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M A  + VPQ RER++I+ F     N  + F FP+P   +P+L  ILE+ +D+  T+S+ 
Sbjct: 171 MNAKYY-VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDN 229

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW   Q   + +K  G GFG+GL       + TLSARYYKDGSEI
Sbjct: 230 LWLYLQNYAKKHKAKGNGFGFGLVD-LDGISRTLSARYYKDGSEI 273


>gi|325130344|gb|EGC53110.1| modification methylase EcoRII [Neisseria meningitidis OX99.30304]
          Length = 337

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 63/105 (60%), Gaps = 6/105 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFL----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M A  + VPQ RER++I+ F     N  + F FP+P   +P+L  ILE+ +D+  T+S+ 
Sbjct: 171 MNAKYY-VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDN 229

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW   Q   + +K  G GFG+GL       + TLSARYYKDGSEI
Sbjct: 230 LWLYLQNYAKKHKAKGNGFGFGLVD-LDGISRTLSARYYKDGSEI 273


>gi|304387412|ref|ZP_07369603.1| modification methylase EcoRII [Neisseria meningitidis ATCC 13091]
 gi|304338505|gb|EFM04624.1| modification methylase EcoRII [Neisseria meningitidis ATCC 13091]
          Length = 336

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 46/105 (43%), Positives = 63/105 (60%), Gaps = 6/105 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFL----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M A  + VPQ RER++I+ F     N  + F FP+P   +P+L  ILE+ +D+  T+S+ 
Sbjct: 171 MNAKYY-VPQNRERIFIVGFDRQYFNKEINFNFPSPPESQPKLKQILEDDVDNSFTLSDN 229

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           LW   Q   + +K  G GFG+GL       + TLSARYYKDGSEI
Sbjct: 230 LWLYLQNYAKKHKAKGNGFGFGLVD-LDGISRTLSARYYKDGSEI 273


>gi|166368844|ref|YP_001661117.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
 gi|166091217|dbj|BAG05925.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
          Length = 338

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/94 (48%), Positives = 59/94 (62%), Gaps = 2/94 (2%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67
           VPQ R+R++I+ F  PS  F FP    I P++ DILE  +D K T+++ LW+  QK  + 
Sbjct: 158 VPQNRKRIFIVGFEKPS-RFMFPEIPDIHPKIKDILEGEVDSKYTLTDHLWDYLQKYADK 216

Query: 68  NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +K  G GFGYGL         TLSARYYKDGSEI
Sbjct: 217 HKEKGNGFGYGLVN-LEGIARTLSARYYKDGSEI 249


>gi|313158099|gb|EFR57504.1| putative DNA (cytosine-5-)-methyltransferase [Alistipes sp. HGB5]
          Length = 431

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 5/100 (5%)

Query: 6   FGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           + VPQ RER+ I+ F N       +FKFP    +  ++ +ILE  +D K T+++KLW   
Sbjct: 265 YFVPQHRERIMIVGFRNNLFHGVEKFKFPELKDVSHKIRNILEPEVDPKYTLTDKLWVYL 324

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q   + ++ +G GFG+GL         TLSARYYKDGSEI
Sbjct: 325 QNYAKKHQDSGNGFGFGLVD-LDGIARTLSARYYKDGSEI 363


>gi|66391578|ref|YP_239103.1| hypothetical protein RB43ORF127c [Enterobacteria phage RB43]
 gi|62288666|gb|AAX78649.1| hypothetical protein RB43ORF127c [Enterobacteria phage RB43]
          Length = 302

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/98 (48%), Positives = 65/98 (66%), Gaps = 2/98 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQRRER++I+ FL+    F FP P     R+GDIL E +DD  T+S+  W+G
Sbjct: 144 LNTKDFGLPQRRERVFIVCFLDDVF-FSFPVPPRTPTRVGDIL-EDVDDSYTLSDNAWKG 201

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
            ++RKE NK  GKGFGY     +S  T T++A+YYKDG
Sbjct: 202 FRERKERNKANGKGFGYQAVTADSTHTGTITAQYYKDG 239


>gi|304373674|ref|YP_003858419.1| putative DNA-methyltransferase, type II restriction-modification
           system [Enterobacteria phage RB16]
 gi|299829630|gb|ADJ55423.1| putative DNA-methyltransferase, type II restriction-modification
           system [Enterobacteria phage RB16]
          Length = 302

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 48/98 (48%), Positives = 64/98 (65%), Gaps = 2/98 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQRRER++I+ FL+    F FP P     R+GDIL E  DD  T+S+  W+G
Sbjct: 144 LNTKDFGLPQRRERVFIVCFLDDVF-FSFPVPPRTPTRVGDIL-EDADDSYTLSDNAWKG 201

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
            ++RKE NK  GKGFGY     +S  T T++A+YYKDG
Sbjct: 202 FRERKERNKANGKGFGYQAVTADSTHTGTITAQYYKDG 239


>gi|238922589|ref|YP_002936102.1| modification methylase [Eubacterium rectale ATCC 33656]
 gi|238874261|gb|ACR73968.1| modification methylase [Eubacterium rectale ATCC 33656]
          Length = 392

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 7/106 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFL----NPSVEFKFP-TPLGIKPRLGDILEEHIDDKSTISN 55
           +   +F VPQ RER+ I+ F        +EF F  TP+  KP + DILE+ +DDK T+S+
Sbjct: 214 LDGQNF-VPQHRERIIIVGFDMERYGDDIEFDFDITPVNPKPVMRDILEKKVDDKYTLSD 272

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            LW   Q     ++ AG GFGYG+       + T+SARY+KDGSEI
Sbjct: 273 NLWTYLQNYAAKHRAAGNGFGYGIA-PLDGVSRTISARYHKDGSEI 317


>gi|53714966|ref|YP_100958.1| C-5 cytosine-specific DNA-methylase [Bacteroides fragilis YCH46]
 gi|52217831|dbj|BAD50424.1| C-5 cytosine-specific DNA-methylase [Bacteroides fragilis YCH46]
          Length = 431

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 55/98 (56%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+ I+ F         +F FP        + +IL+  ID K T+S+KLW   Q 
Sbjct: 270 VPQHRERIMIVGFNQDVFHGKEQFAFPEQKQSTRSIKEILDPDIDGKYTLSDKLWSYLQN 329

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             E ++  G GFG+G+    +  + TLSARYYKDGSEI
Sbjct: 330 YAEKHRAKGNGFGFGMVD-LNGISRTLSARYYKDGSEI 366


>gi|237713924|ref|ZP_04544405.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. D1]
 gi|262409168|ref|ZP_06085712.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. 2_1_22]
 gi|229446080|gb|EEO51871.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. D1]
 gi|262352915|gb|EEZ02011.1| C-5 cytosine-specific DNA-methylase [Bacteroides sp. 2_1_22]
          Length = 361

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 56/98 (57%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+ I+ F         +F FP        + +ILE  IDDK T+S+KLW   Q 
Sbjct: 186 VPQHRERIMIVGFNREIFHGEEQFCFPEQKQSTRGIREILESDIDDKYTLSDKLWSYLQN 245

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             E ++  G GFG+G+    +  + TLSARYYKDGSEI
Sbjct: 246 YAEKHRAKGNGFGFGMVD-LNGISRTLSARYYKDGSEI 282


>gi|255262721|ref|ZP_05342063.1| cytosine-specific methyltransferase NlaX [Thalassiobium sp. R2A62]
 gi|255105056|gb|EET47730.1| cytosine-specific methyltransferase NlaX [Thalassiobium sp. R2A62]
          Length = 421

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 65/114 (57%), Gaps = 13/114 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE----FKFP-------TPLGIKPRLGDILEEH--I 47
           + A +FGVPQ RER+YI+ F    V        P            + RLGD+LE +  +
Sbjct: 243 LAAKNFGVPQNRERVYIVGFDRDQVSEAEARDLPREILDGLKERKSETRLGDVLETNASV 302

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           D K TIS++L  GH++R   ++  G GFG+ LF   S   NT+SARYYKDGSE+
Sbjct: 303 DPKFTISDRLLAGHERRLRAHRAKGNGFGFSLFNAESPYCNTISARYYKDGSEV 356


>gi|294646710|ref|ZP_06724334.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a]
 gi|294807186|ref|ZP_06766001.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD
           CC 1b]
 gi|292637950|gb|EFF56344.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CC 2a]
 gi|294445609|gb|EFG14261.1| DNA (cytosine-5-)-methyltransferase [Bacteroides xylanisolvens SD
           CC 1b]
          Length = 445

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 56/98 (57%), Gaps = 5/98 (5%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+ I+ F         +F FP        + +ILE  IDDK T+S+KLW   Q 
Sbjct: 270 VPQHRERIMIVGFNREIFHGEEQFCFPEQKQSTRGIREILESDIDDKYTLSDKLWSYLQN 329

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             E ++  G GFG+G+    +  + TLSARYYKDGSEI
Sbjct: 330 YAEKHRAKGNGFGFGMVD-LNGISRTLSARYYKDGSEI 366


>gi|210631776|ref|ZP_03297018.1| hypothetical protein COLSTE_00903 [Collinsella stercoris DSM 13279]
 gi|210159896|gb|EEA90867.1| hypothetical protein COLSTE_00903 [Collinsella stercoris DSM 13279]
          Length = 390

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/103 (40%), Positives = 60/103 (58%), Gaps = 5/103 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEHIDDKSTISNKLW 58
           + +  +   Q RER+YI+ F +  V+F +          +  +ILE  +DD+  +S+KLW
Sbjct: 223 LDSKGW-TCQHRERIYIVGFRDD-VDFSWDDLDCPQNGQKAAEILETDVDDRYVLSDKLW 280

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              +  K  ++ AG GFGYGL    S TT TLSARY+KDGSEI
Sbjct: 281 SYLKAYKAKHEAAGNGFGYGLITP-SDTTRTLSARYHKDGSEI 322


>gi|294661528|ref|YP_003579981.1| hypothetical protein KP-KP15_gp115 [Klebsiella phage KP15]
 gi|292660689|gb|ADE34937.1| hypothetical protein [Klebsiella phage KP15]
          Length = 308

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/98 (50%), Positives = 63/98 (64%), Gaps = 2/98 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           M   DFG+PQRRER++I+ F    V F FP P     R+GDILE   D   TIS++ W+G
Sbjct: 144 MNTKDFGLPQRRERVFIVCFR-DPVFFSFPVPPRTPTRVGDILEPDNDQ-YTISDRAWKG 201

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
            ++RKE NK  GKGFGY     +S  T T++A+YYKDG
Sbjct: 202 FRERKELNKANGKGFGYQAVTVDSVCTGTITAQYYKDG 239


>gi|238783073|ref|ZP_04627100.1| Modification methylase EcoRII [Yersinia bercovieri ATCC 43970]
 gi|238716074|gb|EEQ08059.1| Modification methylase EcoRII [Yersinia bercovieri ATCC 43970]
          Length = 475

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 10/109 (9%)

Query: 2   KACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLG----IKPRLGDILEEHIDDKSTIS 54
              +F +PQ RER+ ++ F        +F            +P  G++LE  +DDK  ++
Sbjct: 276 DGKNF-LPQHRERIVLVGFRKDLNIDKDFTLKDIHKFFPEKRPTFGELLEPVVDDKYILT 334

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
             LW+      + ++  G GFG+GL     + +   TLSARY+KDGSEI
Sbjct: 335 PHLWKYLYNYAKKHQAKGNGFGFGLVDPTNSDSVARTLSARYHKDGSEI 383


>gi|163732386|ref|ZP_02139832.1| hypothetical protein RLO149_03007 [Roseobacter litoralis Och 149]
 gi|161394684|gb|EDQ19007.1| hypothetical protein RLO149_03007 [Roseobacter litoralis Och 149]
          Length = 410

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 57/121 (47%), Gaps = 23/121 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEH----------- 46
           + A  F VPQ RER+ I+ F      F F     P   + R+ DIL              
Sbjct: 216 IDAAHF-VPQHRERIVIVGFREDVP-FSFDDVILPPHRERRMRDILHPENGNENPESHFT 273

Query: 47  ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
                 +  K T+S+KLW+  Q     +K  G GFG+GL   +S    TLSARYYKDGSE
Sbjct: 274 LGNDAAVSGKYTLSDKLWKYLQDYAAKHKAKGNGFGFGLVDGDS-IARTLSARYYKDGSE 332

Query: 101 I 101
           I
Sbjct: 333 I 333


>gi|323486195|ref|ZP_08091524.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14163]
 gi|323400521|gb|EGA92890.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14163]
          Length = 382

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 63/106 (59%), Gaps = 7/106 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP----SVEFKF-PTPLGIKPRLGDILEEHIDDKSTISN 55
           +   +F VPQ RER+ I+ F        ++F F  TP   KP + DIL++ +D+K T+S+
Sbjct: 204 LDGQNF-VPQHRERIIIVGFDRERYGQDIKFDFEITPAIPKPVMKDILDKKVDEKYTLSD 262

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW   Q     +K AG GFGYG+       + T+SARYYKDGSEI
Sbjct: 263 KLWIYLQSYAAKHKAAGNGFGYGIA-PLDGVSRTISARYYKDGSEI 307


>gi|312898460|ref|ZP_07757850.1| DNA (cytosine-5-)-methyltransferase [Megasphaera micronuciformis
           F0359]
 gi|310620379|gb|EFQ03949.1| DNA (cytosine-5-)-methyltransferase [Megasphaera micronuciformis
           F0359]
          Length = 400

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 7/106 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP----SVEFKF-PTPLGIKPRLGDILEEHIDDKSTISN 55
           +   ++ VPQ RER+ I+ F        + F+F   P+  KP +  ILE  +DDK T+++
Sbjct: 202 LDGQNY-VPQHRERILIVGFDRKRYGRDIGFRFSIAPVNPKPAIKAILETKVDDKYTLTD 260

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           KLW   Q     ++ AG GFGYG+   N   + TLSARYYKDGSEI
Sbjct: 261 KLWTYLQNYAAKHRAAGNGFGYGIADPN-GVSRTLSARYYKDGSEI 305


>gi|118576810|ref|YP_876553.1| C-5 cytosine-specific DNA methylase [Cenarchaeum symbiosum A]
 gi|118195331|gb|ABK78249.1| C-5 cytosine-specific DNA methylase [Cenarchaeum symbiosum A]
          Length = 325

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 44/94 (46%), Positives = 55/94 (58%), Gaps = 2/94 (2%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67
           VPQ RERL+I+ F    VEF+FP     KPRL DILE     +  ++  +W   ++ KE 
Sbjct: 159 VPQHRERLFIVGFDRE-VEFEFPKMKNAKPRLRDILEPDPGSEYVLTPGVWAALKRHKEA 217

Query: 68  NKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  G GFGYG+       T TLS RYYKDGSEI
Sbjct: 218 CRARGAGFGYGIADP-DGVTRTLSRRYYKDGSEI 250


>gi|237725529|ref|ZP_04556010.1| DNA (cytosine-5-)-methyltransferase [Bacteroides sp. D4]
 gi|229436216|gb|EEO46293.1| DNA (cytosine-5-)-methyltransferase [Bacteroides dorei 5_1_36/D4]
          Length = 374

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 69/123 (56%), Gaps = 22/123 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFP-------------------TPLGIKPR 38
           + A  FGVPQ RERL+I+ +    V+   FKFP                     +  K  
Sbjct: 166 LNAKYFGVPQNRERLFIVAWYKDIVKATTFKFPYGIAPDGSTIYEKSKDLGDKVIKTKVS 225

Query: 39  LGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
                E+ ID   TIS++LW GHQ+RK+ NK  GKGFGY LF ENS  ++T+SARY+KDG
Sbjct: 226 DIFEPEDSIDSYYTISDRLWIGHQERKKRNKANGKGFGYSLFNENSVYSSTISARYWKDG 285

Query: 99  SEI 101
           SEI
Sbjct: 286 SEI 288


>gi|296103580|ref|YP_003613726.1| DNA cytosine methylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058039|gb|ADF62777.1| DNA cytosine methylase [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 471

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 9/105 (8%)

Query: 6   FGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLW 58
           + +PQ RER+ ++ F        +F       + P     + D+LE  +D K  ++  LW
Sbjct: 269 YFLPQHRERIVLVGFRRDLNLKGDFTLRDIPSLYPARRPSVADLLEPAVDAKFILTPVLW 328

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +   +  + ++  G GFG+GL   N     T TLSARYYKDG+EI
Sbjct: 329 KYLYRYAKKHQAKGNGFGFGLVNPNDPHCVTRTLSARYYKDGAEI 373


>gi|260909972|ref|ZP_05916659.1| modification methylase EcoRII [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260635922|gb|EEX53925.1| modification methylase EcoRII [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 370

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 52/121 (42%), Positives = 71/121 (58%), Gaps = 20/121 (16%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFP----------------TPLGIKPRLGD 41
           + A  FGVPQ RERL+II +    V+   FKFP                    I  ++ +
Sbjct: 166 LNAKYFGVPQNRERLFIIAWNRELVDVDCFKFPYGIAIDGTSIYEKRKLKGRTIPTKVSE 225

Query: 42  IL-EEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           I   +++    TI++++WEGH+ RKE NK+ GKGFGY LF  NS  T+T+SARY+KDGSE
Sbjct: 226 IFEPDNVTTPFTITDRMWEGHKTRKERNKMNGKGFGYSLFNANSEYTSTISARYWKDGSE 285

Query: 101 I 101
           I
Sbjct: 286 I 286


>gi|228469904|ref|ZP_04054843.1| cytosine-specific methyltransferase NlaX [Porphyromonas uenonis
           60-3]
 gi|228308539|gb|EEK17327.1| cytosine-specific methyltransferase NlaX [Porphyromonas uenonis
           60-3]
          Length = 395

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 68/122 (55%), Gaps = 21/122 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFP----------------TPLGIKPRLGD 41
           + A  FGVPQ RERL+I+ +    +    F FP                    I+ ++ D
Sbjct: 188 LNAKYFGVPQNRERLFIVAWSKDLISADRFLFPYGIDAEGNTIYDKQMAKRCAIRTKVSD 247

Query: 42  ILEEHIDDK--STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99
           I E    ++   TIS+++W GHQ RK+ N++ GKGFGY  F  NS  T+T+SARY+KDGS
Sbjct: 248 IFEPQSIERDGFTISDRMWLGHQTRKKRNRLNGKGFGYSKFTGNSVYTSTISARYWKDGS 307

Query: 100 EI 101
           EI
Sbjct: 308 EI 309


>gi|261340425|ref|ZP_05968283.1| DNA (cytosine-5-)-methyltransferase [Enterobacter cancerogenus ATCC
           35316]
 gi|288317516|gb|EFC56454.1| DNA (cytosine-5-)-methyltransferase [Enterobacter cancerogenus ATCC
           35316]
          Length = 477

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F       + P     + D+LE  +D K  +
Sbjct: 271 IDGKHF-LPQHRERIVLVGFRRDLNLMGDFTLRNLPALYPARRPTIADLLEPAVDAKFIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFG+G+   N     T TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYAKKHQAKGNGFGFGMVNPNDPHSVTRTLSARYYKDGAEI 379


>gi|161505003|ref|YP_001572115.1| DNA cytosine methylase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160866350|gb|ABX22973.1| hypothetical protein SARI_03133 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 474

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLG----IKPRLGDILEEHIDDKSTI 53
           +   +F +PQ RER+ ++ F         F            +P  G +L+  +D K  +
Sbjct: 275 IDGKNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIHKFYPEKRPTFGQLLDPAVDSKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           S KLWE      + +   G GFG+GL   N+      TLSARY+KDGSEI
Sbjct: 334 SPKLWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|157147667|ref|YP_001454986.1| DNA cytosine methylase [Citrobacter koseri ATCC BAA-895]
 gi|157084872|gb|ABV14550.1| hypothetical protein CKO_03470 [Citrobacter koseri ATCC BAA-895]
          Length = 474

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLG----IKPRLGDILEEHIDDKSTI 53
           +   +F +PQ RER+ ++ F         F            +P  G +L+  +D K  +
Sbjct: 275 IDGKNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIHKFYPEKRPTFGQLLDPAVDSKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           S KLWE      + +   G GFG+GL   N+      TLSARY+KDGSEI
Sbjct: 334 SPKLWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|85709931|ref|ZP_01040996.1| Type II restriction-modification system methylation subunit
           [Erythrobacter sp. NAP1]
 gi|85688641|gb|EAQ28645.1| Type II restriction-modification system methylation subunit
           [Erythrobacter sp. NAP1]
          Length = 370

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/111 (38%), Positives = 60/111 (54%), Gaps = 10/111 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-------FKFPTPLGIKPRLGDILEEHIDD---K 50
           + A +FGVPQ+RER+YI+ F             F      G   RLGD LE    +   +
Sbjct: 184 LAATEFGVPQKRERVYIVGFDRDHFGNIDANDVFAQLERGGHPTRLGDALEPEGANSLAR 243

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            TIS+KLW G  +R   ++  G GFG+ +F  +    NT+++RYYKDG EI
Sbjct: 244 YTISDKLWSGLIRRMARHEAKGNGFGHKVFNYDDPYCNTITSRYYKDGREI 294


>gi|157368818|ref|YP_001476807.1| DNA cytosine methylase [Serratia proteamaculans 568]
 gi|157320582|gb|ABV39679.1| DNA-cytosine methyltransferase [Serratia proteamaculans 568]
          Length = 491

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 56/113 (49%), Gaps = 16/113 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFK-------FPTPLGIKPRLGDILEEHIDDK 50
           +   +F +PQ RER+ ++ F        +F        FP     +P  G++L E +  K
Sbjct: 291 IDGKNF-LPQHRERIVLVGFRRDLNIHGDFSLKNLSQFFPK---KRPSFGELLLEDVAPK 346

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
             ++  LW+      + ++  G GFG+GL      S+   TLSARY+KDGSEI
Sbjct: 347 YILTEHLWKYLYNYAKKHQAKGNGFGFGLVNPKNESSVARTLSARYHKDGSEI 399


>gi|168234623|ref|ZP_02659681.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194736513|ref|YP_002117411.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|194712015|gb|ACF91236.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197291717|gb|EDY31067.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 474

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 57/113 (50%), Gaps = 16/113 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP----------SVEFKFPTPLGIKPRLGDILEEHIDDK 50
           +   +F +PQ RER+ ++ F             +++  +P     +P  G +L+  +D K
Sbjct: 275 IDGKNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIDKFYPE---KRPTFGQLLDSVVDSK 330

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +S KLWE      + +   G GFG+GL   N+      TLSARY+KDGSEI
Sbjct: 331 YILSPKLWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|161617789|ref|YP_001591754.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|161367153|gb|ABX70921.1| hypothetical protein SPAB_05653 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 474

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 57/113 (50%), Gaps = 16/113 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP----------SVEFKFPTPLGIKPRLGDILEEHIDDK 50
           +   +F +PQ RER+ ++ F             +++  +P     +P  G +L+  +D K
Sbjct: 275 IDGKNF-LPQHRERIVLVGFRRDLNIHQGFTLKNIDKFYPE---KRPTFGQLLDSVVDSK 330

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +S KLWE      + +   G GFG+GL   N+      TLSARY+KDGSEI
Sbjct: 331 YILSPKLWEYLYNYAKKHAAKGNGFGFGLVDPNNENSVARTLSARYHKDGSEI 383


>gi|239621327|ref|ZP_04664358.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|239515788|gb|EEQ55655.1| DNA-cytosine methyltransferase [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 343

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPL-GIKPRLGDILEEHIDDKSTISNKLW 58
           + A  F VPQ RER YI+ F   +   F    P+         +    + DK  +S+KLW
Sbjct: 179 IDAAGF-VPQHRERTYIVGFREENGFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKLW 237

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 238 TYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 280


>gi|133756232|ref|YP_001096382.1| DNA cytosine methylase [Escherichia coli]
 gi|110084067|gb|ABG49221.1| hypothetical protein [Escherichia coli]
          Length = 566

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 364 IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYIL 422

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 423 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 472


>gi|23466029|ref|NP_696632.1| modification methylase very EcoRII
           (cytosine-specificmethyltransferase [Bifidobacterium
           longum NCC2705]
 gi|23326750|gb|AAN25268.1| modification methylase very similar to EcoRII
           (cytosine-specificmethyltransferase [Bifidobacterium
           longum NCC2705]
          Length = 323

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPL-GIKPRLGDILEEHIDDKSTISNKLW 58
           + A  F VPQ RER YI+ F   +   F    P+         +    + DK  +S+KLW
Sbjct: 159 IDAAGF-VPQHRERTYIVGFREENGFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKLW 217

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 218 TYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 260


>gi|189439219|ref|YP_001954300.1| site-specific DNA methylase [Bifidobacterium longum DJO10A]
 gi|189427654|gb|ACD97802.1| Site-specific DNA methylase [Bifidobacterium longum DJO10A]
          Length = 323

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPL-GIKPRLGDILEEHIDDKSTISNKLW 58
           + A  F VPQ RER YI+ F   +   F    P+         +    + DK  +S+KLW
Sbjct: 159 IDAAGF-VPQHRERTYIVGFREENGFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKLW 217

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 218 TYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 260


>gi|215487159|ref|YP_002329590.1| DNA cytosine methylase [Escherichia coli O127:H6 str. E2348/69]
 gi|312967158|ref|ZP_07781376.1| DNA-cytosine methyltransferase [Escherichia coli 2362-75]
 gi|215265231|emb|CAS09622.1| DNA cytosine methylase [Escherichia coli O127:H6 str. E2348/69]
 gi|312288622|gb|EFR16524.1| DNA-cytosine methyltransferase [Escherichia coli 2362-75]
          Length = 472

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|46191283|ref|ZP_00120453.2| COG0270: Site-specific DNA methylase [Bifidobacterium longum
           DJO10A]
          Length = 315

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/103 (39%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPL-GIKPRLGDILEEHIDDKSTISNKLW 58
           + A  F VPQ RER YI+ F   +   F    P+         +    + DK  +S+KLW
Sbjct: 151 IDAAGF-VPQHRERTYIVGFREENGFTFDDVKPIAHGNVGSILLPASQVPDKYVLSDKLW 209

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              Q  K+ ++ AG GFGYG+    +  T TLSARY KDGSEI
Sbjct: 210 TYLQNYKKKHEAAGNGFGYGMVDAATDHTRTLSARYGKDGSEI 252


>gi|323186716|gb|EFZ72038.1| DNA-cytosine methyltransferase [Escherichia coli RN587/1]
          Length = 472

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|295098276|emb|CBK87366.1| DNA-methyltransferase (dcm) [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 477

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F       + P     + D+LE  +D K  +
Sbjct: 271 IDGKHF-LPQHRERIVLVGFRRDLNLKGDFTLRDLPSLYPARRPTVADLLEPAVDAKFIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFG+G+       + T TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYAKKHQAKGNGFGFGMVNPLNPDSVTRTLSARYYKDGAEI 379


>gi|94501925|ref|ZP_01308434.1| DNA-cytosine methyltransferase [Oceanobacter sp. RED65]
 gi|94425919|gb|EAT10918.1| DNA-cytosine methyltransferase [Oceanobacter sp. RED65]
          Length = 287

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 58/109 (53%), Gaps = 10/109 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EF---KFPTPLGIKPRLGDILEEHIDDKSTIS 54
           +   +F +PQ RER+ ++ F         F     P P    P L  +LE+ +D+K  ++
Sbjct: 88  IDGANF-LPQHRERIVLVGFRKDLNLTNRFTLTNLPKPRE-VPSLSSLLEKSVDEKYVLT 145

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
            +LWE   +  + ++  G GFGYGL    ++     TLSARY+KDGSEI
Sbjct: 146 PRLWEYLYEYAKKHQAKGNGFGYGLVDPKNSSAVCRTLSARYHKDGSEI 194


>gi|260855934|ref|YP_003229825.1| DNA cytosine methylase [Escherichia coli O26:H11 str. 11368]
 gi|300822269|ref|ZP_07102410.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7]
 gi|257754583|dbj|BAI26085.1| DNA cytosine methylase [Escherichia coli O26:H11 str. 11368]
 gi|300525152|gb|EFK46221.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 119-7]
 gi|309702249|emb|CBJ01566.1| DNA-cytosine methyltransferase [Escherichia coli ETEC H10407]
 gi|323937230|gb|EGB33510.1| DNA-cytosine methyltransferase [Escherichia coli E1520]
          Length = 472

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323977859|gb|EGB72945.1| DNA-cytosine methyltransferase [Escherichia coli TW10509]
          Length = 472

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLREISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323968376|gb|EGB63783.1| DNA-cytosine methyltransferase [Escherichia coli M863]
 gi|327253092|gb|EGE64746.1| DNA-cytosine methyltransferase [Escherichia coli STEC_7v]
          Length = 472

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLREISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323962004|gb|EGB57603.1| DNA-cytosine methyltransferase [Escherichia coli H489]
          Length = 472

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|301018179|ref|ZP_07182696.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1]
 gi|300399832|gb|EFJ83370.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 69-1]
          Length = 472

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300994233|ref|ZP_07180788.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1]
 gi|300304943|gb|EFJ59463.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 200-1]
          Length = 477

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 271 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|218695565|ref|YP_002403232.1| DNA cytosine methylase [Escherichia coli 55989]
 gi|256022383|ref|ZP_05436248.1| DNA cytosine methylase [Escherichia sp. 4_1_40B]
 gi|218352297|emb|CAU98056.1| DNA cytosine methylase [Escherichia coli 55989]
 gi|323972739|gb|EGB67939.1| DNA-cytosine methyltransferase [Escherichia coli TA007]
 gi|332343686|gb|AEE57020.1| DNA-cytosine methyltransferase [Escherichia coli UMNK88]
          Length = 472

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F      G  P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|218705454|ref|YP_002412973.1| DNA cytosine methylase [Escherichia coli UMN026]
 gi|293405443|ref|ZP_06649435.1| DNA cytosine methylase [Escherichia coli FVEC1412]
 gi|298381087|ref|ZP_06990686.1| DNA cytosine methylase [Escherichia coli FVEC1302]
 gi|218432551|emb|CAR13444.1| DNA cytosine methylase [Escherichia coli UMN026]
 gi|291427651|gb|EFF00678.1| DNA cytosine methylase [Escherichia coli FVEC1412]
 gi|298278529|gb|EFI20043.1| DNA cytosine methylase [Escherichia coli FVEC1302]
          Length = 472

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|238787820|ref|ZP_04631617.1| Modification methylase EcoRII [Yersinia frederiksenii ATCC 33641]
 gi|238724163|gb|EEQ15806.1| Modification methylase EcoRII [Yersinia frederiksenii ATCC 33641]
          Length = 475

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +   +F +PQ RER+ ++ F        +F            +P  G++LE  + DK  +
Sbjct: 275 IDGKNF-LPQHRERIVLVGFRKDLNIDKDFTLKDINKFFPEKRPEFGELLESVVADKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+      + ++  G GFG+GL    ++     TLSARY+KDGSEI
Sbjct: 334 TPHLWKYLYNYAKKHQAKGNGFGFGLVDPTNSESVARTLSARYHKDGSEI 383


>gi|309795932|ref|ZP_07690345.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7]
 gi|308120382|gb|EFO57644.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 145-7]
          Length = 472

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|301029418|ref|ZP_07192512.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1]
 gi|299877722|gb|EFI85933.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 196-1]
          Length = 476

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F      G  P     L  +L+  ++ K  +
Sbjct: 270 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYIL 328

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 329 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378


>gi|291283137|ref|YP_003499955.1| DNA-cytosine methyltransferase [Escherichia coli O55:H7 str.
           CB9615]
 gi|209766674|gb|ACI81649.1| DNA cytosine methylase [Escherichia coli]
 gi|290763010|gb|ADD56971.1| DNA-cytosine methyltransferase [Escherichia coli O55:H7 str.
           CB9615]
          Length = 472

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|167035739|ref|YP_001670970.1| DNA cytosine methylase [Pseudomonas putida GB-1]
 gi|166862227|gb|ABZ00635.1| DNA-cytosine methyltransferase [Pseudomonas putida GB-1]
          Length = 447

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 42/103 (40%), Positives = 55/103 (53%), Gaps = 8/103 (7%)

Query: 6   FGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58
           +  PQ RER+ ++ F         F            +P LGDIL+E +DDK  ++ KLW
Sbjct: 259 YFTPQHRERIVLVGFRKDLGVHSGFTLKDIAELFPKKRPALGDILDEKVDDKYILTPKLW 318

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +        +K  G GFG+GL    S+ T TLSARYYKDGSEI
Sbjct: 319 QYLFNYAIKHKAKGNGFGFGLV-GKSSVTRTLSARYYKDGSEI 360


>gi|330911766|gb|EGH40276.1| DNA-cytosine methyltransferase [Escherichia coli AA86]
          Length = 472

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|74312499|ref|YP_310918.1| DNA cytosine methylase [Shigella sonnei Ss046]
 gi|73855976|gb|AAZ88683.1| DNA cytosine methylase [Shigella sonnei Ss046]
 gi|323168918|gb|EFZ54598.1| DNA-cytosine methyltransferase [Shigella sonnei 53G]
          Length = 472

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|194430436|ref|ZP_03062919.1| DNA-cytosine methyltransferase [Escherichia coli B171]
 gi|194411515|gb|EDX27854.1| DNA-cytosine methyltransferase [Escherichia coli B171]
          Length = 472

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQCVTRTLSARYYKDGAEI 374


>gi|300975476|ref|ZP_07173024.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1]
 gi|300410366|gb|EFJ93904.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 45-1]
          Length = 472

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|297622183|ref|YP_003675732.1| EcoRII cytosine-methyltransferase [Klebsiella oxytoca KOX105]
 gi|296492002|gb|ADH29504.1| EcoRII cytosine-methyltransferase [Klebsiella oxytoca KOX105]
          Length = 491

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 289 IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYIL 347

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 348 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397


>gi|24113334|ref|NP_707844.1| DNA cytosine methylase [Shigella flexneri 2a str. 301]
 gi|30063396|ref|NP_837567.1| DNA cytosine methylase [Shigella flexneri 2a str. 2457T]
 gi|110805927|ref|YP_689447.1| DNA cytosine methylase [Shigella flexneri 5 str. 8401]
 gi|24052347|gb|AAN43551.1| DNA cytosine methylase [Shigella flexneri 2a str. 301]
 gi|30041648|gb|AAP17376.1| DNA cytosine methylase [Shigella flexneri 2a str. 2457T]
 gi|110615475|gb|ABF04142.1| DNA cytosine methylase [Shigella flexneri 5 str. 8401]
 gi|281601397|gb|ADA74381.1| Cytosine-specific methyltransferase [Shigella flexneri 2002017]
 gi|313650184|gb|EFS14597.1| DNA-cytosine methyltransferase [Shigella flexneri 2a str. 2457T]
 gi|332756118|gb|EGJ86471.1| DNA-cytosine methyltransferase [Shigella flexneri 4343-70]
 gi|332757312|gb|EGJ87649.1| DNA-cytosine methyltransferase [Shigella flexneri 2747-71]
 gi|332757528|gb|EGJ87863.1| DNA-cytosine methyltransferase [Shigella flexneri K-671]
 gi|332766700|gb|EGJ96904.1| cytosine-specific methyltransferase [Shigella flexneri 2930-71]
 gi|333003060|gb|EGK22614.1| DNA-cytosine methyltransferase [Shigella flexneri VA-6]
 gi|333003307|gb|EGK22853.1| DNA-cytosine methyltransferase [Shigella flexneri K-218]
 gi|333004068|gb|EGK23602.1| DNA-cytosine methyltransferase [Shigella flexneri K-272]
 gi|333017687|gb|EGK36999.1| DNA-cytosine methyltransferase [Shigella flexneri K-304]
 gi|333017841|gb|EGK37148.1| DNA-cytosine methyltransferase [Shigella flexneri K-227]
          Length = 472

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|323191533|gb|EFZ76794.1| modification methylase EcoRII [Escherichia coli RN587/1]
          Length = 474

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F            +P  G++L+ ++DDK  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHNVDDKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           + +LWE      + +   G GFG+GL       +   TLSARY+KDGSEI
Sbjct: 334 TPRLWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|37524351|ref|NP_927695.1| DNA cytosine methylase [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|36783775|emb|CAE12633.1| DNA-cytosine methyltransferase [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 478

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 52/105 (49%), Gaps = 9/105 (8%)

Query: 6   FGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLW 58
           + +PQ RER+ ++ F         F            +P L D+LE  +D K  ++  LW
Sbjct: 279 YFLPQHRERIVLVGFRKDLNIHQGFTLRDISRYFPKERPTLADLLEPEVDSKYILTPNLW 338

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           +        ++  G GFG+GL   N   + T TLSARY+KDGSEI
Sbjct: 339 KYLYNYARKHQAKGNGFGFGLIDPNNKDSVTRTLSARYHKDGSEI 383


>gi|320641809|gb|EFX11197.1| DNA cytosine methylase [Escherichia coli O157:H7 str. G5101]
          Length = 472

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|315296465|gb|EFU55762.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 16-3]
          Length = 476

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 270 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 328

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 329 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378


>gi|300931174|ref|ZP_07146520.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1]
 gi|300461007|gb|EFK24500.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 187-1]
          Length = 477

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 271 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|91211180|ref|YP_541166.1| DNA cytosine methylase [Escherichia coli UTI89]
 gi|117624099|ref|YP_853012.1| DNA cytosine methylase [Escherichia coli APEC O1]
 gi|218558817|ref|YP_002391730.1| DNA cytosine methylase [Escherichia coli S88]
 gi|91072754|gb|ABE07635.1| DNA cytosine methylase [Escherichia coli UTI89]
 gi|115513223|gb|ABJ01298.1| DNA cytosine methylase [Escherichia coli APEC O1]
 gi|218365586|emb|CAR03313.1| DNA cytosine methylase [Escherichia coli S88]
 gi|294492656|gb|ADE91412.1| DNA-cytosine methyltransferase [Escherichia coli IHE3034]
 gi|307626564|gb|ADN70868.1| DNA cytosine methylase [Escherichia coli UM146]
 gi|323952452|gb|EGB48325.1| DNA-cytosine methyltransferase [Escherichia coli H252]
          Length = 472

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|15802395|ref|NP_288421.1| DNA cytosine methylase [Escherichia coli O157:H7 EDL933]
 gi|15831953|ref|NP_310726.1| DNA cytosine methylase [Escherichia coli O157:H7 str. Sakai]
 gi|16129907|ref|NP_416470.1| DNA cytosine methyltransferase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89108792|ref|AP_002572.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. W3110]
 gi|168752207|ref|ZP_02777229.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758275|ref|ZP_02783282.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168771615|ref|ZP_02796622.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777717|ref|ZP_02802724.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783359|ref|ZP_02808366.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789321|ref|ZP_02814328.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC869]
 gi|168801737|ref|ZP_02826744.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC508]
 gi|170081604|ref|YP_001730924.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. DH10B]
 gi|195939267|ref|ZP_03084649.1| DNA cytosine methylase [Escherichia coli O157:H7 str. EC4024]
 gi|208810340|ref|ZP_03252216.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816602|ref|ZP_03257722.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821263|ref|ZP_03261583.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209400193|ref|YP_002271076.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209919382|ref|YP_002293466.1| DNA cytosine methylase [Escherichia coli SE11]
 gi|217328629|ref|ZP_03444710.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218689956|ref|YP_002398168.1| DNA cytosine methylase [Escherichia coli ED1a]
 gi|238901165|ref|YP_002926961.1| DNA cytosine methylase [Escherichia coli BW2952]
 gi|253773091|ref|YP_003035922.1| DNA cytosine methylase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254793611|ref|YP_003078448.1| DNA cytosine methylase [Escherichia coli O157:H7 str. TW14359]
 gi|256017846|ref|ZP_05431711.1| DNA cytosine methylase [Shigella sp. D9]
 gi|261227545|ref|ZP_05941826.1| DNA cytosine methylase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261254631|ref|ZP_05947164.1| DNA cytosine methylase [Escherichia coli O157:H7 str. FRIK966]
 gi|293415271|ref|ZP_06657914.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli B185]
 gi|300818618|ref|ZP_07098826.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1]
 gi|300920181|ref|ZP_07136630.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1]
 gi|301327749|ref|ZP_07220953.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1]
 gi|301644580|ref|ZP_07244570.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1]
 gi|307312454|ref|ZP_07592088.1| DNA-cytosine methyltransferase [Escherichia coli W]
 gi|312973821|ref|ZP_07787993.1| DNA-cytosine methyltransferase [Escherichia coli 1827-70]
 gi|332278872|ref|ZP_08391285.1| DNA cytosine methylase [Shigella sp. D9]
 gi|83305674|sp|P0AEE0|DCM_ECO57 RecName: Full=DNA-cytosine methyltransferase
 gi|83305675|sp|P0AED9|DCM_ECOLI RecName: Full=DNA-cytosine methyltransferase; AltName:
           Full=M.EcoDcm
 gi|12516070|gb|AAG56975.1|AE005418_3 DNA cytosine methylase [Escherichia coli O157:H7 str. EDL933]
 gi|41239|emb|CAA31705.1| unnamed protein product [Escherichia coli K-12]
 gi|145719|gb|AAA03723.1| DNA cytosine methylase [Escherichia coli]
 gi|1736630|dbj|BAA15788.1| DNA cytosine methylase [Escherichia coli str. K12 substr. W3110]
 gi|1788271|gb|AAC75027.1| DNA cytosine methyltransferase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13362167|dbj|BAB36122.1| DNA cytosine methylase [Escherichia coli O157:H7 str. Sakai]
 gi|169889439|gb|ACB03146.1| DNA cytosine methylase [Escherichia coli str. K-12 substr. DH10B]
 gi|187767102|gb|EDU30946.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188013903|gb|EDU52025.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999305|gb|EDU68291.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354901|gb|EDU73320.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359668|gb|EDU78087.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189371047|gb|EDU89463.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC869]
 gi|189376137|gb|EDU94553.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC508]
 gi|208724856|gb|EDZ74563.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208730945|gb|EDZ79634.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741386|gb|EDZ89068.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161593|gb|ACI39026.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209766668|gb|ACI81646.1| DNA cytosine methylase [Escherichia coli]
 gi|209766670|gb|ACI81647.1| DNA cytosine methylase [Escherichia coli]
 gi|209766672|gb|ACI81648.1| DNA cytosine methylase [Escherichia coli]
 gi|209766676|gb|ACI81650.1| DNA cytosine methylase [Escherichia coli]
 gi|209912641|dbj|BAG77715.1| DNA cytosine methylase [Escherichia coli SE11]
 gi|217317976|gb|EEC26403.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218427520|emb|CAR08415.2| DNA cytosine methylase [Escherichia coli ED1a]
 gi|238860813|gb|ACR62811.1| DNA cytosine methylase [Escherichia coli BW2952]
 gi|253324135|gb|ACT28737.1| DNA-cytosine methyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254593011|gb|ACT72372.1| DNA cytosine methylase [Escherichia coli O157:H7 str. TW14359]
 gi|260448927|gb|ACX39349.1| DNA-cytosine methyltransferase [Escherichia coli DH1]
 gi|291432919|gb|EFF05898.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli B185]
 gi|300412803|gb|EFJ96113.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 115-1]
 gi|300528790|gb|EFK49852.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 107-1]
 gi|300845711|gb|EFK73471.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 78-1]
 gi|301077088|gb|EFK91894.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 146-1]
 gi|306907625|gb|EFN38128.1| DNA-cytosine methyltransferase [Escherichia coli W]
 gi|310332416|gb|EFP99651.1| DNA-cytosine methyltransferase [Escherichia coli 1827-70]
 gi|315061260|gb|ADT75587.1| DNA cytosine methylase [Escherichia coli W]
 gi|315136597|dbj|BAJ43756.1| DNA cytosine methylase [Escherichia coli DH1]
 gi|320191934|gb|EFW66581.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320198651|gb|EFW73251.1| DNA-cytosine methyltransferase [Escherichia coli EC4100B]
 gi|320647167|gb|EFX16000.1| DNA cytosine methylase [Escherichia coli O157:H- str. 493-89]
 gi|320652452|gb|EFX20750.1| DNA cytosine methylase [Escherichia coli O157:H- str. H 2687]
 gi|320658054|gb|EFX25816.1| DNA cytosine methylase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320658625|gb|EFX26319.1| DNA cytosine methylase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668523|gb|EFX35350.1| DNA cytosine methylase [Escherichia coli O157:H7 str. LSU-61]
 gi|323174657|gb|EFZ60277.1| DNA-cytosine methyltransferase [Escherichia coli LT-68]
 gi|323183944|gb|EFZ69331.1| DNA-cytosine methyltransferase [Escherichia coli 1357]
 gi|323378163|gb|ADX50431.1| DNA-cytosine methyltransferase [Escherichia coli KO11]
 gi|323948336|gb|EGB44323.1| DNA-cytosine methyltransferase [Escherichia coli H120]
 gi|326342371|gb|EGD66152.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. 1044]
 gi|326344875|gb|EGD68622.1| DNA-cytosine methyltransferase [Escherichia coli O157:H7 str. 1125]
 gi|332101224|gb|EGJ04570.1| DNA cytosine methylase [Shigella sp. D9]
          Length = 472

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|110642066|ref|YP_669796.1| DNA cytosine methylase [Escherichia coli 536]
 gi|191173268|ref|ZP_03034798.1| DNA-cytosine methyltransferase [Escherichia coli F11]
 gi|110343658|gb|ABG69895.1| DNA-cytosine methyltransferase [Escherichia coli 536]
 gi|190906385|gb|EDV65994.1| DNA-cytosine methyltransferase [Escherichia coli F11]
 gi|222033699|emb|CAP76440.1| DNA-cytosine methyltransferase [Escherichia coli LF82]
 gi|312946553|gb|ADR27380.1| DNA cytosine methylase [Escherichia coli O83:H1 str. NRG 857C]
 gi|324013473|gb|EGB82692.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 60-1]
          Length = 472

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|56751653|ref|YP_172354.1| hypothetical protein syc1644_d [Synechococcus elongatus PCC 6301]
 gi|81301269|ref|YP_401477.1| DNA-cytosine methyltransferase [Synechococcus elongatus PCC 7942]
 gi|56686612|dbj|BAD79834.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81170150|gb|ABB58490.1| DNA-cytosine methyltransferase [Synechococcus elongatus PCC 7942]
          Length = 424

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 46/121 (38%), Positives = 61/121 (50%), Gaps = 23/121 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFP---TPLGIKPRLGDILEEH----------- 46
           + A  F VPQ RER+YI+ F    V F +     P      + DIL  +           
Sbjct: 228 IDAKGF-VPQHRERIYIVGFREE-VGFNWDSFSQPPTDTKCMADILHPNDGSEEVEEPYT 285

Query: 47  ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
                 ++DK T+S+KLW   Q     ++ AG GFG+GL  ++S    TLSARYYKDGSE
Sbjct: 286 VGIEAKVNDKYTLSDKLWNYLQNYANKHRAAGNGFGFGLVNKDS-IARTLSARYYKDGSE 344

Query: 101 I 101
           I
Sbjct: 345 I 345


>gi|238919389|ref|YP_002932904.1| DNA cytosine methylase [Edwardsiella ictaluri 93-146]
 gi|238868958|gb|ACR68669.1| modification methylase [Edwardsiella ictaluri 93-146]
          Length = 471

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F            KP  G++LE  +D K  +
Sbjct: 273 IDGKHF-LPQHRERIVLVGFRRDLNIHHDFTLQKIQQFYPEKKPTFGELLEPAVDSKYIL 331

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           S KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 332 SPKLWEYLYNYAKKHAEKGNGFGFGLVDPKNKESIARTLSARYHKDGSEI 381


>gi|296538000|gb|ADH30019.1| EcoRII cytosine methylase [Escherichia coli O25b:H4 str. EC958]
          Length = 477

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 334 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|26248232|ref|NP_754272.1| DNA cytosine methylase [Escherichia coli CFT073]
 gi|227885611|ref|ZP_04003416.1| DNA cytosine methylase [Escherichia coli 83972]
 gi|237705920|ref|ZP_04536401.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|331647554|ref|ZP_08348646.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605]
 gi|26108636|gb|AAN80839.1|AE016762_92 DNA-cytosine methyltransferase [Escherichia coli CFT073]
 gi|226900677|gb|EEH86936.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|227837184|gb|EEJ47650.1| DNA cytosine methylase [Escherichia coli 83972]
 gi|281179022|dbj|BAI55352.1| DNA cytosine methylase [Escherichia coli SE15]
 gi|307553973|gb|ADN46748.1| DNA cytosine methylase [Escherichia coli ABU 83972]
 gi|320194327|gb|EFW68958.1| DNA-cytosine methyltransferase [Escherichia coli WV_060327]
 gi|323956356|gb|EGB52099.1| DNA-cytosine methyltransferase [Escherichia coli H263]
 gi|324005878|gb|EGB75097.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 57-2]
 gi|331043278|gb|EGI15416.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M605]
          Length = 472

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|191169235|ref|ZP_03030988.1| DNA-cytosine methyltransferase [Escherichia coli B7A]
 gi|190900713|gb|EDV60509.1| DNA-cytosine methyltransferase [Escherichia coli B7A]
          Length = 472

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|315286667|gb|EFU46100.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 110-3]
          Length = 475

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 269 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 327

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 328 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 377


>gi|300923873|ref|ZP_07139889.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1]
 gi|300419870|gb|EFK03181.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 182-1]
          Length = 477

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 271 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|170681403|ref|YP_001743285.1| DNA cytosine methylase [Escherichia coli SMS-3-5]
 gi|170519121|gb|ACB17299.1| DNA-cytosine methyltransferase [Escherichia coli SMS-3-5]
 gi|324119009|gb|EGC12898.1| DNA-cytosine methyltransferase [Escherichia coli E1167]
          Length = 472

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|113706802|ref|YP_724464.1| DNA cytosine methylase [Escherichia coli]
 gi|190576899|ref|YP_001966231.1| M.EcoRII DNA methylase [Klebsiella pneumoniae]
 gi|194433606|ref|ZP_03065883.1| modification methylase EcoRII [Shigella dysenteriae 1012]
 gi|209901141|ref|YP_002286923.1| DNA cytosine methylase [Klebsiella pneumoniae]
 gi|209901236|ref|YP_002287017.1| DNA cytosine methylase [Klebsiella pneumoniae]
 gi|215528089|ref|YP_002332862.1| EcoRII cytosine methylase [Klebsiella pneumoniae]
 gi|302141639|ref|YP_003813098.1| EcoRII methylase [Klebsiella pneumoniae]
 gi|127448|sp|P05101|MTE2_ECOLX RecName: Full=Modification methylase EcoRII; Short=M.EcoRII;
           AltName: Full=Cytosine-specific methyltransferase EcoRII
 gi|41317|emb|CAA28725.1| unnamed protein product [Escherichia coli HB101]
 gi|109390538|gb|ABG33840.1| EcoRII modification enzyme [Escherichia coli]
 gi|110264483|gb|ABG56846.1| M.EcoRII DNA methylase [Klebsiella pneumoniae]
 gi|165928612|gb|ABY74380.1| EcoRII cytosine methylase [Klebsiella pneumoniae]
 gi|194418198|gb|EDX34290.1| modification methylase EcoRII [Shigella dysenteriae 1012]
 gi|197092209|gb|ACH42172.1| EcoRII cytosine methylase [Klebsiella pneumoniae]
 gi|209574187|gb|ACI63075.1| modification methylase [Klebsiella pneumoniae]
 gi|209574298|gb|ACI63184.1| modification methylase [Klebsiella pneumoniae]
 gi|296033904|gb|ADG84867.1| EcoRII methylase [Klebsiella pneumoniae]
          Length = 477

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 334 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|193071315|ref|ZP_03052233.1| DNA-cytosine methyltransferase [Escherichia coli E110019]
 gi|331683510|ref|ZP_08384111.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299]
 gi|192955357|gb|EDV85842.1| DNA-cytosine methyltransferase [Escherichia coli E110019]
 gi|331079725|gb|EGI50922.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H299]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F      G  P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|301050676|ref|ZP_07197538.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1]
 gi|300297633|gb|EFJ54018.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 185-1]
          Length = 477

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 271 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|218699478|ref|YP_002407107.1| DNA cytosine methylase [Escherichia coli IAI39]
 gi|218369464|emb|CAR17229.1| DNA cytosine methylase [Escherichia coli IAI39]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|331671799|ref|ZP_08372595.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli TA280]
 gi|331070788|gb|EGI42147.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli TA280]
          Length = 474

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F            +P  G++L+  +DDK  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHDVDDKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           + +LWE      + +   G GFG+GL       +   TLSARY+KDGSEI
Sbjct: 334 TPRLWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|300940416|ref|ZP_07155001.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1]
 gi|300454810|gb|EFK18303.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 21-1]
          Length = 476

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 270 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 328

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 329 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 378


>gi|160431610|ref|YP_001551777.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Dublin]
 gi|298206539|ref|YP_003717476.1| EcoRII modification enzyme [Escherichia coli]
 gi|159885479|dbj|BAF93082.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Dublin]
 gi|296537944|gb|ADH29964.1| EcoRII modification enzyme [Escherichia coli O25b:H4 str. EC958]
          Length = 477

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 334 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|300899219|ref|ZP_07117494.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1]
 gi|300357175|gb|EFJ73045.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 198-1]
          Length = 477

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F      G  P     L  +L+  ++ K  +
Sbjct: 271 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|284921868|emb|CBG34943.1| DNA-cytosine methyltransferase [Escherichia coli 042]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|82543581|ref|YP_407528.1| DNA cytosine methylase [Shigella boydii Sb227]
 gi|81244992|gb|ABB65700.1| DNA cytosine methylase [Shigella boydii Sb227]
 gi|332096894|gb|EGJ01883.1| DNA-cytosine methyltransferase [Shigella boydii 3594-74]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|187732725|ref|YP_001879611.1| DNA cytosine methylase [Shigella boydii CDC 3083-94]
 gi|293446340|ref|ZP_06662762.1| DNA-cytosine methyltransferase [Escherichia coli B088]
 gi|187429717|gb|ACD08991.1| DNA-cytosine methyltransferase [Shigella boydii CDC 3083-94]
 gi|291323170|gb|EFE62598.1| DNA-cytosine methyltransferase [Escherichia coli B088]
 gi|320175451|gb|EFW50550.1| DNA-cytosine methyltransferase [Shigella dysenteriae CDC 74-1112]
 gi|320184499|gb|EFW59303.1| DNA-cytosine methyltransferase [Shigella flexneri CDC 796-83]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|331663456|ref|ZP_08364366.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143]
 gi|331059255|gb|EGI31232.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA143]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|293410317|ref|ZP_06653893.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291470785|gb|EFF13269.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|170019707|ref|YP_001724661.1| DNA cytosine methylase [Escherichia coli ATCC 8739]
 gi|169754635|gb|ACA77334.1| DNA-cytosine methyltransferase [Escherichia coli ATCC 8739]
 gi|323940380|gb|EGB36571.1| DNA-cytosine methyltransferase [Escherichia coli E482]
 gi|332093084|gb|EGI98148.1| DNA-cytosine methyltransferase [Shigella boydii 5216-82]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|188494720|ref|ZP_03001990.1| DNA-cytosine methyltransferase [Escherichia coli 53638]
 gi|188489919|gb|EDU65022.1| DNA-cytosine methyltransferase [Escherichia coli 53638]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F      G  P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDINLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|82776352|ref|YP_402701.1| DNA cytosine methylase [Shigella dysenteriae Sd197]
 gi|309789422|ref|ZP_07684012.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1617]
 gi|81240500|gb|ABB61210.1| DNA cytosine methylase [Shigella dysenteriae Sd197]
 gi|308922816|gb|EFP68333.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1617]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F      G  P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISGCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|331643338|ref|ZP_08344469.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli H736]
 gi|331036809|gb|EGI09033.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli H736]
          Length = 491

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 289 IDGKHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYIL 347

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 348 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397


>gi|331645413|ref|ZP_08346517.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli M605]
 gi|331045575|gb|EGI17701.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Escherichia coli M605]
          Length = 474

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F            +P  G++L+ ++DDK  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHNVDDKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           + +LWE      + +   G GFG+GL       +   TLSARY+KDGSEI
Sbjct: 334 TPRLWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|218701133|ref|YP_002408762.1| DNA cytosine methylase [Escherichia coli IAI39]
 gi|218371119|emb|CAR18947.1| Modification methylase EcoRII (M.EcoRII) (Cytosine-specific
           methyltransferase EcoRII) [Escherichia coli IAI39]
          Length = 491

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 289 IDGKHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYIL 347

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 348 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 397


>gi|157158517|ref|YP_001463262.1| DNA cytosine methylase [Escherichia coli E24377A]
 gi|157080547|gb|ABV20255.1| DNA-cytosine methyltransferase [Escherichia coli E24377A]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDSMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|315290247|gb|EFU49625.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 153-1]
          Length = 478

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 272 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 330

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 331 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 380


>gi|331653374|ref|ZP_08354379.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718]
 gi|331049472|gb|EGI21544.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300904853|ref|ZP_07122678.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1]
 gi|301304244|ref|ZP_07210359.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1]
 gi|300403236|gb|EFJ86774.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 84-1]
 gi|300840501|gb|EFK68261.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 124-1]
 gi|315257206|gb|EFU37174.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 85-1]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + +++ G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQVRGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|218554541|ref|YP_002387454.1| DNA cytosine methylase [Escherichia coli IAI1]
 gi|260868553|ref|YP_003234955.1| DNA cytosine methylase [Escherichia coli O111:H- str. 11128]
 gi|218361309|emb|CAQ98893.1| DNA cytosine methylase [Escherichia coli IAI1]
 gi|257764909|dbj|BAI36404.1| DNA cytosine methylase [Escherichia coli O111:H- str. 11128]
 gi|323180787|gb|EFZ66327.1| DNA-cytosine methyltransferase [Escherichia coli 1180]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|324018843|gb|EGB88062.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 117-3]
          Length = 472

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|300956520|ref|ZP_07168803.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1]
 gi|300316661|gb|EFJ66445.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 175-1]
          Length = 477

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 271 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 379


>gi|320182772|gb|EFW57655.1| DNA-cytosine methyltransferase [Shigella boydii ATCC 9905]
          Length = 472

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|307138628|ref|ZP_07497984.1| DNA cytosine methylase [Escherichia coli H736]
 gi|331642581|ref|ZP_08343716.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736]
 gi|331039379|gb|EGI11599.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H736]
          Length = 472

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|193066646|ref|ZP_03047681.1| DNA-cytosine methyltransferase [Escherichia coli E22]
 gi|260844359|ref|YP_003222137.1| DNA cytosine methylase [Escherichia coli O103:H2 str. 12009]
 gi|192925721|gb|EDV80380.1| DNA-cytosine methyltransferase [Escherichia coli E22]
 gi|257759506|dbj|BAI31003.1| DNA cytosine methylase [Escherichia coli O103:H2 str. 12009]
          Length = 472

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|311279100|ref|YP_003941331.1| DNA-cytosine methyltransferase [Enterobacter cloacae SCF1]
 gi|308748295|gb|ADO48047.1| DNA-cytosine methyltransferase [Enterobacter cloacae SCF1]
          Length = 492

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F      G+ P      G++LE  +D K  +
Sbjct: 287 IDGRHF-LPQHRERIVLVGFRRDLNLHQGFSLRALPGLYPAQRPTFGELLEPTVDAKFIL 345

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYGL       +   TLSARYYKDG+EI
Sbjct: 346 TPVLWKYLYRYAKKHQARGNGFGYGLVDPTNPDSVARTLSARYYKDGAEI 395


>gi|300951590|ref|ZP_07165422.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1]
 gi|300449174|gb|EFK12794.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 116-1]
          Length = 478

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 272 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 330

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 331 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 380


>gi|194433657|ref|ZP_03065933.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1012]
 gi|194418086|gb|EDX34179.1| DNA-cytosine methyltransferase [Shigella dysenteriae 1012]
 gi|332095525|gb|EGJ00541.1| DNA-cytosine methyltransferase [Shigella dysenteriae 155-74]
          Length = 472

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDFNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|307139342|ref|ZP_07498698.1| DNA cytosine methylase [Escherichia coli H736]
          Length = 477

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 334 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|323960520|gb|EGB56149.1| DNA-cytosine methyltransferase [Escherichia coli H489]
          Length = 477

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHKGFTLRDISRFYPEHRPSFGELLEPVVDSKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 334 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 383


>gi|327254549|gb|EGE66165.1| modification methylase EcoRII [Escherichia coli STEC_7v]
          Length = 474

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F            +P  G++L+  +DDK  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHKDFTLRNINRFYPQNRPTFGELLDHDVDDKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           + +LWE      + +   G GFG+GL       +   TLSARY+KDGSEI
Sbjct: 334 TPRLWEYLYNYAKKHAAKGNGFGFGLVDPKNPDSIARTLSARYHKDGSEI 383


>gi|157161430|ref|YP_001458748.1| DNA cytosine methylase [Escherichia coli HS]
 gi|157067110|gb|ABV06365.1| DNA-cytosine methyltransferase [Escherichia coli HS]
          Length = 472

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQTRGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|331668651|ref|ZP_08369499.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271]
 gi|331063845|gb|EGI35756.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA271]
          Length = 458

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 252 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 310

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 311 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 360


>gi|296114735|ref|ZP_06833385.1| DNA-cytosine methyltransferase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978659|gb|EFG85387.1| DNA-cytosine methyltransferase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 419

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 59/107 (55%), Gaps = 9/107 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT----PLGIKPRLGDIL--EEHIDDKSTIS 54
           + A  + VPQ+RER++I+ F     +F   +    P+   PRLG IL     ++ K T++
Sbjct: 224 ISAASW-VPQKRERIFIVGFR-EKTDFDLKSLVVPPIEKGPRLGSILLPHAEVEPKYTLT 281

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             LW   Q  K  +  AG GFG+GL   +     TLSARY+KDGSEI
Sbjct: 282 EHLWNYLQNYKAKHAAAGNGFGFGLCGPDD-VARTLSARYFKDGSEI 327


>gi|331658007|ref|ZP_08358969.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206]
 gi|331056255|gb|EGI28264.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA206]
          Length = 472

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPIVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|165938005|ref|ZP_02226565.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165914028|gb|EDR32645.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) (M.EcoRII) [Yersinia pestis biovar Orientalis
           str. IP275]
          Length = 282

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 80  IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYIL 138

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 139 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 188


>gi|62180565|ref|YP_216982.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62128198|gb|AAX65901.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322715041|gb|EFZ06612.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 476

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|322616984|gb|EFY13892.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322618223|gb|EFY15115.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322625894|gb|EFY22713.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626346|gb|EFY23156.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322632761|gb|EFY29506.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322639103|gb|EFY35796.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322640419|gb|EFY37075.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322647220|gb|EFY43719.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322648528|gb|EFY44979.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655540|gb|EFY51848.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322660318|gb|EFY56556.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662999|gb|EFY59206.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322668184|gb|EFY64343.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322674057|gb|EFY70151.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675591|gb|EFY71665.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682998|gb|EFY79014.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686692|gb|EFY82670.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323195420|gb|EFZ80600.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323198052|gb|EFZ83169.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323204476|gb|EFZ89482.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207566|gb|EFZ92514.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323210995|gb|EFZ95855.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323217551|gb|EGA02270.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323226697|gb|EGA10894.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231573|gb|EGA15686.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323236016|gb|EGA20095.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240586|gb|EGA24629.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245478|gb|EGA29478.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323247596|gb|EGA31547.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323254424|gb|EGA38240.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257764|gb|EGA41444.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323262129|gb|EGA45692.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323266252|gb|EGA49742.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323270729|gb|EGA54168.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 476

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPGSVARTLSARYYKDGAEI 378


>gi|168239231|ref|ZP_02664289.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194734985|ref|YP_002115026.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|204931362|ref|ZP_03222061.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|194710487|gb|ACF89708.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288080|gb|EDY27467.1| modification methylase EcoRII (Cytosine-specificmethyltransferase
           EcoRII) [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|204319845|gb|EDZ05054.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 476

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|323158561|gb|EFZ44575.1| DNA-cytosine methyltransferase [Escherichia coli E128010]
          Length = 472

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLG----DILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P        +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVMLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQCVTRTLSARYYKDGAEI 374


>gi|168462467|ref|ZP_02696398.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194443436|ref|YP_002041256.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|238912436|ref|ZP_04656273.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|194402099|gb|ACF62321.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|195634356|gb|EDX52708.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|167552776|ref|ZP_02346527.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205322616|gb|EDZ10455.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|161613440|ref|YP_001587405.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|205352316|ref|YP_002226117.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207856496|ref|YP_002243147.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|161362804|gb|ABX66572.1| hypothetical protein SPAB_01156 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205272097|emb|CAR36949.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206708299|emb|CAR32602.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326627365|gb|EGE33708.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|317048624|ref|YP_004116272.1| DNA-cytosine methyltransferase [Pantoea sp. At-9b]
 gi|316950241|gb|ADU69716.1| DNA-cytosine methyltransferase [Pantoea sp. At-9b]
          Length = 467

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 51/110 (46%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           + A  F +PQ RER+ ++        S  F             P L  +LE   D K T+
Sbjct: 271 IDARHF-LPQHRERIVLVGIRRDTRLSEGFTLRALAQLYPKKVPTLKSLLEPQPDAKYTL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           S  LW    +  + +K  G GFG+GL    +      TLSARYYKDGSEI
Sbjct: 330 SPVLWNYLYQYAKKHKAKGNGFGFGLNDPRNPSVCVRTLSARYYKDGSEI 379


>gi|168259722|ref|ZP_02681695.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|205351069|gb|EDZ37700.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNISRCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|200390041|ref|ZP_03216652.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199602486|gb|EDZ01032.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|56413096|ref|YP_150171.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197362022|ref|YP_002141659.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56127353|gb|AAV76859.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197093499|emb|CAR58960.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|198242597|ref|YP_002215094.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|197937113|gb|ACH74446.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|326622842|gb|EGE29187.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNISRCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|197251440|ref|YP_002146032.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197215143|gb|ACH52540.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|16765328|ref|NP_460943.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167993566|ref|ZP_02574660.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|16420526|gb|AAL20902.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|205328427|gb|EDZ15191.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261247157|emb|CBG24980.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993981|gb|ACY88866.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301158505|emb|CBW18015.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912981|dbj|BAJ36955.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321224636|gb|EFX49699.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323130270|gb|ADX17700.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|332988880|gb|AEF07863.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|224583511|ref|YP_002637309.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224468038|gb|ACN45868.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|168244842|ref|ZP_02669774.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194449372|ref|YP_002046042.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194407676|gb|ACF67895.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205336375|gb|EDZ23139.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|134044844|ref|YP_001102126.1| cytosine-specific methyltransferase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|133905378|gb|ABO42140.1| cytosine-specific methyltransferase [Yersinia pestis biovar
           Orientalis str. IP275]
          Length = 274

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 72  IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYIL 130

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 131 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 180


>gi|168234164|ref|ZP_02659222.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168821682|ref|ZP_02833682.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194470868|ref|ZP_03076852.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197263635|ref|ZP_03163709.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|194457232|gb|EDX46071.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197241890|gb|EDY24510.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205331847|gb|EDZ18611.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205341769|gb|EDZ28533.1| modification methylase EcoRII [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320085391|emb|CBY95172.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|16760934|ref|NP_456551.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29141374|ref|NP_804716.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|213424982|ref|ZP_03357732.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|289829483|ref|ZP_06547095.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|25286126|pir||AH0754 site-specific DNA-methyltransferase (cytosine-specific) (EC
           2.1.1.73) - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16503231|emb|CAD05739.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137001|gb|AAO68565.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 476

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|331673470|ref|ZP_08374238.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280]
 gi|331069668|gb|EGI41055.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli TA280]
          Length = 472

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIK----PRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F               L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFSAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|306814216|ref|ZP_07448382.1| DNA cytosine methylase [Escherichia coli NC101]
 gi|305852375|gb|EFM52826.1| DNA cytosine methylase [Escherichia coli NC101]
          Length = 472

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISACFPAQRVTLAQLLDPIVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|283785730|ref|YP_003365595.1| DNA-cytosine methyltransferase [Citrobacter rodentium ICC168]
 gi|282949184|emb|CBG88792.1| DNA-cytosine methyltransferase [Citrobacter rodentium ICC168]
          Length = 477

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 9/105 (8%)

Query: 6   FGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLW 58
           + +PQ RER+ ++ F        +F         P     L ++LE  ++ K  ++  LW
Sbjct: 275 YFLPQHRERIVLVGFRRDLNLKGDFTLRDISTRYPQRRTTLAELLEPVVEAKYVLTPVLW 334

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +   +  + ++  G GFGYG+   +     T TLSARYYKDG+EI
Sbjct: 335 KYLYRYAKKHQAKGNGFGYGMVSPSDPNSVTRTLSARYYKDGAEI 379


>gi|146312197|ref|YP_001177271.1| DNA cytosine methylase [Enterobacter sp. 638]
 gi|145319073|gb|ABP61220.1| DNA-cytosine methyltransferase [Enterobacter sp. 638]
          Length = 471

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F       + P     + ++LE   D K  +
Sbjct: 265 IDGKHF-LPQHRERIVLVGFRRDLNLKGDFTLRDIPSLYPAHRPSVAELLEPAFDAKFIL 323

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFG+G+    +    T TLSARYYKDG+EI
Sbjct: 324 TPVLWKYLYRYAKKHQAKGNGFGFGMVDPRNPHSVTRTLSARYYKDGAEI 373


>gi|118614638|ref|YP_908421.1| DNA methyltrasferase [Photobacterium damselae subsp. piscicida]
 gi|118596729|dbj|BAF38033.1| DNA methyltrasferase [Photobacterium damselae subsp. piscicida]
          Length = 266

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 64  IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYIL 122

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 123 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 172


>gi|48093754|gb|AAT40239.1| Eco128I DNA methylase [Escherichia coli]
          Length = 332

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G++LE  +D K  +
Sbjct: 194 IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDISRFYPEQRPSFGELLEPVVDSKYIL 252

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + KLWE      + +   G GFG+GL    +      TLSARY+KDGSEI
Sbjct: 253 TPKLWEYLYNYAKKHAAKGNGFGFGLVNPENKESIARTLSARYHKDGSEI 302


>gi|114571596|ref|YP_758276.1| DNA-cytosine methyltransferase [Maricaulis maris MCS10]
 gi|114342058|gb|ABI67338.1| DNA-cytosine methyltransferase [Maricaulis maris MCS10]
          Length = 406

 Score =  104 bits (260), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 56/102 (54%), Gaps = 10/102 (9%)

Query: 8   VPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRLGDILEEHIDD---KSTISNKLWE 59
           VPQ+RER++I+ F   S +F F       P        D + +  ++   K T++ KLW+
Sbjct: 228 VPQKRERVFIVGFR-DSTDFSFEGFERLIPHASNHPTLDSILQSHNEIGQKYTLTEKLWD 286

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             Q  ++ ++  G GFGY LF  +     TLSARY+KDGSEI
Sbjct: 287 YLQAYRQKHESKGNGFGYSLFGPDD-VARTLSARYHKDGSEI 327


>gi|296282358|ref|ZP_06860356.1| DNA-cytosine methyltransferase [Citromicrobium bathyomarinum JL354]
          Length = 439

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 8/100 (8%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDIL--EEHIDDKSTISNKLWEGH 61
           VPQ+RER++I+ F   S       + P  +   P+LG IL   + +D K T++ +LWE  
Sbjct: 250 VPQKRERIFIVGFREKSAFNLAGLEIPA-VADGPKLGSILEPHDQVDPKYTLTPRLWEYL 308

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           Q+ ++ ++  G GFGY LF        TLSARY+KDGSEI
Sbjct: 309 QEYRKKHEAKGNGFGYSLFGPGD-VARTLSARYHKDGSEI 347


>gi|294979850|pdb|3ME5|A Chain A, Crystal Structure Of Putative Dna Cytosine Methylase From
           Shigella Flexneri 2a Str. 301
          Length = 482

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 268 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPXVEAKYIL 326

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG  + N+    T TLSARYYKDG+EI
Sbjct: 327 TPVLWKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 376


>gi|259909642|ref|YP_002649998.1| DNA cytosine methylase [Erwinia pyrifoliae Ep1/96]
 gi|224965264|emb|CAX56796.1| Cytosine-specific methyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|261863687|gb|ACY01298.1| unknown [Erwinia pyrifoliae]
 gi|283479721|emb|CAY75637.1| DNA cytosine methylase [Erwinia pyrifoliae DSM 12163]
          Length = 473

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +   +F +PQ RER+ ++ F         F            +P  G +LE+ +D K  +
Sbjct: 275 IDGKNF-LPQHRERIVLVGFRRDLNIHQNFTLSNISRYFPDKRPEFGSLLEKTVDSKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           + +LWE      + +   G GFG+GL    ++     TLSARY+KDGSEI
Sbjct: 334 TPRLWEYLYNYAKKHAAKGNGFGFGLVDPTNSGSVARTLSARYHKDGSEI 383


>gi|288934555|ref|YP_003438614.1| DNA-cytosine methyltransferase [Klebsiella variicola At-22]
 gi|288889264|gb|ADC57582.1| DNA-cytosine methyltransferase [Klebsiella variicola At-22]
          Length = 466

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F           ++P  G++LE  +D K  +
Sbjct: 260 IDGRHF-LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTVDAKFIL 318

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 319 TPVLWKYLYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 368


>gi|152970972|ref|YP_001336081.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150955821|gb|ABR77851.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 477

 Score =  104 bits (259), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F           ++P  G++LE  +D K  +
Sbjct: 271 IDGRHF-LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYPAVRPTFGELLEPTVDSKFIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379


>gi|170769440|ref|ZP_02903893.1| DNA-cytosine methyltransferase [Escherichia albertii TW07627]
 gi|170121764|gb|EDS90695.1| DNA-cytosine methyltransferase [Escherichia albertii TW07627]
          Length = 472

 Score =  104 bits (259), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLG----DILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F         P        +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKASFTLRDINQCFPTQRVTLAQLLDPVVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 325 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 374


>gi|206577074|ref|YP_002237693.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342]
 gi|206566132|gb|ACI07908.1| DNA-cytosine methyltransferase [Klebsiella pneumoniae 342]
          Length = 477

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F           ++P  G++LE  +D K  +
Sbjct: 271 IDGRHF-LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTVDAKFIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 379


>gi|238895488|ref|YP_002920223.1| DNA cytosine methylase [Klebsiella pneumoniae NTUH-K2044]
 gi|330000908|ref|ZP_08303852.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. MS 92-3]
 gi|238547805|dbj|BAH64156.1| DNA cytosine methylase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|328537840|gb|EGF64032.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. MS 92-3]
          Length = 477

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F           ++P  G++LE  +D K  +
Sbjct: 271 IDGRHF-LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYPAVRPTFGELLEPTVDAKFIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379


>gi|86136173|ref|ZP_01054752.1| hypothetical protein MED193_18659 [Roseobacter sp. MED193]
 gi|85827047|gb|EAQ47243.1| hypothetical protein MED193_18659 [Roseobacter sp. MED193]
          Length = 399

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 57/122 (46%), Gaps = 23/122 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPT---PLGIKPRLGDILEE----------- 45
           + A  + VPQ RER++I  F       F       P G  PRL DIL             
Sbjct: 201 IDARSW-VPQHRERIFISGFRRDVPTRFCLDDVVIPPGPNPRLSDILHPENGSEIAEPPY 259

Query: 46  ------HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99
                  I DK T+S+KLW   Q     +K AG GFG+GL    S    TLSARYYKDGS
Sbjct: 260 TEGHLARIADKYTLSDKLWAYLQNYAAKHKAAGNGFGFGLCTPES-VARTLSARYYKDGS 318

Query: 100 EI 101
           EI
Sbjct: 319 EI 320


>gi|213581465|ref|ZP_03363291.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
          Length = 295

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 108 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 167

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 168 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 210


>gi|213622824|ref|ZP_03375607.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-2068]
          Length = 324

 Score =  103 bits (257), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 124 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 183

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 184 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 226


>gi|213650730|ref|ZP_03380783.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
          Length = 405

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 205 LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 264

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 265 LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 307


>gi|161502886|ref|YP_001569998.1| DNA cytosine methylase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160864233|gb|ABX20856.1| hypothetical protein SARI_00944 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 476

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 52/103 (50%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++          +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGVRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
                + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 336 LYCYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 378


>gi|262043463|ref|ZP_06016586.1| DNA (cytosine-5-)-methyltransferase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039205|gb|EEW40353.1| DNA (cytosine-5-)-methyltransferase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 477

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F           + P  G++LE  +D K  +
Sbjct: 271 IDGRHF-LPQHRERIVLVGFRRDLQLHAGFTLRDIAAQYPAVWPTFGELLEPTVDAKFIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYARKHQARGNGFGYGLVDPANPHSVARTLSARYYKDGAEI 379


>gi|148244085|ref|YP_001220322.1| DNA-cytosine methyltransferase [Acidiphilium cryptum JF-5]
 gi|146400648|gb|ABQ29180.1| DNA-cytosine methyltransferase [Acidiphilium cryptum JF-5]
          Length = 487

 Score =  103 bits (256), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 44/123 (35%), Positives = 59/123 (47%), Gaps = 25/123 (20%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRLGDILEEH--------- 46
           + A  + VPQ RER++I  F + + EF F     P P    PRL  IL            
Sbjct: 285 IDAKSW-VPQHRERIFIAGFRDRNAEFTFKTLDIPDP-ASGPRLASILHPEDGTEKPDGH 342

Query: 47  --------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
                   + ++ T+++ LW   Q   E ++ AG GFG+GL         TLSARYYKDG
Sbjct: 343 FTEGPLATVTERYTLTDHLWNYLQNYAEKHRRAGNGFGFGLCGPED-VARTLSARYYKDG 401

Query: 99  SEI 101
           SEI
Sbjct: 402 SEI 404


>gi|291463698|pdb|3LX6|A Chain A, Structure Of Probable Cytosine-Specific Methyltransferase
           From Shigella Flexneri
 gi|291463699|pdb|3LX6|B Chain B, Structure Of Probable Cytosine-Specific Methyltransferase
           From Shigella Flexneri
          Length = 410

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 206 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPXVEAKYIL 264

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG  + N+    T TLSARYYKDG+EI
Sbjct: 265 TPVLWKYLYRYAKKHQARGNGFGYGXVYPNNPQSVTRTLSARYYKDGAEI 314


>gi|304398880|ref|ZP_07380750.1| DNA-cytosine methyltransferase [Pantoea sp. aB]
 gi|304353584|gb|EFM17961.1| DNA-cytosine methyltransferase [Pantoea sp. aB]
          Length = 458

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 52/109 (47%), Gaps = 9/109 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTP----LGIKPRLGDILEEHIDDKSTIS 54
           + A  F +PQ RER+ ++         +F             P L  +LE   DDK  +S
Sbjct: 266 IDARHF-LPQHRERIVLVGIRRDLKKQDFTLRDIRRFYPAQVPSLQSLLERAPDDKYILS 324

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             LW    +  + +K  G GFG+GL   ++      TLSARYYKDGSEI
Sbjct: 325 PVLWRYLYQYAKKHKAKGNGFGFGLNDPHNPDCCVRTLSARYYKDGSEI 373


>gi|212716092|ref|ZP_03324220.1| hypothetical protein BIFCAT_01005 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661459|gb|EEB22034.1| hypothetical protein BIFCAT_01005 [Bifidobacterium catenulatum DSM
           16992]
          Length = 453

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 53/117 (45%), Gaps = 25/117 (21%)

Query: 8   VPQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKPRLGDILE 44
           VPQ RER+YI+ F +   +F +                       P       R  D   
Sbjct: 242 VPQHRERIYIVGFRS-HTDFTWDDLKLPEHKPVLADILHKNDGTEPYLPWDGDRYFDYEH 300

Query: 45  EHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
             + DK T++ +LW+  Q  K  ++  G GFGYGL       + TLSARY+KDGSEI
Sbjct: 301 NKVQDKYTLTPRLWQYLQDYKAKHEAMGHGFGYGLVTP-DMVSRTLSARYHKDGSEI 356


>gi|188533556|ref|YP_001907353.1| DNA cytosine methylase [Erwinia tasmaniensis Et1/99]
 gi|188028598|emb|CAO96460.1| DNA-cytosine methyltransferase [Erwinia tasmaniensis Et1/99]
          Length = 469

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 51/108 (47%), Gaps = 9/108 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGD----ILEEHIDDKSTISN 55
               F +PQ RER+ ++ F        F       + PR       +L+  +++K  ++ 
Sbjct: 275 DGKHF-LPQHRERIVLVGFRRDLQLPAFSLSLLPALYPRQRTPLNALLDSQVEEKYILTP 333

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
            LW+      + ++  G GFGYGL      +    TLSARYYKDGSEI
Sbjct: 334 TLWKYLYHYAKKHQARGNGFGYGLVDPALENGVVRTLSARYYKDGSEI 381


>gi|237732007|ref|ZP_04562488.1| DNA cytosine methylase [Citrobacter sp. 30_2]
 gi|226907546|gb|EEH93464.1| DNA cytosine methylase [Citrobacter sp. 30_2]
          Length = 476

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F     +   P     L ++LE  +D K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLNLKSDFTLRDIVTRYPQRRTTLAELLEPTVDAKYILTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ +     + T TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPGNPDSVTRTLSARYYKDGAEI 378


>gi|290508755|ref|ZP_06548126.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. 1_1_55]
 gi|289778149|gb|EFD86146.1| DNA (cytosine-5-)-methyltransferase [Klebsiella sp. 1_1_55]
          Length = 477

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F           ++P  G++LE   D K  +
Sbjct: 271 IDGRHF-LPQHRERIVLVGFRRDLQLHEGFTLRDIAALYPAVRPTFGELLEPTADAKFIL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +    ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYARKHQARGNGFGYGLVDPGNPHSVARTLSARYYKDGAEI 379


>gi|308187315|ref|YP_003931446.1| DNA cytosine methylase [Pantoea vagans C9-1]
 gi|308057825|gb|ADO09997.1| DNA cytosine methylase [Pantoea vagans C9-1]
          Length = 458

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 52/109 (47%), Gaps = 9/109 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTP----LGIKPRLGDILEEHIDDKSTIS 54
           + A  F +PQ RER+ ++         +F             P L  +LE+  DDK  +S
Sbjct: 266 IDARHF-LPQHRERIVLVGIRRDLKKQDFTLRDIRRFYPAQVPSLQSLLEKAPDDKYILS 324

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             LW    +  + +K  G GFG+GL    +      TLSARYYKDGSEI
Sbjct: 325 PVLWRYLYQYAKKHKAKGNGFGFGLNDPRNPDCCVRTLSARYYKDGSEI 373


>gi|315498495|ref|YP_004087299.1| transcriptional regulator, xre family [Asticcacaulis excentricus CB
           48]
 gi|315416507|gb|ADU13148.1| transcriptional regulator, XRE family [Asticcacaulis excentricus CB
           48]
          Length = 410

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 55/121 (45%), Gaps = 23/121 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEH----------- 46
           + A  F VPQ RER+ I+ F      F +     P     +L  IL              
Sbjct: 218 IDAQHF-VPQHRERIVIVGFREDVP-FSWDDLNLPPKGSVKLSSILHPENAIEEAEPPYT 275

Query: 47  ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
                 +  K T+++KLW   Q   + +K AG GFG+GL       + TLSARYYKDGSE
Sbjct: 276 TGIRAEVASKYTLTDKLWAYLQNYADKHKAAGNGFGFGLVGPGD-VSRTLSARYYKDGSE 334

Query: 101 I 101
           I
Sbjct: 335 I 335


>gi|324112381|gb|EGC06359.1| DNA-cytosine methyltransferase [Escherichia fergusonii B253]
          Length = 473

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G +LE  +D K  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQRPLFGQLLESSVDSKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           S KLW+      + +   G GFG+GL   N+  +   TLSARY+KDGSEI
Sbjct: 334 SPKLWQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 383


>gi|325499566|gb|EGC97425.1| DNA cytosine methylase [Escherichia fergusonii ECD227]
          Length = 473

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G +LE  +D K  +
Sbjct: 275 IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQRPLFGQLLESSVDSKYIL 333

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           S KLW+      + +   G GFG+GL   N+  +   TLSARY+KDGSEI
Sbjct: 334 SPKLWQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 383


>gi|218551294|ref|YP_002385086.1| DNA cytosine methylase [Escherichia fergusonii ATCC 35469]
 gi|218358836|emb|CAQ91493.1| DNA modification methylase [Escherichia fergusonii ATCC 35469]
          Length = 485

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F            +P  G +LE  +D K  +
Sbjct: 287 IDGKHF-LPQHRERIVLVGFRRDLNIHQGFTLRDIDRFYPQQRPLFGQLLESSVDSKYIL 345

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
           S KLW+      + +   G GFG+GL   N+  +   TLSARY+KDGSEI
Sbjct: 346 SPKLWQYLYNYAKKHAAKGNGFGFGLVDPNNANSVARTLSARYHKDGSEI 395


>gi|300724477|ref|YP_003713798.1| DNA cytosine methylase [Xenorhabdus nematophila ATCC 19061]
 gi|297631015|emb|CBJ91699.1| DNA cytosine methylase [Xenorhabdus nematophila ATCC 19061]
          Length = 476

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 58/113 (51%), Gaps = 16/113 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFK-------FPTPLGIKPRLGDILEEHIDDK 50
           +   +F +PQ RER+ ++ F         F        FP     +P L ++L+ ++D K
Sbjct: 275 IDGQNF-LPQHRERIVLVGFRRDLNIHQGFTLRNMNQLFPAQ---RPTLKELLDSNVDKK 330

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             ++  LW+      + ++  G GFG+GL F ++      TLSARY+KDGSEI
Sbjct: 331 YILTPALWKYLYNYAKKHQAKGNGFGFGLVFPDNPNSVARTLSARYHKDGSEI 383


>gi|291085206|ref|ZP_06352388.2| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC
           29220]
 gi|291072321|gb|EFE10430.1| DNA (cytosine-5-)-methyltransferase [Citrobacter youngae ATCC
           29220]
          Length = 476

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +  L D+LE  ++ K  ++  LW+ 
Sbjct: 276 LPQHRERIVLVGFRRDLQLKSDFTLRNIATCYPRRRTTLADLLEPTVEAKYVLTPVLWKY 335

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ +  +    T TLSARYYKDG+EI
Sbjct: 336 LYRYAKKHQARGNGFGYGMVYPGNPDCVTRTLSARYYKDGAEI 378


>gi|121997219|ref|YP_001002006.1| DNA-cytosine methyltransferase [Halorhodospira halophila SL1]
 gi|121588624|gb|ABM61204.1| DNA-cytosine methyltransferase [Halorhodospira halophila SL1]
          Length = 436

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 52/115 (45%), Gaps = 24/115 (20%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPL-----------------GIKPRLGDILEEH 46
           VPQ RER+Y++ F   +     +  FP P                        GD+    
Sbjct: 241 VPQHRERIYMVGFRKDTPFTWNQLDFPAPDARTLREVLHPEDGSEAAEPPYTEGDL--AT 298

Query: 47  IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           + DK  +S KLW+  Q  +  ++ AG GFGY        T  TLSARY+KDGSEI
Sbjct: 299 VGDKYVLSEKLWKYLQDYRAKHEHAGNGFGYSKVGPED-TARTLSARYHKDGSEI 352


>gi|331677842|ref|ZP_08378517.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
 gi|331074302|gb|EGI45622.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
          Length = 320

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 114 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYIL 172

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ + N+    T TLSARYYKDG+EI
Sbjct: 173 TPVLWKYLYRYAKKHQARGNGFGYGMVYPNNPQSVTRTLSARYYKDGAEI 222


>gi|10957343|ref|NP_058367.1| DNA cytosine methylase [Salmonella typhi]
 gi|7800396|gb|AAF69992.1|AF250878_153 EcoRII cytosine methylase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|145849042|emb|CAM91602.1| ecoRII cytosine methylase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 475

 Score =  102 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 56/113 (49%), Gaps = 16/113 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFK-------FPTPLGIKPRLGDILEEHIDDK 50
           +   +F  PQ RER+ ++ F         F        +P+    +P LG++L+  +D +
Sbjct: 271 IDGKNFR-PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPS---RRPTLGELLDAEVDSR 326

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +S KLWE      + ++  G GFG+GL           TLSARYY+DGSEI
Sbjct: 327 YILSPKLWEYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379


>gi|310767946|gb|ADP12896.1| DNA cytosine methylase [Erwinia sp. Ejp617]
          Length = 467

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRL-GDILEEHIDDKSTISN 55
               F +PQ RER+ ++ F        F     P    ++      +L+ H++ K  ++ 
Sbjct: 273 DGKHF-LPQHRERIILVGFRRDLKLPAFSLSALPALYPLQRTPLKALLDSHVEAKYILTP 331

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
            LW+   +  + ++  G GFGYGL      +    TLSARYYKDGSEI
Sbjct: 332 TLWKYLYQYAKKHQARGNGFGYGLVDPVLENGVVRTLSARYYKDGSEI 379


>gi|259908144|ref|YP_002648500.1| DNA cytosine methylase [Erwinia pyrifoliae Ep1/96]
 gi|224963766|emb|CAX55267.1| DNA-cytosine methyltransferase [Erwinia pyrifoliae Ep1/96]
 gi|283478063|emb|CAY73979.1| DNA cytosine methylase [Erwinia pyrifoliae DSM 12163]
          Length = 467

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRL-GDILEEHIDDKSTISN 55
               F +PQ RER+ ++ F        F     P    ++      +L+ H++ K  ++ 
Sbjct: 273 DGKHF-LPQHRERIILVGFRRDLKLPAFSLSALPALYPLQRTPLKALLDSHVEAKYILTP 331

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
            LW+   +  + ++  G GFGYGL      +    TLSARYYKDGSEI
Sbjct: 332 TLWKYLYQYAKKHQARGNGFGYGLVDPALENGVVRTLSARYYKDGSEI 379


>gi|254526757|ref|ZP_05138809.1| modification methylase EcoRII [Prochlorococcus marinus str. MIT
           9202]
 gi|221538181|gb|EEE40634.1| modification methylase EcoRII [Prochlorococcus marinus str. MIT
           9202]
          Length = 298

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/122 (31%), Positives = 59/122 (48%), Gaps = 24/122 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL----GIKPRLGDILEEH---------- 46
           + A  F VPQ R+R+YI+ F   +  F F   +       P L  +L             
Sbjct: 99  INAKSF-VPQNRQRIYIVGFREEN-NFNFDDLIIPDISKGPTLSSVLHPEDGSENFEDPY 156

Query: 47  -------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99
                  +++K TI+NKLW+  +  ++ ++  G GFG+GL         TLSARY+KDG+
Sbjct: 157 TIPHLSKVNEKYTITNKLWDYLKMYEKKHRAKGNGFGFGLCKRED-VARTLSARYHKDGA 215

Query: 100 EI 101
           EI
Sbjct: 216 EI 217


>gi|260752101|ref|YP_003237616.1| putative DNA modification methylase [Escherichia coli O111:H- str.
           11128]
 gi|257767571|dbj|BAI39065.1| putative DNA modification methylase [Escherichia coli O111:H- str.
           11128]
          Length = 475

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 56/113 (49%), Gaps = 16/113 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFK-------FPTPLGIKPRLGDILEEHIDDK 50
           +   +F  PQ RER+ ++ F         F        +P+    +P LG++L+  +D +
Sbjct: 271 IDGKNFR-PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPS---RRPTLGELLDAEVDSR 326

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +S KLWE      + ++  G GFG+GL           TLSARYY+DGSEI
Sbjct: 327 YILSPKLWEYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379


>gi|313651376|gb|EFS15772.1| modification methylase EcoRII [Shigella flexneri 2a str. 2457T]
          Length = 463

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 56/113 (49%), Gaps = 16/113 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFK-------FPTPLGIKPRLGDILEEHIDDK 50
           +   +F  PQ RER+ ++ F         F        +P+    +P LG++L+  +D +
Sbjct: 259 IDGKNFR-PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPS---RRPTLGELLDAEVDSR 314

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +S KLWE      + ++  G GFG+GL           TLSARYY+DGSEI
Sbjct: 315 YILSPKLWEYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 367


>gi|260598469|ref|YP_003211040.1| DNA cytosine methylase [Cronobacter turicensis z3032]
 gi|260217646|emb|CBA31957.1| DNA-cytosine methyltransferase [Cronobacter turicensis z3032]
          Length = 450

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKF---PTP-LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F         F     P      +P  G++L+  +D +  +
Sbjct: 246 IDGKHF-LPQHRERIVLVGFRRDLNLHDGFTLRALPELYPARRPAFGELLDPTVDARYVL 304

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 305 TPTLWKYLYRYAQKHQAKGNGFGYGLVDPQNPASVARTLSARYYKDGAEI 354


>gi|323222338|gb|EGA06720.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
          Length = 259

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 59  LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 118

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 119 LYRYAKKHQARGNGFGYGMVYPDNPGSVARTLSARYYKDGAEI 161


>gi|18466581|ref|NP_569389.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|160431784|ref|YP_001551898.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Choleraesuis]
 gi|16505897|emb|CAD09776.1| putative DNA modification methylase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|159885325|dbj|BAF92929.1| putative DNA modification methylase [Salmonella enterica subsp.
           enterica serovar Choleraesuis]
          Length = 475

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 56/113 (49%), Gaps = 16/113 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFK-------FPTPLGIKPRLGDILEEHIDDK 50
           +   +F  PQ RER+ ++ F         F        +P+    +P LG++L+  +D +
Sbjct: 271 IDGKNFR-PQHRERIVLVGFRRDLKLHDGFSLSGVSALYPS---RRPTLGELLDAEVDSR 326

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +S KLWE      + ++  G GFG+GL           TLSARYY+DGSEI
Sbjct: 327 YILSPKLWEYLYNYAKKHQAKGNGFGFGLVNPLDKSVVCRTLSARYYRDGSEI 379


>gi|226942156|ref|YP_002797230.1| Cytosine-specific methyltransferase [Laribacter hongkongensis
           HLHK9]
 gi|226717083|gb|ACO76221.1| Cytosine-specific methyltransferase [Laribacter hongkongensis
           HLHK9]
          Length = 420

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 55/125 (44%), Gaps = 27/125 (21%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF---PTPLGIKPRLGDILEEH----------- 46
           +    F  PQ RER+ I  F    V F +   P P      L  +L              
Sbjct: 224 IDGAHF-TPQHRERILIAGFR-EPVAFDWDAIPLPPKGSRTLRTVLHRTDGSEPVLPWDG 281

Query: 47  ----------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
                     + DK T++ KLW+  Q   E ++  G GFG+GL   +S  T TLSARYYK
Sbjct: 282 DRFFDHQARCVQDKYTLTPKLWDYLQAYAEKHRAKGNGFGFGLVGPDS-VTRTLSARYYK 340

Query: 97  DGSEI 101
           DGSEI
Sbjct: 341 DGSEI 345


>gi|327394286|dbj|BAK11708.1| modification methylase EcoRII [Pantoea ananatis AJ13355]
          Length = 459

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           + A  F +PQ RER+ ++        S +F             P L  +LE   DDK  +
Sbjct: 266 IDARFF-LPQHRERIVLVGIRRDIAGSAQFSLRDIRQFFPAQVPSLQSLLEPQPDDKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101
           S  LW    +  + +K  G GFG+GL   ++      TLSARYYKDGSEI
Sbjct: 325 SPVLWRYLYQYAKKHKARGNGFGFGLNDPHNVHCCVRTLSARYYKDGSEI 374


>gi|291617874|ref|YP_003520616.1| EcoRIIM [Pantoea ananatis LMG 20103]
 gi|291152904|gb|ADD77488.1| EcoRIIM [Pantoea ananatis LMG 20103]
          Length = 459

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTI 53
           + A  F +PQ RER+ ++        S +F             P L  +LE   DDK  +
Sbjct: 266 IDARFF-LPQHRERIVLVGIRRDIAGSAQFSLRDIRQFFPAQVPSLQSLLEPQPDDKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101
           S  LW    +  + +K  G GFG+GL   ++      TLSARYYKDGSEI
Sbjct: 325 SPVLWRYLYQYAKKHKARGNGFGFGLNDPHNVHCCVRTLSARYYKDGSEI 374


>gi|217980150|ref|YP_002364200.1| DNA-cytosine methyltransferase [Thauera sp. MZ1T]
 gi|217508321|gb|ACK55106.1| DNA-cytosine methyltransferase [Thauera sp. MZ1T]
          Length = 419

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 54/125 (43%), Gaps = 27/125 (21%)

Query: 2   KACDFGVPQRRERLYIIDFLN-PSVEFKFPT---PLGIKPRLGDILEE------------ 45
               F VPQ RER+ I+ F N   + F +     P      + DIL              
Sbjct: 218 DGAHF-VPQHRERILIVGFRNEDGIRFDWDAVGLPQKGVHVMRDILHRTDGTEPVLPWDG 276

Query: 46  ---------HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
                     + DK T++ KLW   Q   + ++  G GFG+GL    S    TLSARYYK
Sbjct: 277 DRFFDHAGRRVQDKYTLTPKLWRYLQDYADKHRAKGNGFGFGLVHPGS-VARTLSARYYK 335

Query: 97  DGSEI 101
           DGSEI
Sbjct: 336 DGSEI 340


>gi|300717257|ref|YP_003742060.1| cytosine-specific methyltransferase [Erwinia billingiae Eb661]
 gi|299063093|emb|CAX60213.1| Cytosine-specific methyltransferase [Erwinia billingiae Eb661]
          Length = 466

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLG----DILEEHIDDKSTIS 54
           +    F +PQ RER+ ++         EF       + P+       ++E  +D K  ++
Sbjct: 272 IDGKHF-LPQHRERIVLVGMRRDLKLPEFTLKALSTLYPKQRIPLRALMEPEVDSKYILT 330

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
             LW+      + ++  G GFGYGL      +    TLSARYYKDGSEI
Sbjct: 331 PTLWKYLYNYAKKHQAKGNGFGYGLVDPQVETGVVRTLSARYYKDGSEI 379


>gi|157145245|ref|YP_001452564.1| DNA cytosine methylase [Citrobacter koseri ATCC BAA-895]
 gi|157082450|gb|ABV12128.1| hypothetical protein CKO_00981 [Citrobacter koseri ATCC BAA-895]
          Length = 477

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L ++LE  ++ +  +
Sbjct: 271 IDGRHF-LPQHRERIVLVGFRRDLNLKTDFTLRDIATRYPQQRITLAELLEPAVEARYVL 329

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYG+ +  +    T TLSARYYKDG+EI
Sbjct: 330 TPVLWKYLYRYAKKHQARGNGFGYGMVYPANPGSVTRTLSARYYKDGAEI 379


>gi|156933419|ref|YP_001437335.1| DNA cytosine methylase [Cronobacter sakazakii ATCC BAA-894]
 gi|156531673|gb|ABU76499.1| hypothetical protein ESA_01237 [Cronobacter sakazakii ATCC BAA-894]
          Length = 481

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFL---NPSVEFKF---PTP-LGIKPRLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F    N    F     P      +P  G++L+  +D +  +
Sbjct: 277 IDGKHF-LPQHRERIVLVGFRRSLNLHDGFTLRALPEFYPARRPAFGELLDPTVDARYVL 335

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
           +  LW+   +  + ++  G GFGYGL    +      TLSARYYKDG+EI
Sbjct: 336 TPTLWKYLYRYAQKHQAKGNGFGYGLVDPQNPASVARTLSARYYKDGAEI 385


>gi|213853126|ref|ZP_03382658.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
          Length = 219

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 9/103 (8%)

Query: 8   VPQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +PQ RER+ ++ F        +F            +P L ++LE  ++ K  ++  LW+ 
Sbjct: 19  LPQHRERIVLVGFRRDLNLKTDFTLRNIARCYPPRRPTLAELLEPVVEAKYILTPVLWKY 78

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             +  + ++  G GFGYG+ + ++      TLSARYYKDG+EI
Sbjct: 79  LYRYAKKHQARGNGFGYGMVYPDNPESVARTLSARYYKDGAEI 121


>gi|209520785|ref|ZP_03269531.1| DNA-cytosine methyltransferase [Burkholderia sp. H160]
 gi|209498782|gb|EDZ98891.1| DNA-cytosine methyltransferase [Burkholderia sp. H160]
          Length = 432

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 51/116 (43%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKPRLGDILEE 45
           PQ RER+ I+ F   +  F +                       P       R  D    
Sbjct: 238 PQHRERIIIVGFRGET-TFTWDDLRLPEQGPRLGAILHRKDGSEPVLPWDHDRFFDHAAR 296

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++ KLW   Q     ++ AG GFG+GL + +S  T TLSARY+KDGSEI
Sbjct: 297 RVQPKYTLTPKLWAYLQNYAAKHRAAGNGFGFGLAYPDS-VTRTLSARYHKDGSEI 351


>gi|261337441|ref|ZP_05965325.1| modification methylase HpaII [Bifidobacterium gallicum DSM 20093]
 gi|270277829|gb|EFA23683.1| modification methylase HpaII [Bifidobacterium gallicum DSM 20093]
          Length = 442

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 57/116 (49%), Gaps = 23/116 (19%)

Query: 8   VPQRRERLYIIDFLNPSV----EFKFPTPLGI------------------KPRLGDILEE 45
           VPQ RER+YI+ F + +     + KFP    I                    +  D   +
Sbjct: 231 VPQHRERIYIVGFCSKTDFTWDDLKFPDHQPILADILHKTDGTEPYLPWDGDKYFDFEHQ 290

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            + DK T++ +LW+  Q  ++ ++  G GFGYGL       + TLSARY+KDGSEI
Sbjct: 291 KVQDKYTLTPRLWQYLQDYRKKHEALGHGFGYGLVTP-DMVSRTLSARYHKDGSEI 345


>gi|170691874|ref|ZP_02883038.1| DNA-cytosine methyltransferase [Burkholderia graminis C4D1M]
 gi|170143158|gb|EDT11322.1| DNA-cytosine methyltransferase [Burkholderia graminis C4D1M]
          Length = 438

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 53/116 (45%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKPRLGDILEE 45
           PQ RER+ II F + + EF F                       P       R  D ++ 
Sbjct: 245 PQHRERIVIIGFRSDT-EFSFDDLRLPATGPRLASILHKTDGSEPLLPHDGERFFDHVQR 303

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   + ++ AG GFG+GL    S  T TLSARY+KDGSEI
Sbjct: 304 KVQPKYTLTPNLWAYLQAYADKHRAAGNGFGFGLVTPAS-VTRTLSARYHKDGSEI 358


>gi|254251049|ref|ZP_04944367.1| Site-specific DNA methylase [Burkholderia dolosa AUO158]
 gi|124893658|gb|EAY67538.1| Site-specific DNA methylase [Burkholderia dolosa AUO158]
          Length = 530

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 51/117 (43%), Gaps = 26/117 (22%)

Query: 9   PQRRERLYIIDFLNPSVEFKF------------------------PTPLGIKPRLGDILE 44
           PQ RER+ I+ F  P+  F +                        P       R  D  +
Sbjct: 331 PQHRERIVIVGFREPTP-FSWESLQLPEKGGIKMKDILHKLDGSEPRLEHDGDRYFDHEK 389

Query: 45  EHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           + ++DK T++  LW+  Q     +K  G GFGYGL         TLSARYYKDGSEI
Sbjct: 390 QKVNDKYTLTPNLWKYLQDYAAKHKAKGNGFGYGLVGPED-IARTLSARYYKDGSEI 445


>gi|323525262|ref|YP_004227415.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1001]
 gi|323382264|gb|ADX54355.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1001]
          Length = 428

 Score =  100 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 50/116 (43%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKPRLGDILEE 45
           PQ RER+ I+ F   +  F F                       P       R  D +  
Sbjct: 235 PQHRERIVIVGFREETG-FSFDDLRLPANGPRLASILHKTDGSEPLLPHDGERFFDHVRR 293

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+GL    S  T TLSARY+KDGSEI
Sbjct: 294 KVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGLVTPAS-VTRTLSARYHKDGSEI 348


>gi|295675907|ref|YP_003604431.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1002]
 gi|295435750|gb|ADG14920.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1002]
          Length = 430

 Score =  100 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 51/116 (43%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKPRLGDILEE 45
           PQ RER+ I+ F   +  F +                       P       R  D    
Sbjct: 236 PQHRERIIIVGFRGKTA-FTWDDLRLPDEGPRLGAILHRTDGTEPVLPWDHDRFFDHATR 294

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++ KLW   Q     ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 295 RVQPKYTLTPKLWAYLQNYAAKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 349


>gi|189423370|ref|YP_001950547.1| DNA-cytosine methyltransferase [Geobacter lovleyi SZ]
 gi|189419629|gb|ACD94027.1| DNA-cytosine methyltransferase [Geobacter lovleyi SZ]
          Length = 415

 Score = 99.7 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/112 (36%), Positives = 52/112 (46%), Gaps = 19/112 (16%)

Query: 8   VPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEH-----------------IDD 49
           VPQ RER+ I+ F   +   F         P+L  IL                    + +
Sbjct: 226 VPQHRERIIIVGFREKTGFSFDSLQLPKEGPKLFSILHPEDGTEQEETPFTVGDKAKVHE 285

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           K  ++N LW   Q     +K AG GFG+GL  +N  T  TLSARYYKDGSEI
Sbjct: 286 KYILTNNLWSYLQAYAAKHKAAGNGFGFGLVGKND-TARTLSARYYKDGSEI 336


>gi|292488627|ref|YP_003531511.1| DNA cytosine methylase [Erwinia amylovora CFBP1430]
 gi|292899788|ref|YP_003539157.1| modification methylase EcoRII [Erwinia amylovora ATCC 49946]
 gi|291199636|emb|CBJ46755.1| modification methylase EcoRII [Erwinia amylovora ATCC 49946]
 gi|291554058|emb|CBA21160.1| DNA cytosine methylase [Erwinia amylovora CFBP1430]
 gi|312172770|emb|CBX81026.1| DNA cytosine methylase [Erwinia amylovora ATCC BAA-2158]
          Length = 469

 Score = 99.7 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/108 (30%), Positives = 49/108 (45%), Gaps = 9/108 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKF-----PTPLGIKPRLGD-ILEEHIDDKSTISN 55
               F +PQ RER+ ++ F        F     P     +      +L+  ++ K  ++ 
Sbjct: 275 DGKHF-LPQHRERIILVGFRRDLKLPAFSLSALPAWYPQQRTPLHALLDTDVEAKYILTP 333

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYKDGSEI 101
            LW+      + ++  G GFGYGL      +    TLSARYYKDGSEI
Sbjct: 334 TLWKYLYHYAKKHQARGNGFGYGLVDPALENGVVRTLSARYYKDGSEI 381


>gi|329298618|ref|ZP_08255954.1| DNA cytosine methylase [Plautia stali symbiont]
          Length = 465

 Score = 99.3 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 48/109 (44%), Gaps = 10/109 (9%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV---EFKFPTP----LGIKPRLGDILEEHIDDKSTIS 54
            A  F +PQ RER+ ++     +     F             P L  +LE     K  +S
Sbjct: 270 DARHF-LPQHRERIVLVGIRRDTGLSEGFSLRALAALYPPEVPALHSLLELQPAAKYILS 328

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATT--NTLSARYYKDGSEI 101
             LW    +  + +K  G GFG+GL    +      TLSARYYKDGSEI
Sbjct: 329 PTLWHYLYQYAKKHKAKGNGFGFGLNDPRNPHCCVRTLSARYYKDGSEI 377


>gi|254429380|ref|ZP_05043087.1| DNA-cytosine methyltransferase superfamily [Alcanivorax sp. DG881]
 gi|196195549|gb|EDX90508.1| DNA-cytosine methyltransferase superfamily [Alcanivorax sp. DG881]
          Length = 435

 Score = 99.3 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/118 (32%), Positives = 53/118 (44%), Gaps = 26/118 (22%)

Query: 8   VPQRRERLYIIDFLNPSVEFKF------------------------PTPLGIKPRLGDIL 43
           VPQ RER+ I+ F  P   F +                        P       R  D  
Sbjct: 244 VPQHRERIAIVGFREPMP-FSWDAMKMAGKGEKRMREVLHREDGSEPYLEWDGDRFFDHG 302

Query: 44  EEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           +  +++K  ++ KLW+  +  K  ++  G GFG+GL   +S    TLSARYYKDGSEI
Sbjct: 303 KGEVNEKYILTPKLWKYLKDYKAKHQAKGNGFGFGLVGPDS-VARTLSARYYKDGSEI 359


>gi|54293106|ref|YP_125521.1| hypothetical protein lpl0145 [Legionella pneumophila str. Lens]
 gi|53752938|emb|CAH14374.1| hypothetical protein lpl0145 [Legionella pneumophila str. Lens]
          Length = 417

 Score = 99.3 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 55/121 (45%), Gaps = 23/121 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEH----IDDKSTI 53
           + A  F VPQ RER++I+ F      F +     P      L  IL       I++K   
Sbjct: 220 IDANGF-VPQHRERIFIVGFREDLP-FSWNDLRLPPKNSVLLESILHPENGTEIEEKPYT 277

Query: 54  -------------SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
                        S+KLW   Q  K+ +   G GFG+GL  E +    TLSARY+KDGSE
Sbjct: 278 FGEKAEVSSCFTLSDKLWNYLQDYKKKHSEKGNGFGFGLVSEKN-IARTLSARYHKDGSE 336

Query: 101 I 101
           I
Sbjct: 337 I 337


>gi|296159065|ref|ZP_06841892.1| DNA-cytosine methyltransferase [Burkholderia sp. Ch1-1]
 gi|295890626|gb|EFG70417.1| DNA-cytosine methyltransferase [Burkholderia sp. Ch1-1]
          Length = 426

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 51/116 (43%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKPRLGDILEE 45
           PQ RER+ I+ F   +  F +                       P       R  D    
Sbjct: 232 PQHRERIIIVGFRGET-SFSWDDLHLPENGPRLGSILHRTDGSEPVLPWDHDRFFDHTSR 290

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 291 RVQPKYTLTPNLWTYLQNYAEKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 345


>gi|126464142|ref|YP_001045255.1| DNA-cytosine methyltransferase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105953|gb|ABN78483.1| DNA-cytosine methyltransferase [Rhodobacter sphaeroides ATCC 17029]
          Length = 417

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/124 (32%), Positives = 58/124 (46%), Gaps = 26/124 (20%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV------EFKFPTPLGIKPRLGDILEE--------- 45
           + A  F VPQ RER++I+             +   P+ +   PR G +L +         
Sbjct: 216 IDARCF-VPQHRERIFIVGVRKDLDMKIDLSKLVLPSGV-TGPRFGTVLHKEDGSELPNN 273

Query: 46  --------HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97
                    + D+ T+S+KLW+  Q   E ++  G GFG+GL         TLSARY+KD
Sbjct: 274 RSFLDPEGRVSDRYTLSDKLWKYLQDYAEKHRQKGNGFGFGL-TRRGDVARTLSARYHKD 332

Query: 98  GSEI 101
           GSEI
Sbjct: 333 GSEI 336


>gi|149184876|ref|ZP_01863193.1| hypothetical protein ED21_17522 [Erythrobacter sp. SD-21]
 gi|148830987|gb|EDL49421.1| hypothetical protein ED21_17522 [Erythrobacter sp. SD-21]
          Length = 410

 Score = 98.9 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/121 (33%), Positives = 58/121 (47%), Gaps = 23/121 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEH----------- 46
           + A  F +PQ RER+ ++ F   S  F +     P+  + R+  +L              
Sbjct: 216 LNARHF-LPQNRERIVLVGFREKSG-FDWADLKLPVEGEARMRSVLHPENGSEIAESHYT 273

Query: 47  ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
                 +  K T+SN LW+  +     ++ AG GFGYGL   +  T  TLSARYYKDGSE
Sbjct: 274 EGELATVSAKYTLSNHLWKYLRDYSAKHRAAGNGFGYGLVGPDD-TCRTLSARYYKDGSE 332

Query: 101 I 101
           I
Sbjct: 333 I 333


>gi|328947602|ref|YP_004364939.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
 gi|328447926|gb|AEB13642.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
          Length = 431

 Score = 98.5 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 52/118 (44%), Gaps = 26/118 (22%)

Query: 8   VPQRRERLYIIDFLNPSVEFKF------------------------PTPLGIKPRLGDIL 43
           VPQ RER+ I+ F N  V+F                          P       +  D  
Sbjct: 233 VPQHRERIVIVGFRN-KVDFSLEDMELPPKGEVKLASILHKTDGTEPRLPQDGDKYFDFE 291

Query: 44  EEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
              + DK T+++ LW   Q   + ++  G GFGYGL  EN     TLSARYYKDGSEI
Sbjct: 292 NNKVLDKYTLTDNLWAYLQAYAQKHRSMGNGFGYGLVNEND-IARTLSARYYKDGSEI 348


>gi|119355933|ref|YP_910577.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides DSM
           266]
 gi|119353282|gb|ABL64153.1| DNA-cytosine methyltransferase [Chlorobium phaeobacteroides DSM
           266]
          Length = 425

 Score = 98.5 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 58/121 (47%), Gaps = 22/121 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFK-FPTPLGIKPRLGDILEEH------------ 46
           + A ++ VPQ RER++I  F       F  F  P G +  + + +               
Sbjct: 218 IDAGNW-VPQHRERIFIAGFREDCGFSFDRFDLPHGNERPVIETILHPENGMEDEEPPYT 276

Query: 47  ------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
                 I D+ T+S+ LWE  QK  E ++  G GFG+GL   +     TLSARYYKDGSE
Sbjct: 277 VGPLARISDRYTLSDHLWEYLQKYAEKHRAKGNGFGFGLVGPHD-VARTLSARYYKDGSE 335

Query: 101 I 101
           I
Sbjct: 336 I 336


>gi|157412142|ref|YP_001481483.1| DNA cytosine methylase [Escherichia coli APEC O1]
 gi|99867167|gb|ABF67812.1| cytosine methylase [Escherichia coli APEC O1]
          Length = 489

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ +I F         F            +P L D+L+  +D K  +S KLWE  
Sbjct: 292 PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPKLWEYL 351

Query: 62  QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
               + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 352 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 393


>gi|226807724|ref|YP_002791420.1| Dcm [Enterobacter cloacae]
 gi|226810038|ref|YP_002791733.1| Dcm [Enterobacter cloacae]
 gi|226425951|gb|ACO54044.1| Dcm [Enterobacter cloacae]
 gi|226426265|gb|ACO54357.1| Dcm [Enterobacter cloacae]
          Length = 489

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ +I F         F            +P L D+L+  +D K  +S KLWE  
Sbjct: 292 PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPKLWEYL 351

Query: 62  QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
               + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 352 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 393


>gi|38347986|ref|NP_941235.1| DNA cytosine methylase [Serratia marcescens]
 gi|190410308|ref|YP_001965811.1| dcm [Klebsiella pneumoniae]
 gi|38259463|emb|CAE51691.1| DNA-cytosine methyltransferase [Serratia marcescens]
 gi|146151102|gb|ABQ02868.1| dcm [Klebsiella pneumoniae]
          Length = 475

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ +I F         F            +P L D+L+  +D K  +S KLWE  
Sbjct: 278 PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPKLWEYL 337

Query: 62  QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
               + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 338 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 379


>gi|187923141|ref|YP_001894783.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN]
 gi|187714335|gb|ACD15559.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN]
          Length = 426

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 50/116 (43%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKPRLGDILEE 45
           PQ RER+ I+ F   +  F +                       P       R  D    
Sbjct: 232 PQHRERIIIVGFRGKTA-FSWDDLRLPQDGPRLGSILHRTDGSEPVLPWDHDRFFDHAGR 290

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+G+ +  S  T TLSARY+KDGSEI
Sbjct: 291 RVQPKYTLTPNLWTYLQNYAEKHRAAGNGFGFGMAYPTS-VTRTLSARYHKDGSEI 345


>gi|307729019|ref|YP_003906243.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1003]
 gi|307583554|gb|ADN56952.1| DNA-cytosine methyltransferase [Burkholderia sp. CCGE1003]
          Length = 428

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 50/116 (43%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKPRLGDILEE 45
           PQ RER+ I+ F   +  F F                       P       R  D +  
Sbjct: 235 PQHRERIVIVGFRQETG-FSFDDLKLPASGPRLASILHKTDGSEPLLPHDGERFFDPVRR 293

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+GL    S  T TLSARY+KDGSEI
Sbjct: 294 SVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGLVTPAS-VTRTLSARYHKDGSEI 348


>gi|327198092|ref|YP_004306459.1| gp47 [Burkholderia phage KL3]
 gi|310657226|gb|ADP02340.1| gp47 [Burkholderia phage KL3]
          Length = 422

 Score = 96.6 bits (239), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 52/116 (44%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKPRLGDILEE 45
           PQ RER+ I+ F   +  F +                       P       R  D  + 
Sbjct: 229 PQHRERIVIVGFRKKTG-FSWDDLRLPADGPRLASILHKTDGSEPVLPWDGERFFDHEKR 287

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 288 KVQSKYTLTPNLWTYLQAYAEKHRAAGNGFGFGMAYPDS-VTRTLSARYHKDGSEI 342


>gi|186476891|ref|YP_001858361.1| DNA-cytosine methyltransferase [Burkholderia phymatum STM815]
 gi|184193350|gb|ACC71315.1| DNA-cytosine methyltransferase [Burkholderia phymatum STM815]
          Length = 428

 Score = 96.6 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/124 (32%), Positives = 54/124 (43%), Gaps = 26/124 (20%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKP 37
           +    F  PQ RER+ +I F   +  F +                       P       
Sbjct: 230 IDGAHF-TPQHRERIIMIGFRART-SFSWDDLRLPEEGPRLASILHRTDGTEPVLPWDGD 287

Query: 38  RLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97
           R  D    H+  K T++ KLW   Q   + ++ AG GFGYG+ +  S  T TLSARY+KD
Sbjct: 288 RFFDHAARHVQPKYTLTPKLWTYLQNYADKHRAAGNGFGYGMAYPQS-VTRTLSARYHKD 346

Query: 98  GSEI 101
           GSEI
Sbjct: 347 GSEI 350


>gi|91782477|ref|YP_557683.1| C-5 cytosine-specific DNA methylase [Burkholderia xenovorans LB400]
 gi|91686431|gb|ABE29631.1| C-5 cytosine-specific DNA methylase [Burkholderia xenovorans LB400]
          Length = 418

 Score = 95.8 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 38/119 (31%), Positives = 51/119 (42%), Gaps = 25/119 (21%)

Query: 6   FGVPQRRERLYIIDFLNPSVEFKF-----------------------PTPLGIKPRLGDI 42
           +  PQ RER+ I+ F   + EF F                       P       R  D 
Sbjct: 228 YFTPQHRERIVIVGFREET-EFTFDDLNVPAEGPRLASILHKTDGSEPVLAHDGDRFFDH 286

Query: 43  LEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
               +  + T++  LW   Q     ++ AG GFG+GL   +S  T TLSARY+KDGSEI
Sbjct: 287 ASREVQPRYTLTANLWAYLQAYAAKHRAAGNGFGFGLVTPDS-VTRTLSARYFKDGSEI 344


>gi|46581246|ref|YP_012054.1| type II DNA modification methyltransferase [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|46450667|gb|AAS97314.1| type II DNA modification methyltransferase, putative [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311234912|gb|ADP87766.1| DNA-cytosine methyltransferase [Desulfovibrio vulgaris RCH1]
          Length = 358

 Score = 95.8 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 58/116 (50%), Gaps = 16/116 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-----------PSVEFKF--PTPLGIKPRLGDILEEHI 47
           + A D+ +PQ RER++++ F                +F F   +  G +  L  ++E  +
Sbjct: 166 IDARDW-IPQHRERIFMVGFRLPEACPAGAQKWDVKDFDFGKVSRRGSQKDLESVIEPDV 224

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
            +K T+    W    + K N+   G+GFGYG+        TT TLSARY+KDG+EI
Sbjct: 225 PEKYTLGPGTWNTLVRHKANHAAKGQGFGYGMITPPFAGQTTRTLSARYHKDGAEI 280


>gi|7636053|emb|CAB88410.1| putative methyltransferase [Serratia marcescens]
          Length = 290

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 9   PQRRERLYIIDFLNP---SVEFKFPTP----LGIKPRLGDILEEHIDDKSTISNKLWEGH 61
           PQ RER+ +I F         F            +P L D+L+  +D K  +S  LWE  
Sbjct: 93  PQHRERIVLIGFRRDLRLKDGFTLRDIKDFYPDKRPSLSDLLDPSVDSKYILSPXLWEYL 152

Query: 62  QKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
               + +   G GFG+GL   +  ++ T TLS+RY KDGSEI
Sbjct: 153 YNYAKKHAAKGNGFGFGLVDPSNVNSVTRTLSSRYMKDGSEI 194


>gi|320156908|ref|YP_004189287.1| DNA-cytosine methyltransferase [Vibrio vulnificus MO6-24/O]
 gi|319932220|gb|ADV87084.1| DNA-cytosine methyltransferase [Vibrio vulnificus MO6-24/O]
          Length = 552

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 51/116 (43%), Gaps = 17/116 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI-------------LEEHI 47
           +   +F  PQ RER+ ++      VE   P    +  +  ++             L E  
Sbjct: 304 IDGMNF-TPQHRERIVLVGVRKDLVEKN-PEYKKLSLKNIEVPQERLRVSDILTDLSEEE 361

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTLSARYYKDGSEI 101
             K T++  LW         ++  G GFG+GL   ++    T TLSARYYKDGSEI
Sbjct: 362 TKKYTLTPNLWNYLYHYALKHQSKGNGFGFGLVDPSNPNAVTRTLSARYYKDGSEI 417


>gi|320331203|gb|EFW87160.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330882725|gb|EGH16874.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 420

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 51/116 (43%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFPTP-----------------------LGIKPRLGDILEE 45
           PQ RER+ I+ F      F +                             + R  D  + 
Sbjct: 228 PQHRERIIIVGFR-EKTGFSWDDLRLPTDGPRLASILHKTDGTERVLPWDEDRFFDHKKR 286

Query: 46  HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  K T++  LW   Q   E ++ AG GFG+G+ F +S  T TLSARY+KDGSEI
Sbjct: 287 VVQPKYTLTPNLWAYLQAYAEKHRAAGNGFGFGMAFPDS-VTRTLSARYHKDGSEI 341


>gi|238898088|ref|YP_002923769.1| DNA cytosine methylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465848|gb|ACQ67622.1| DNA cytosine methylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 401

 Score = 94.3 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 52/116 (44%), Gaps = 25/116 (21%)

Query: 9   PQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEH-------------------- 46
           PQ RER+ I+ F      F +         PRL  IL                       
Sbjct: 208 PQHRERIIIVGFR-EKTGFSWDDLKLPEEGPRLASILHRTDGTEPVLPWDGERFFDHDRR 266

Query: 47  -IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
            +  + T++  LW   Q   + ++ AG GFG+G+ + +S  T TLSARY+KDGSEI
Sbjct: 267 AVPLRYTLTPNLWAYLQAYADKHRAAGNGFGFGIVYPDS-VTRTLSARYHKDGSEI 321


>gi|149926993|ref|ZP_01915251.1| C-5 cytosine-specific DNA methylase [Limnobacter sp. MED105]
 gi|149824214|gb|EDM83434.1| C-5 cytosine-specific DNA methylase [Limnobacter sp. MED105]
          Length = 435

 Score = 93.5 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 44/125 (35%), Positives = 55/125 (44%), Gaps = 27/125 (21%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF---PTPLGIKPRLGDILEE------------ 45
           +    F  PQ RER+ I  F    V F +   P P     +L +IL +            
Sbjct: 238 IDGAHF-TPQHRERILIAGF-ADQVAFDWDAIPLPPKGSRKLKEILHKTDGSEPYLPWDE 295

Query: 46  ---------HIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
                     + DK T++  LW   Q     +K  G GFG+GL    S TT TLSARYYK
Sbjct: 296 NRFFDHDSKKVQDKYTLTPGLWTYLQNYAAKHKAKGNGFGFGLVGPES-TTRTLSARYYK 354

Query: 97  DGSEI 101
           DGSEI
Sbjct: 355 DGSEI 359


>gi|261252209|ref|ZP_05944782.1| DNA-cytosine methyltransferase [Vibrio orientalis CIP 102891]
 gi|260935600|gb|EEX91589.1| DNA-cytosine methyltransferase [Vibrio orientalis CIP 102891]
          Length = 584

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 46/105 (43%), Gaps = 11/105 (10%)

Query: 8   VPQRRERLYIIDFLNPSV---------EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           +PQ RER+ ++                  + PT       +   L +    K T++  LW
Sbjct: 307 LPQHRERVVLVGVRKDLTIDKSKLSLNNIQKPTERVPLKDILCELSDEDSSKYTLTPNLW 366

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDGSEI 101
                    ++  G GFG+GL   ++    T TLSARY+KDGSEI
Sbjct: 367 NYLYNYALKHQTQGNGFGFGLVDPSNINTVTRTLSARYHKDGSEI 411


>gi|255514225|gb|EET90487.1| DNA-cytosine methyltransferase [Candidatus Micrarchaeum acidiphilum
           ARMAN-2]
          Length = 328

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 14/113 (12%)

Query: 1   MKACDFGVPQRRERLYIIDF--LNPSVEFKFPTPLGIKP-----------RLGDILEEHI 47
           + A ++GVPQ+R+R++ I             P P   +            +   +  + +
Sbjct: 156 LNAANYGVPQKRQRIFFIGVNRRQAEKAILPPVPTHSEHPTNGLKPWVPSKQFLLPPQKV 215

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
             +   S ++  G  +RK+ N     GFG+      S  +NT+SARY+KDG+E
Sbjct: 216 SKRFYYSERMINGFIRRKKKNAERNIGFGWQFLD-FSKPSNTISARYWKDGAE 267


>gi|332188292|ref|ZP_08390019.1| DNA-cytosine methyltransferase family protein [Sphingomonas sp.
           S17]
 gi|332011688|gb|EGI53766.1| DNA-cytosine methyltransferase family protein [Sphingomonas sp.
           S17]
          Length = 423

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 28/120 (23%)

Query: 8   VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD-------------------------- 41
           VPQ R+R+ ++ F    V F +   L   P + D                          
Sbjct: 229 VPQHRQRILLVGFQKD-VGFDWEKVLAKMPAVADGPKLASILHREDGTEEEGEDDDRRFI 287

Query: 42  ILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           + +  +  K  ++++LW+  Q   E ++ AG GFG  +      T+ TLSARYYKDGSEI
Sbjct: 288 LADGKVQKKYVLTDRLWQYLQGYAEKHRQAGNGFGCSVVGPKD-TSRTLSARYYKDGSEI 346


>gi|169786848|ref|YP_001700742.1| modification methylase (cytosine-specific
           methyltransferase)(HpaIIM-like) [Acinetobacter baumannii
           SDF]
 gi|169150765|emb|CAP02959.1| modification methylase (Cytosine-specific
           methyltransferase)(HpaIIM-like) [Acinetobacter
           baumannii]
          Length = 366

 Score = 88.9 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 55/94 (58%), Gaps = 4/94 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDD-KSTISNKL 57
           + A DFGVPQ RER++I+ F   +   +F++PTP G K    D+ EE++   K  +SN+ 
Sbjct: 186 INAKDFGVPQNRERIFIVGFHKDTGVHDFEYPTPTGKKVCFADVKEENVVPTKYYLSNQY 245

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
            +  ++ K +++  G GFGY +   +++  N + 
Sbjct: 246 LQTLERHKAHHESKGNGFGYAII-PDNSIANAIV 278


>gi|261400408|ref|ZP_05986533.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
 gi|269209852|gb|EEZ76307.1| modification methylase EcoRII [Neisseria lactamica ATCC 23970]
          Length = 362

 Score = 88.5 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDI-LEEHIDDKSTISNKLW 58
            A DFGVPQ RER++I+ F   +   +FK+P P GI+    DI  ++ +  K  +S +  
Sbjct: 181 NAKDFGVPQNRERIFIVGFRGDTDIKDFKYPEPTGIQTAFRDIREKDTVPTKYYLSTQYI 240

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
           +  +K K+ ++  G GFGY +   +    N + 
Sbjct: 241 DTLRKHKQRHEEKGNGFGYEIIS-DDGIANAIV 272


>gi|225076313|ref|ZP_03719512.1| hypothetical protein NEIFLAOT_01354 [Neisseria flavescens
           NRL30031/H210]
 gi|224952437|gb|EEG33646.1| hypothetical protein NEIFLAOT_01354 [Neisseria flavescens
           NRL30031/H210]
          Length = 359

 Score = 88.5 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 4/94 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDI-LEEHIDDKSTISNKL 57
           + A DFGVPQ RER++I+ F   +   +F++P P+G+K    DI  +E +  K  +S   
Sbjct: 181 INAKDFGVPQNRERIFIVGFHPDTKVNDFEYPKPIGLKTSFSDIREKETVPTKYYLSTVY 240

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
            +  +K KE ++  G GFGY +   +    N + 
Sbjct: 241 IDTLRKHKERHEAKGNGFGYEII-PDDGIANAIV 273


>gi|159027151|emb|CAO86782.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 347

 Score = 88.5 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 44/94 (46%), Gaps = 4/94 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + A  FGVPQ R R++I+ F        F +P P   +  L DILEE  +  K  +SN+ 
Sbjct: 145 LNARYFGVPQNRPRIFIVGFREDLNIYHFSYPQPTHPETCLKDILEEKEVSVKYYLSNQY 204

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
            E   K K  ++  G GFGY +        N + 
Sbjct: 205 LETLFKHKARHENKGNGFGYEIISP-DGIANAIV 237


>gi|313668796|ref|YP_004049080.1| C-5 cytosine-specific DNA-methylase [Neisseria lactamica ST-640]
 gi|313006258|emb|CBN87720.1| C-5 cytosine-specific DNA-methylase [Neisseria lactamica 020-06]
          Length = 362

 Score = 88.5 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 4/93 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDI-LEEHIDDKSTISNKLW 58
            A DFGVPQ RER++I+ F   +   +FK+P P GI+    DI  ++ +  K  +S +  
Sbjct: 181 NAKDFGVPQNRERIFIVGFRGDTDIKDFKYPEPTGIQTAFQDIREKDTVPTKYYLSTQYI 240

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
           +  +K K+ ++  G GFGY +   +    N + 
Sbjct: 241 DTLRKHKQRHEEKGNGFGYEIIS-DDGIANAIV 272


>gi|166368121|ref|YP_001660394.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
 gi|166090494|dbj|BAG05202.1| C-5 cytosine-specific DNA-methylase [Microcystis aeruginosa
           NIES-843]
          Length = 347

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 44/94 (46%), Gaps = 4/94 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + A  FGVPQ R R++I+ F        F +P P   +  L DILEE  +  K  +SN+ 
Sbjct: 145 LNARYFGVPQNRPRIFIVGFREDLNIYHFSYPQPTHQETCLKDILEEKEVSVKYYLSNQY 204

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
            E   K K  ++  G GFGY +        N + 
Sbjct: 205 LETLFKHKARHQHKGNGFGYEIIS-TDGIANAIV 237


>gi|27497145|gb|AAO17336.1| methylase [Neisseria lactamica]
          Length = 384

 Score = 86.6 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 4/93 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDI-LEEHIDDKSTISNKLW 58
            A DFGVPQ RER++I+ F   +    F++P P GI+    DI  ++ +  K  +S +  
Sbjct: 203 NAKDFGVPQNRERIFIVGFRGDTDIKYFEYPEPTGIQTAFRDIREKDTVPTKYYLSTQYI 262

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
           +  +K K+ ++  G GFGY +   +    N + 
Sbjct: 263 DTLRKHKQRHEEKGNGFGYEIIS-DDGIANAIV 294


>gi|309378773|emb|CBX22599.1| putative DNA cytosine methyltransferase [Neisseria lactamica
           Y92-1009]
          Length = 342

 Score = 86.2 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 4/93 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDI-LEEHIDDKSTISNKLW 58
            A DFGVPQ RER++I+ F   +    F++P P GI+    DI  ++ +  K  +S +  
Sbjct: 161 NAKDFGVPQNRERIFIVGFRGDTDIKYFEYPEPTGIQTAFRDIREKDTVPTKYYLSTQYI 220

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
           +  +K K+ ++  G GFGY +   +    N + 
Sbjct: 221 DTLRKHKQRHEEKGNGFGYEIIS-DDGIANAIV 252


>gi|167854713|ref|ZP_02477492.1| cell division protein MukB [Haemophilus parasuis 29755]
 gi|167854127|gb|EDS25362.1| cell division protein MukB [Haemophilus parasuis 29755]
          Length = 361

 Score = 86.2 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDD-KSTISNKL 57
           + A DFGVPQ RER++I+ F        F +P PL  K    D+ E+++   K  +S + 
Sbjct: 181 LNAKDFGVPQNRERIFIVGFRQDLAINSFYYPAPLNRKVCFNDVKEKNVVPTKYYLSTQY 240

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
            E  +K K  ++  G GFGY +   +    N + 
Sbjct: 241 IETLRKHKARHQDKGNGFGYEII-PDDGIANAIV 273


>gi|219870523|ref|YP_002474898.1| Type II modification methyltransferase HpaII/DNA
           (cytosine-5-)-methyltransferase [Haemophilus parasuis
           SH0165]
 gi|219690727|gb|ACL31950.1| Type II modification methyltransferase HpaII/DNA
           (cytosine-5-)-methyltransferase [Haemophilus parasuis
           SH0165]
          Length = 350

 Score = 85.8 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDD-KSTISNKL 57
           + A DFGVPQ RER++I+ F        F +P PL  K    D+ E+++   K  +S + 
Sbjct: 170 LNAKDFGVPQNRERIFIVGFRQDLAINSFYYPAPLNRKVCFNDVKEKNVVPTKYYLSTQY 229

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
            E  +K K  ++  G GFGY +   +    N + 
Sbjct: 230 IETLRKHKARHQDKGNGFGYEII-PDDGIANAIV 262


>gi|254282099|ref|ZP_04957067.1| modification methylase SsoII [gamma proteobacterium NOR51-B]
 gi|219678302|gb|EED34651.1| modification methylase SsoII [gamma proteobacterium NOR51-B]
          Length = 356

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 5/97 (5%)

Query: 8   VPQRRERLYIIDFLNPS----VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           V QRR R +++   N        F+FP        L  +L +  D K T+S+K+W GH+ 
Sbjct: 192 VAQRRVRCFMVAVRNDIAANRGAFEFPKFPEGSIPLRSVLSKEPDPKYTLSDKMWAGHKA 251

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           R   N   G GF   L       +NT+ ARY KD  E
Sbjct: 252 RTIRNVERGTGF-TALEANLDKPSNTIVARYGKDAKE 287


>gi|127459|sp|P15446|MTH2_HAEPA RecName: Full=Modification methylase HpaII; Short=M.HpaII; AltName:
           Full=Cytosine-specific methyltransferase HpaII
 gi|43630|emb|CAA35705.1| unnamed protein product [Haemophilus parainfluenzae]
 gi|305377|gb|AAA20481.1| HpaII modification methyltransferase [Haemophilus parainfluenzae]
          Length = 358

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDI-LEEHIDDKSTISNKLW 58
            A +FGVPQ RER+YI+ F        F +P PL       DI  E+ +  K  +S +  
Sbjct: 177 NAKNFGVPQNRERIYIVGFHKSTGVNSFSYPEPLDKIVTFADIREEKTVPTKYYLSTQYI 236

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
           +  +K KE ++  G GFGY +   +    N + 
Sbjct: 237 DTLRKHKERHESKGNGFGYEII-PDDGIANAIV 268


>gi|149369548|ref|ZP_01889400.1| C-5 cytosine-specific DNA-methylase [unidentified eubacterium
           SCB49]
 gi|149356975|gb|EDM45530.1| C-5 cytosine-specific DNA-methylase [unidentified eubacterium
           SCB49]
          Length = 421

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 4/96 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + A  FGVPQ RER++I+ F        FK+P P   +  L +ILE E +  K  +S   
Sbjct: 241 LNAKKFGVPQNRERIFIVGFRKDLGINNFKYPEPTDTEAILENILEAEEVSVKYYLSEVY 300

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +  +  +  ++  G GFGY +   N+ T N +   
Sbjct: 301 LQTLRNHRARHESKGNGFGYEII-PNNGTANAVVCG 335


>gi|282859944|ref|ZP_06269032.1| DNA (cytosine-5-)-methyltransferase [Prevotella bivia JCVIHMP010]
 gi|282587347|gb|EFB92564.1| DNA (cytosine-5-)-methyltransferase [Prevotella bivia JCVIHMP010]
          Length = 448

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 4/94 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + A +FGVPQ RER+YI+ F        F +P P        DI E   +  K  +S   
Sbjct: 258 LNAANFGVPQHRERVYIVGFRKDLNIKAFNYPMPTDNSKTFADIKEATTVSSKYYLSTTY 317

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
            +     K  +   G GFGY +   ++   N + 
Sbjct: 318 LDTLIAHKARHAAKGHGFGYEIIS-DTGIANAIV 350


>gi|326798326|ref|YP_004316145.1| DNA-cytosine methyltransferase [Sphingobacterium sp. 21]
 gi|326549090|gb|ADZ77475.1| DNA-cytosine methyltransferase [Sphingobacterium sp. 21]
          Length = 409

 Score = 83.5 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 4/95 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDIL-EEHIDDKSTISNKLW 58
            A +FGVPQ RER++I+ +        F++P PL     + DI  EE +  K  +S +  
Sbjct: 230 NAKNFGVPQNRERIFIVGYRKDLGIDRFEYPEPLDEPVAIEDIFEEEEVSVKYYLSTQYL 289

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           +  ++ K  ++  G GFG+ +   N    N +   
Sbjct: 290 KTLKEHKARHESKGNGFGFEII-PNDGIANAVVCG 323


>gi|150026305|ref|YP_001297131.1| Type II modification methyltransferase HpaII [Flavobacterium
           psychrophilum JIP02/86]
 gi|149772846|emb|CAL44330.1| Type II modification methyltransferase HpaII [Flavobacterium
           psychrophilum JIP02/86]
          Length = 425

 Score = 83.5 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDD-KSTISNKLW 58
            A +FGVPQ RER+YI+ F        F++P PL   P    + E+ +   K  +S +  
Sbjct: 240 NAKNFGVPQNRERIYIVGFRQDLNISSFEYPEPLENNPTFESVKEKLVPPTKYYLSTQYV 299

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
           +     K  +   G GFGY +   ++   N + 
Sbjct: 300 QTLINHKARHASKGNGFGYAII-PDNGIANAIV 331


>gi|313892290|ref|ZP_07825883.1| modification methylase HpaII [Dialister microaerophilus UPII 345-E]
 gi|313119428|gb|EFR42627.1| modification methylase HpaII [Dialister microaerophilus UPII 345-E]
          Length = 329

 Score = 83.5 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-EEHIDDKSTISNKL 57
           + + +FGVPQ RER+YI+ F N      F FP     +  L DI+ +E +  +  +S   
Sbjct: 147 LNSKNFGVPQNRERIYIVAFRNDISPENFDFPEGTDTEKTLKDIIEKEEVSSRYYLSETY 206

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                K KE  K  G GFGY +  +  +    +   
Sbjct: 207 LNSLIKHKERQKAKGNGFGYEI-RQMDSVAGAIVCG 241


>gi|169334482|ref|ZP_02861675.1| hypothetical protein ANASTE_00885 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259199|gb|EDS73165.1| hypothetical protein ANASTE_00885 [Anaerofustis stercorihominis DSM
           17244]
          Length = 337

 Score = 83.1 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/84 (36%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + + +FGVPQ RER+YI+ F N     +F FPTP+    ++ DI+EE  +  K  +S+  
Sbjct: 156 LNSRNFGVPQNRERIYIVAFRNDIAPKDFIFPTPIDENKKIKDIMEEKPVSPKYYLSDVY 215

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF 81
            E  +K K  ++  G GFGY +  
Sbjct: 216 LETLRKHKARHEAKGNGFGYEIRD 239


>gi|327403407|ref|YP_004344245.1| DNA-cytosine methyltransferase [Fluviicola taffensis DSM 16823]
 gi|327318915|gb|AEA43407.1| DNA-cytosine methyltransferase [Fluviicola taffensis DSM 16823]
          Length = 422

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 4/96 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDI-LEEHIDDKSTISNKL 57
           M A +FGVPQ RER++I+ F        F++P P+       D+  E+ +  K  +S   
Sbjct: 241 MNAKNFGVPQNRERIFIVGFRKDLNIDSFEYPLPVSKSVTFQDVREEKEVSVKYYLSETY 300

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                K KE +   G GFG+ +   +    N +   
Sbjct: 301 LNTLVKHKERHASKGNGFGFEII-PDDGIANAVVCG 335


>gi|290969050|ref|ZP_06560585.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1
           str. 28L]
 gi|290781006|gb|EFD93599.1| DNA (cytosine-5-)-methyltransferase [Megasphaera genomosp. type_1
           str. 28L]
          Length = 333

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + + DFGVPQ RER+YI+ F        F+FP        + DI+EE     K  +S+  
Sbjct: 147 LNSKDFGVPQNRERIYIVAFREDIAPNTFRFPEKTDDTKVIADIMEEKEPSSKYYLSDVY 206

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
               +K K+ ++  G GFGY +     +    +   
Sbjct: 207 LASLRKHKQRHQAKGNGFGYEI-RGVHSVAGAIVCG 241


>gi|313674544|ref|YP_004052540.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
 gi|312941242|gb|ADR20432.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
          Length = 420

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDI-LEEHIDDKSTISNKL 57
           + A D+GVPQ+RER++I+ F        F++P P        D+  EE +  K  +SN  
Sbjct: 242 INAKDYGVPQKRERIFIVGFRKDLKIETFEYPEPSKSPVSFEDVKEEEPVSVKYYLSNTY 301

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTN 88
               +K K  +   G GFGY +   +    N
Sbjct: 302 LNTLKKHKARHLGKGNGFGYAVI-ADDEIAN 331


>gi|170757755|ref|YP_001781752.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str.
           Okra]
 gi|169122967|gb|ACA46803.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum B1 str.
           Okra]
          Length = 561

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 8/95 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+G+PQ RER++I+          F FP       RL D LE  +D+K  IS K  
Sbjct: 149 LNAKDYGIPQNRERVFIVSIRKDIDTGIFSFPKGFDNGLRLKDFLENEVDEKYYISEKAT 208

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           +G        +   +     +  ++S  + TL  R
Sbjct: 209 QGL------LRALKRPHTPKMLNKDSEYSPTLDTR 237


>gi|291530358|emb|CBK95943.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3]
          Length = 696

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDI-LEEHIDDKSTISNKL 57
           + + +FGVPQ RER+YI+ F N      F FP        L DI     +  K  +S+  
Sbjct: 154 LNSKNFGVPQNRERIYIVAFRNDIAPDNFDFPESTDTNKCLLDIRERNPVPAKYYLSDVY 213

Query: 58  WEGHQKRKENNKIAGKGFGYGL 79
            +  +K K  ++  G GFGY +
Sbjct: 214 VDTLRKHKARHEAKGNGFGYEI 235


>gi|218900598|ref|YP_002449009.1| modification methylase HaeIII [Bacillus cereus G9842]
 gi|218544695|gb|ACK97089.1| modification methylase HaeIII [Bacillus cereus G9842]
          Length = 313

 Score = 81.2 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 43/113 (38%), Gaps = 12/113 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTIS----- 54
           + A D+GVPQ R+R++I+         + +PTP   +    D+   +   K         
Sbjct: 145 LNAADYGVPQTRQRVFIVGVRKDLDLTYSYPTPTHEESPTFDLFNLNALQKWVTIGEALS 204

Query: 55  -----NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR-YYKDGSEI 101
                ++            ++   G+      + +  + T++AR   K G+ I
Sbjct: 205 DIPEPDEAHNLLNHVYSQYRLKFNGYIGHRVTDPNKPSPTITARGDNKGGAVI 257


>gi|10954474|ref|NP_039765.1| DNA cytosine-5 methylase subunit A [Methanothermobacter
           thermautotrophicus]
 gi|266583|sp|P29567|MTHT_METTF RecName: Full=Modification methylase MthTI; Short=M.MthTI; AltName:
           Full=Cytosine-specific methyltransferase MthTI
 gi|44641|emb|CAA48436.1| TIM [Methanothermobacter thermautotrophicus]
 gi|149743|gb|AAA73370.1| TIM [Methanothermobacter thermautotrophicus]
          Length = 330

 Score = 80.8 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 18/96 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ R+R++I+ +    +++F+FP PL  K  L D + +  + K         
Sbjct: 144 LNAKDYGVPQDRKRVFIVGYREDLNLKFEFPKPLNKKVTLRDAIGDLPEPKP-------- 195

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARY 94
                        +  G  L   N    T T S+RY
Sbjct: 196 --------ALEKNRSNGENLEVPNHEYMTGTFSSRY 223


>gi|167751356|ref|ZP_02423483.1| hypothetical protein EUBSIR_02342 [Eubacterium siraeum DSM 15702]
 gi|167655602|gb|EDR99731.1| hypothetical protein EUBSIR_02342 [Eubacterium siraeum DSM 15702]
          Length = 475

 Score = 80.8 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 4/96 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL-EEHIDDKSTISNKL 57
           + + +FGVPQ RER+YI+ F N     +F+FP       R+ DI+ E  +  K  +S+  
Sbjct: 294 LNSKNFGVPQNRERIYIVAFRNDIAPEKFEFPQGNDDTKRIKDIIEENPVPAKYYLSDVY 353

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            E  ++ K  ++  G GFGY            +   
Sbjct: 354 LETLRRHKARHESKGNGFGYE-VRGMEDIAGAIVCG 388


>gi|154484133|ref|ZP_02026581.1| hypothetical protein EUBVEN_01844 [Eubacterium ventriosum ATCC
           27560]
 gi|149735175|gb|EDM51061.1| hypothetical protein EUBVEN_01844 [Eubacterium ventriosum ATCC
           27560]
          Length = 366

 Score = 80.4 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 3/88 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKL 57
           + + DFGVPQ RER+YI+ F     S  F+FP        + DI+EE  +  K  +S   
Sbjct: 164 LNSKDFGVPQNRERIYIVAFRKDINSENFEFPVGNKPDTCIRDIMEEQEVSVKYYLSTTY 223

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSA 85
            E  ++ K  +   G GFGY +   +  
Sbjct: 224 IETLKRHKARHAAKGNGFGYEIRDLDGK 251


>gi|330960632|gb|EGH60892.1| DNA cytosine methylase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 178

 Score = 80.0 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 33  LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
              +P  GD+L++ +D K  ++  LW+   +  E ++  G GFG+GL   N     TLSA
Sbjct: 15  PKQRPSFGDLLDKEVDSKYILTPNLWDYLYRYAEKHRQKGNGFGFGLTRPND-IARTLSA 73

Query: 93  RYYKDGSEI 101
           RY+KDGSEI
Sbjct: 74  RYHKDGSEI 82


>gi|292670064|ref|ZP_06603490.1| modification methylase EcoRII [Selenomonas noxia ATCC 43541]
 gi|292648252|gb|EFF66224.1| modification methylase EcoRII [Selenomonas noxia ATCC 43541]
          Length = 377

 Score = 80.0 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 44/96 (45%), Gaps = 4/96 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE-EHIDDKSTISNKL 57
           + + DFGVPQ RER+YI+ F N   S  F FP        + DI+E E +  K  +S   
Sbjct: 181 LNSKDFGVPQNRERIYIVAFRNDIDSTGFAFPEGHDSNTTIRDIMEAEEVSVKYYLSTVY 240

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
               ++ K +++  G GFGY    E       +   
Sbjct: 241 LASLRRHKAHHEALGHGFGYE-VRELDGQAGAIVCG 275


>gi|113971536|ref|YP_735329.1| DNA-cytosine methyltransferase [Shewanella sp. MR-4]
 gi|113886220|gb|ABI40272.1| DNA-cytosine methyltransferase [Shewanella sp. MR-4]
          Length = 417

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/100 (37%), Positives = 51/100 (51%), Gaps = 8/100 (8%)

Query: 8   VPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEE---HIDDKSTISNKLWEG 60
           V QRR R +++       +    FKFP   G    L D LEE    + ++ TIS++LWEG
Sbjct: 254 VAQRRVRCFMVCVREDVFQEFGAFKFPEFEGEPIPLRDALEELTAELMEEYTISDRLWEG 313

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
           H  R + N   G GF   +    +  +NT+ ARY KDG E
Sbjct: 314 HINRTQRNLDRGTGFTAHVAD-LNRPSNTIVARYGKDGKE 352


>gi|300813374|ref|ZP_07093725.1| Modification methylase HpaII [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300512517|gb|EFK39666.1| Modification methylase HpaII [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 347

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/87 (36%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKL 57
           + + DFGVPQ RER+YI+ F       +F FP        + DI+EE     K  +S+  
Sbjct: 147 INSKDFGVPQNRERIYIVAFREDISPNKFIFPEETDDTKVIADIMEEKETSPKYYLSDVY 206

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
            E  +K K+ +K  G GFGY +   NS
Sbjct: 207 LESLRKHKQRHKAKGNGFGYEIRDVNS 233


>gi|56461628|ref|YP_156909.1| DNA cytosine methylase [Idiomarina loihiensis L2TR]
 gi|56180638|gb|AAV83360.1| DNA cytosine methylase [Idiomarina loihiensis L2TR]
          Length = 419

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 7/96 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ R+R Y++ F      F FP P  IK  +G +LE+   +  +IS  L + 
Sbjct: 240 LNASDFGVPQNRKRFYLVAFDGKDCGFSFPQPPMIKADIGTLLEKGA-EGYSISEHLQKT 298

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           +  +K++ +                   TL + Y+K
Sbjct: 299 YLFKKDDGRPILIDRNT------KGPMRTLVSSYHK 328


>gi|296114006|ref|YP_003627944.1| DNA-cytosine methyltransferase [Moraxella catarrhalis RH4]
 gi|295921700|gb|ADG62051.1| DNA-cytosine methyltransferase [Moraxella catarrhalis RH4]
          Length = 410

 Score = 78.9 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + D+G+PQ RER+++I F N     F+FP P+ ++  + D LE++ D K  +  K  +
Sbjct: 182 LNSKDYGIPQHRERIFVIGFKNKPKNGFEFPQPIELEYTMQDFLEDYTDSKYFLKEKGIK 241

Query: 60  GHQKRKENNKIAGKGFG 76
                K   K   +  G
Sbjct: 242 FVTSSKNRQKRYTQING 258


>gi|213053049|ref|ZP_03345927.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
          Length = 169

 Score = 78.5 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 33  LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTL 90
              +P L ++LE  ++ K  ++  LW+   +  + ++  G GFGYG+ + ++      TL
Sbjct: 1   PPRRPTLAELLEPVVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTL 60

Query: 91  SARYYKDGSEI 101
           SARYYKDG+EI
Sbjct: 61  SARYYKDGAEI 71


>gi|326573696|gb|EGE23654.1| DNA-cytosine methyltransferase [Moraxella catarrhalis O35E]
          Length = 408

 Score = 78.5 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + D+G+PQ RER+++I F N     F+FP P+ ++  + D LE++ D K  +  K  +
Sbjct: 180 LNSKDYGIPQHRERIFVIGFKNKPKNGFEFPQPIELEYTMQDFLEDYTDSKYFLKEKGIK 239

Query: 60  GHQKRKENNKIAGKGFG 76
                K   K   +  G
Sbjct: 240 FVTSSKNRQKRYTQING 256


>gi|213027601|ref|ZP_03342048.1| DNA cytosine methylase [Salmonella enterica subsp. enterica serovar
           Typhi str. 404ty]
          Length = 176

 Score = 78.1 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 33  LGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA--TTNTL 90
              +P L ++LE  ++ K  ++  LW+   +  + ++  G GFGYG+ + ++      TL
Sbjct: 8   PPRRPTLAELLEPVVEAKYILTPVLWKYLYRYAKKHQARGNGFGYGMVYPDNPESVARTL 67

Query: 91  SARYYKDGSEI 101
           SARYYKDG+EI
Sbjct: 68  SARYYKDGAEI 78


>gi|49476998|ref|YP_035184.1| modification methylase HpaII (cytosine-specific methyltransferase
           HpaII) [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|49328554|gb|AAT59200.1| modification methylase HpaII (Cytosine-specific methyltransferase
           HpaII) [Bacillus thuringiensis serovar konkukian str.
           97-27]
          Length = 373

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 14/106 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFL--------NPSVEFKFPT---PLGIKPRLGDILEEHIDD 49
           + + +FGVPQ R R+YI+ F              F  P       I   + D+LE+++ +
Sbjct: 164 LNSRNFGVPQNRPRIYIVGFNQRLYRDKIESMPLFTLPKSRSRKKIYDSVRDVLEDNVGE 223

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
           K  +S    E  +K KE     G GFGY +       +  +N L A
Sbjct: 224 KYYLSEGYLETLKKHKEAQGKKGNGFGYSIVNLPEIENPVSNALLA 269


>gi|2599488|gb|AAB84141.1| FauI DNA methyltransferase [Flavobacterium aquatile]
          Length = 343

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 49/98 (50%), Gaps = 4/98 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFL--NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + +FGVPQ+RER++I+ F   +  + FKFP P+ ++     I+ + + DK   + + W
Sbjct: 165 LNSSEFGVPQKRERVFIVGFRDFDDYLNFKFPQPITLEGSK--IVLKEVIDKKADTEEKW 222

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
              QK  +      +    G   + +   NT+S+   K
Sbjct: 223 FFSQKAVDGMLRVREKMNKGRVQDLNQPCNTISSHLAK 260


>gi|238917714|ref|YP_002931231.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC
           27750]
 gi|238873074|gb|ACR72784.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC
           27750]
          Length = 311

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 35/58 (60%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + D+GVPQ R R YI+ F N +  F+FP    +   L D+LE  +DDK  +S+++ 
Sbjct: 148 LNSADYGVPQTRNRTYIVCFDNQNARFEFPEKKKLNKTLQDLLEPEVDDKYFLSDRIL 205


>gi|157265308|ref|YP_001467867.1| C5 cytosine-specific DNA methylase [Thermus phage P23-45]
 gi|157265426|ref|YP_001467984.1| C5 cytosine-specific DNA methylase [Thermus phage P74-26]
 gi|156905203|gb|ABU96847.1| C5 cytosine-specific DNA methylase [Thermus phage P23-45]
 gi|156905321|gb|ABU96964.1| C5 cytosine-specific DNA methylase [Thermus phage P74-26]
          Length = 368

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 9/101 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRL--GDILEEHIDDKSTISN-K 56
           + A D+GVPQ+RER++I+   +    +F FP P    P++     L   +  K  I + +
Sbjct: 162 LNAADYGVPQKRERVFIVGVRSDLPGDFAFPLPTHANPQVAAKYGLLPWVTAKEAIGDLE 221

Query: 57  LWEGHQKRKENNKIAGKGFGY----GLFFENSATTNTLSAR 93
             +  +    +     K F Y     +   N   + T+ AR
Sbjct: 222 DEDKLRSLPNHEYTKTKFFPYWNQERILNPN-EPSPTILAR 261


>gi|167747653|ref|ZP_02419780.1| hypothetical protein ANACAC_02374 [Anaerostipes caccae DSM 14662]
 gi|239625035|ref|ZP_04668066.1| modification methylase Rho11sI [Clostridiales bacterium 1_7_47_FAA]
 gi|167653015|gb|EDR97144.1| hypothetical protein ANACAC_02374 [Anaerostipes caccae DSM 14662]
 gi|239521421|gb|EEQ61287.1| modification methylase Rho11sI [Clostridiales bacterium 1_7_47FAA]
          Length = 504

 Score = 75.0 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A ++G+PQ RER+Y++       + +F FP P+    RL DILE+ +D+K  +S+   
Sbjct: 158 LNAKNYGIPQNRERVYLVLIKKECDNGKFVFPEPMENGRRLMDILEDEVDEKYYLSDDKV 217

Query: 59  EGHQKRKENNKI 70
           +      +  K 
Sbjct: 218 QKLITDMKERKA 229


>gi|218900599|ref|YP_002449010.1| modification methylase HaeIII [Bacillus cereus G9842]
 gi|218543463|gb|ACK95857.1| modification methylase HaeIII [Bacillus cereus G9842]
          Length = 313

 Score = 75.0 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 43/105 (40%), Gaps = 14/105 (13%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
              D+GVPQ+RER+  I   N  + E++FP P   +    D+  ++   +    +++  G
Sbjct: 143 NLADYGVPQKRERVIFIGVRNDMNFEYEFPMPTHEENPTFDLFNQNALQRWVSISEVLAG 202

Query: 61  HQKRKENNK------------IAGKGFGYGLFFENSATTNTLSAR 93
             +  E++K                  G+ +       + T+ AR
Sbjct: 203 LPEPSEDSKILNHVCSNYKIIENKNFTGHRMINP-DKPSPTILAR 246


>gi|282879499|ref|ZP_06288233.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS
           5C-B1]
 gi|281306646|gb|EFA98672.1| DNA (cytosine-5-)-methyltransferase [Prevotella timonensis CRIS
           5C-B1]
          Length = 438

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + + D+G+PQ RER++ I F +  V+F FP P+ ++ ++ D LE+++D K  +  K  + 
Sbjct: 208 LNSKDYGIPQHRERIFCIGF-HTPVKFAFPAPIPLEYKMYDFLEDYVDTKYFLKEKGIKF 266

Query: 61  HQKRKENNKIAGKGFG 76
               K + K   +  G
Sbjct: 267 VTSHKNHTKCYTQING 282


>gi|288559284|ref|YP_003422770.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1]
 gi|288541994|gb|ADC45878.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1]
          Length = 339

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 40/88 (45%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + + D+GVPQ RER++I+ F +    FKFP P   K  + D+LE+++ D           
Sbjct: 170 LNSKDYGVPQNRERIFIVGFKDNVNTFKFPLPFENKANINDLLEKNVKDHELSGIASDHL 229

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTN 88
            +  +E  K       Y +F      + 
Sbjct: 230 KKHYEEFLKNKKVNKNYPIFATEIRPSR 257


>gi|281420730|ref|ZP_06251729.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205]
 gi|281405022|gb|EFB35702.1| DNA (cytosine-5-)-methyltransferase [Prevotella copri DSM 18205]
          Length = 432

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 17/105 (16%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + +CD+G+PQ RER++ + F     +FK+P P+ ++ ++ D LE++ID K  +  K  + 
Sbjct: 203 LNSCDYGIPQHRERVFCLGFKK-PTDFKYPAPIKLEYKMYDFLEDYIDTKYFLKEKGIKF 261

Query: 61  HQKRK-------------ENNKIAGKGFGYG---LFFENSATTNT 89
               K                +   + F +    ++  +S  T T
Sbjct: 262 VTSHKNREKSYTQINGEVALCQKRNQEFNWHGDFVYHPDSELTPT 306


>gi|146298415|ref|YP_001193006.1| DNA-cytosine methyltransferase [Flavobacterium johnsoniae UW101]
 gi|146152833|gb|ABQ03687.1| DNA-cytosine methyltransferase [Flavobacterium johnsoniae UW101]
          Length = 329

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 9/101 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDF-----LNPSVEFKFPTPLGIKPRLGDIL-EEHIDDK-ST 52
           +   DFG +P  RER++I+ F      +   EF FP    +   + D++ +E +D+K   
Sbjct: 144 LNTKDFGNIPHNRERIFIVAFDKDYIKDDKFEFHFPEKEDLTKSIKDLITKEKVDEKFYY 203

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFEN-SATTNTLSA 92
             +K      +    NK     F      EN S+   TL+A
Sbjct: 204 HEDKYMYDMLRESITNKDRIYQFRRQYVRENKSSVCPTLTA 244


>gi|311064356|ref|YP_003971081.1| cytosine methyl transferase Dcm [Bifidobacterium bifidum PRL2010]
 gi|310866675|gb|ADP36044.1| Dcm Cytosine methyl transferase [Bifidobacterium bifidum PRL2010]
          Length = 326

 Score = 73.5 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 41/103 (39%), Gaps = 13/103 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK---------PRLGDILEEHIDDK 50
           + A D+GVPQ R+R+ I+   N   VEF +P P   K           + + +++  D  
Sbjct: 154 LNAADYGVPQTRQRVIIVGVRNDLDVEFTYPQPTNSKEGKNGLPRWISVQEAIKDIPDPD 213

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
              ++ +           K+  + +      +    + T+ AR
Sbjct: 214 GPDADSVPN---NEYSQYKVKPRNYTGHRITDPDKPSPTILAR 253


>gi|15616070|ref|NP_244375.1| cytosine-specific methyltransferase [Bacillus halodurans C-125]
 gi|10176132|dbj|BAB07227.1| cytosine-specific methyltransferase [Bacillus halodurans C-125]
          Length = 326

 Score = 73.5 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 30/94 (31%), Gaps = 13/94 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+ VPQ RER+ I+ F N     EF FP        L + L +  +          
Sbjct: 146 LNAKDYSVPQNRERVIIVGFRNDLGITEFTFPEKHDKIVTLREALADLPEPSPEDICDA- 204

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                         +   +         + T+ A
Sbjct: 205 ----PYSSRFMSRNRKRNW------DEVSYTIPA 228


>gi|306828113|ref|ZP_07461376.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pyogenes ATCC
           10782]
 gi|304429650|gb|EFM32696.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pyogenes ATCC
           10782]
          Length = 214

 Score = 73.5 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 34/62 (54%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ RER++ +  L     + FP    +  RL D+LEE +D+K  +S +    
Sbjct: 150 LNAKDYGVPQNRERVFCVSILGDHEPYIFPEKQELTIRLKDVLEEDVDEKYYLSEEKTRS 209

Query: 61  HQ 62
            +
Sbjct: 210 IK 211


>gi|291561285|emb|CBL40084.1| DNA-methyltransferase (dcm) [butyrate-producing bacterium SS3/4]
          Length = 247

 Score = 73.5 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + D+GVPQ RER++I+       +  F+FP  + ++  +GD+L+E +  +  +S +  
Sbjct: 153 LNSADYGVPQGRERVFIVSIRKDVDDHSFRFPPVIPLEMCMGDLLDEEVPAEFYLSEEKT 212

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           +   +   N+       G G          T+  R
Sbjct: 213 QSVIRHDSNHPGHIADRGGGRVQPY--CQGTIKTR 245


>gi|16923911|gb|AAL31632.1|AF438204_2 C5 DNA methyltransferase [Positive selection vector pMTet1]
          Length = 418

 Score = 73.1 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  FG+PQ+R+R Y++ FLN ++ F+FP P  I   +G++LE  +    +IS  L + 
Sbjct: 246 LDASHFGIPQKRKRFYLVAFLNQNIHFEFPKPPMISKDIGEVLESDVTG-YSISEHLQKS 304

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           +  +K++ K +                 TL + Y+K
Sbjct: 305 YLFKKDDGKPSLIDKNTTGA------VKTLVSTYHK 334


>gi|127464|sp|P11408|MTM1_MORSP RecName: Full=Modification methylase MspI; Short=M.MspI; AltName:
           Full=Cytosine-specific methyltransferase MspI
 gi|44539|emb|CAA32393.1| unnamed protein product [Moraxella sp.]
          Length = 418

 Score = 73.1 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 7/96 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  FG+PQ+R+R Y++ FLN ++ F+FP P  I   +G++LE  +    +IS  L + 
Sbjct: 246 LDASHFGIPQKRKRFYLVAFLNQNIHFEFPKPPMISKDIGEVLESDVTG-YSISEHLQKS 304

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           +  +K++ K +                 TL + Y+K
Sbjct: 305 YLFKKDDGKPSLIDKNTTGA------VKTLVSTYHK 334


>gi|161869767|ref|YP_001598934.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
 gi|161595320|gb|ABX72980.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
          Length = 411

 Score = 72.7 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K  +
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREKGVK 243

Query: 60  GHQKRKENNKIAGKGFGY 77
                K   K   +  G 
Sbjct: 244 FVTSSKNRQKRYTQINGE 261


>gi|313668701|ref|YP_004048985.1| modification methylase [Neisseria lactamica ST-640]
 gi|313006163|emb|CBN87625.1| putative modification methylase [Neisseria lactamica 020-06]
          Length = 372

 Score = 72.7 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K  +
Sbjct: 145 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREKGVK 204

Query: 60  GHQKRKENNKIAGKGFGY 77
                K   K   +  G 
Sbjct: 205 FVTSSKNRQKRYTQINGE 222


>gi|304387865|ref|ZP_07370039.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|254670653|emb|CBA06706.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha153]
 gi|254672637|emb|CBA06420.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha275]
 gi|261392815|emb|CAX50396.1| putative type II restriction-modification system enzyme Mod
           [Neisseria meningitidis 8013]
 gi|304338130|gb|EFM04266.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|319410190|emb|CBY90526.1| putative type II restriction-modification system enzyme Mod
           [Neisseria meningitidis WUE 2594]
 gi|325134031|gb|EGC56686.1| DNA-cytosine methyltransferase [Neisseria meningitidis M13399]
 gi|325203903|gb|ADY99356.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240355]
          Length = 411

 Score = 72.7 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K  +
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREKGVK 243

Query: 60  GHQKRKENNKIAGKGFGY 77
                K   K   +  G 
Sbjct: 244 FVTSSKNRQKRYTQINGE 261


>gi|325127899|gb|EGC50802.1| DNA-cytosine methyltransferase [Neisseria meningitidis N1568]
          Length = 411

 Score = 72.7 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K  +
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREKGVK 243

Query: 60  GHQKRKENNKIAGKGFGY 77
                K   K   +  G 
Sbjct: 244 FVTSSKNRQKRYTQINGE 261


>gi|121634611|ref|YP_974856.1| putative modification methylase [Neisseria meningitidis FAM18]
 gi|4887086|gb|AAD32180.1|AF125564_2 putative site specific DNA methyltransferase [Neisseria
           meningitidis]
 gi|120866317|emb|CAM10058.1| putative modification methylase [Neisseria meningitidis FAM18]
 gi|325132026|gb|EGC54724.1| DNA-cytosine methyltransferase [Neisseria meningitidis M6190]
 gi|325135954|gb|EGC58564.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579]
 gi|325137780|gb|EGC60355.1| DNA-cytosine methyltransferase [Neisseria meningitidis ES14902]
 gi|325142075|gb|EGC64502.1| DNA-cytosine methyltransferase [Neisseria meningitidis 961-5945]
 gi|325198036|gb|ADY93492.1| DNA-cytosine methyltransferase [Neisseria meningitidis G2136]
 gi|325202381|gb|ADY97835.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149]
 gi|325207867|gb|ADZ03319.1| DNA-cytosine methyltransferase [Neisseria meningitidis NZ-05/33]
          Length = 411

 Score = 72.7 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K  +
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREKGVK 243

Query: 60  GHQKRKENNKIAGKGFGY 77
                K   K   +  G 
Sbjct: 244 FVTSSKNRQKRYTQINGE 261


>gi|167746073|ref|ZP_02418200.1| hypothetical protein ANACAC_00768 [Anaerostipes caccae DSM 14662]
 gi|167654588|gb|EDR98717.1| hypothetical protein ANACAC_00768 [Anaerostipes caccae DSM 14662]
          Length = 312

 Score = 72.7 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 34/58 (58%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           +   D+G+PQ R R YI+ F N + EF+FP    +   L D+LE  +DDK  +S ++ 
Sbjct: 148 LNTADYGIPQTRNRTYIVCFANDNAEFEFPDKQELNLTLQDLLETEVDDKYFLSERIL 205


>gi|323650448|gb|ADX97301.1| M.Fnu4HI [Fusobacterium nucleatum]
          Length = 351

 Score = 72.3 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 7/99 (7%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL-EEHIDDKSTISNK 56
           + A D+G +PQ RER+YI+ F N      F+FP PL +   + D+L + +ID+K   S +
Sbjct: 145 LNAKDYGNIPQNRERIYIVGFKNEEHFKNFEFPFPLELTRNIEDMLEKNNIDEKYYYSKE 204

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
             + +   ++        + +   +     S    TL+A
Sbjct: 205 KNKFYDTLEKEITNENTIYQWRRRYVRENKSNVCPTLTA 243


>gi|288576182|ref|ZP_05978340.2| DNA (cytosine-5-)-methyltransferase [Neisseria mucosa ATCC 25996]
 gi|288566126|gb|EFC87686.1| DNA (cytosine-5-)-methyltransferase [Neisseria mucosa ATCC 25996]
          Length = 406

 Score = 72.3 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + D+G+PQ RER++++ F  P    F+FP  + ++  + D LE++ D K  +  K  +
Sbjct: 179 MNSKDYGIPQHRERIFVVGFHTPPTNGFQFPEKIELEHTMQDFLEDYTDSKYFLREKGVK 238

Query: 60  GHQKRKENNKIAGKGFGY 77
                K   K   +  G 
Sbjct: 239 FVTSSKNRQKRYTQINGE 256


>gi|219855710|ref|YP_002472832.1| hypothetical protein CKR_2367 [Clostridium kluyveri NBRC 12016]
 gi|219569434|dbj|BAH07418.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 419

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           M A +FG+PQRRER+ I+ F       +F FP          + + EH     +IS +L 
Sbjct: 245 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTGYSISKRLQ 304

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           E +  +K++ K     F      +++   NTL A Y+K
Sbjct: 305 ESYLFKKDDGKPQIVDF------DSTIQVNTLVASYHK 336


>gi|256822924|ref|YP_003146887.1| DNA-cytosine methyltransferase [Kangiella koreensis DSM 16069]
 gi|256796463|gb|ACV27119.1| DNA-cytosine methyltransferase [Kangiella koreensis DSM 16069]
          Length = 419

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 48/107 (44%), Gaps = 17/107 (15%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP-----------SVEFKFPTPLGIKPRLGDILEEHID 48
           + + DFG VPQ RER+YII F +            + EF +P P+ +   + D+L++ + 
Sbjct: 239 LNSMDFGDVPQNRERIYIIGFKDEANWQNNKGATRTSEFSWPEPIRLSKSVRDLLDKQVS 298

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
           +      + +  +++ KE        + +   +     +    TL+A
Sbjct: 299 EHYFY--ERFACYKQLKEQMTRKDTVYQWRRVYVRENKNNVCPTLTA 343


>gi|269122857|ref|YP_003305434.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM
           12112]
 gi|268314183|gb|ACZ00557.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM
           12112]
          Length = 329

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/102 (24%), Positives = 42/102 (41%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHID--------DK 50
           + + DFG+PQ+RER+Y++ F        F FP P  +   + D+L    +        D 
Sbjct: 152 LNSLDFGIPQKRERIYMVCFRKDLNIKNFIFPKPFKLSTFVEDLLLPDEEVSNLIINRDD 211

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
             + +K  + +  +       GKG      +       TLSA
Sbjct: 212 LVLKDKEIKENSNKAIRIGTVGKGGQGERIYSPKGIAITLSA 253


>gi|153955289|ref|YP_001396054.1| DNA methylase [Clostridium kluyveri DSM 555]
 gi|146348147|gb|EDK34683.1| Predicted DNA methylase [Clostridium kluyveri DSM 555]
          Length = 416

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           M A +FG+PQRRER+ I+ F       +F FP          + + EH     +IS +L 
Sbjct: 242 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTGYSISKRLQ 301

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           E +  +K++ K     F      +++   NTL A Y+K
Sbjct: 302 ESYLFKKDDGKPQIVDF------DSTIQVNTLVASYHK 333


>gi|218767941|ref|YP_002342453.1| putative modification methylase [Neisseria meningitidis Z2491]
 gi|6900408|emb|CAB72018.1| putative cytosine-specific methyltransferase [Neisseria
           meningitidis]
 gi|121051949|emb|CAM08255.1| putative modification methylase [Neisseria meningitidis Z2491]
          Length = 411

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K  +
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREKGAK 243

Query: 60  GHQKRKENNKIAGKGFGY 77
                K   K   +  G 
Sbjct: 244 FVTSSKNRQKRYTQINGE 261


>gi|15676724|ref|NP_273868.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis MC58]
 gi|7226061|gb|AAF41239.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis MC58]
 gi|308389005|gb|ADO31325.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha710]
 gi|316984499|gb|EFV63467.1| modification methylase HpaII [Neisseria meningitidis H44/76]
 gi|325129944|gb|EGC52743.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304]
 gi|325140023|gb|EGC62552.1| DNA-cytosine methyltransferase [Neisseria meningitidis CU385]
 gi|325206334|gb|ADZ01787.1| DNA-cytosine methyltransferase [Neisseria meningitidis M04-240196]
          Length = 411

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K  +
Sbjct: 184 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREKGAK 243

Query: 60  GHQKRKENNKIAGKGFGY 77
                K   K   +  G 
Sbjct: 244 FVTSSKNRQKRYTQINGE 261


>gi|254303554|ref|ZP_04970912.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148323746|gb|EDK88996.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 492

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + + D+G+PQ RER++++ F        +F+FP P  ++  + D L +++  K  +  K 
Sbjct: 265 LNSKDYGIPQNRERVFVVGFRKDLKLKKKFEFPRPFLLEKTMQDFLLDNVAGKYYLQEKG 324

Query: 58  WEGHQKRKENNKI 70
            +     K  NK 
Sbjct: 325 VDFVTLEKNINKR 337


>gi|315608882|ref|ZP_07883855.1| modification methylase EcoRII [Prevotella buccae ATCC 33574]
 gi|315249409|gb|EFU29425.1| modification methylase EcoRII [Prevotella buccae ATCC 33574]
          Length = 312

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI--KPRLGDILEEHIDDKSTISNKLW 58
           + A DFG+PQ+RER+ I+ F   ++ F FPTP+ I  +  L DILE  +D K  + +K+ 
Sbjct: 147 LNALDFGIPQKRERIIIVGF-KDNILFSFPTPVPISQRKTLKDILEIDVDKKYYVKDKIR 205

Query: 59  EGHQKRKENN 68
           E    R ++ 
Sbjct: 206 ESRLMRLKDP 215


>gi|220930232|ref|YP_002507141.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
 gi|220000560|gb|ACL77161.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
          Length = 416

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 8/98 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           M A +FG+PQRRER+ I+ F       +F FP          + + EH     +IS +L 
Sbjct: 242 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTGYSISKRLQ 301

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           E +  +K++ K     F      +++   NTL A Y+K
Sbjct: 302 ESYLFKKDDGKPQIVDF------DSTIQVNTLVASYHK 333


>gi|325144138|gb|EGC66445.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240013]
 gi|325200491|gb|ADY95946.1| DNA-cytosine methyltransferase [Neisseria meningitidis H44/76]
          Length = 406

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + D+G+PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K  +
Sbjct: 179 MNSKDYGIPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREKGAK 238

Query: 60  GHQKRKENNKIAGKGFGY 77
                K   K   +  G 
Sbjct: 239 FVTSSKNRQKRYTQINGE 256


>gi|261379604|ref|ZP_05984177.1| modification methylase EcoRII [Neisseria subflava NJ9703]
 gi|284798084|gb|EFC53431.1| modification methylase EcoRII [Neisseria subflava NJ9703]
          Length = 320

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 42/100 (42%), Gaps = 9/100 (9%)

Query: 1   MKACDF-GVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           M   ++  +PQ RER++I+ F         +F FP  + +   + DIL++   +     +
Sbjct: 149 MNTAEYANIPQNRERIFIVAFNKDHNFDTSKFDFPKKIKLTKSIHDILDKEKQEDIYYYD 208

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
           K  +   + KE  K     + +   +     +    TL+A
Sbjct: 209 K-SKYISQLKETIKSKDTIYQWRRVYVRENKNKLCPTLTA 247


>gi|127427|sp|P17044|MTBF_BACSU RecName: Full=Modification methylase BsuFI; Short=M.BsuFI; AltName:
           Full=Cytosine-specific methyltransferase BsuFI
 gi|39984|emb|CAA35888.1| unnamed protein product [Bacillus subtilis]
          Length = 409

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 44/98 (44%), Gaps = 8/98 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           M A +FG+PQRRER+ I+ F       +F FP          + + EH     +IS +L 
Sbjct: 241 MDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTGYSISKRLQ 300

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           E +  +K++ K     F            NTL A Y+K
Sbjct: 301 ESYLFKKDDGKPQIVDFRCTY------QVNTLVASYHK 332


>gi|125974805|ref|YP_001038715.1| DNA-cytosine methyltransferase [Clostridium thermocellum ATCC
           27405]
 gi|125715030|gb|ABN53522.1| DNA-cytosine methyltransferase [Clostridium thermocellum ATCC
           27405]
          Length = 334

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 34/93 (36%), Gaps = 13/93 (13%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GVPQ R R+ +  F       +FKFP P   K  L + + +  + K +       
Sbjct: 156 NAADYGVPQDRWRVILYGFRKDLEVKDFKFPEPFPYKVTLREAIGDMPEPKQSDIC---- 211

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            H           +  G+         + T+ A
Sbjct: 212 -HASYSSRYMSRNRKRGW------DEVSYTIPA 237


>gi|1171044|sp|P43420|MTB6_BACSF RecName: Full=Modification methylase Bsp6I; Short=M.Bsp6I; AltName:
           Full=Cytosine-specific methyltransferase Bsp6I
 gi|547481|emb|CAA57293.1| site-specific DNA-methyltransferase (cytosine-specific) [Bacillus
           sp.]
 gi|1098125|prf||2115268B methyltransferase Bsp6IM
          Length = 315

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDI--LEEHIDDKSTISN 55
           + A DFG +PQ RER+YI+ F N      F FP P  +   + D+  L + +DD+   + 
Sbjct: 145 LNAKDFGNIPQNRERIYIVGFRNIEHYKNFNFPMPQPLTLTIKDMINLSDKLDDRFYYTE 204

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                +   +E        + +   +     S    TL+A
Sbjct: 205 DKCSFYSPLQEQMTSDETIYQWRRKYVRENKSNVCPTLTA 244


>gi|223937258|ref|ZP_03629164.1| DNA-cytosine methyltransferase [bacterium Ellin514]
 gi|223894043|gb|EEF60498.1| DNA-cytosine methyltransferase [bacterium Ellin514]
          Length = 408

 Score = 70.8 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER++I+ F +   +E+ FP P           +  +  K    +  WE
Sbjct: 186 LNAADYGVPQFRERVFIVGFRHDLGIEWSFPKPTHSY-------DALVKAKWVTGD-YWE 237

Query: 60  GHQKRKEN 67
            H+  K++
Sbjct: 238 QHKIAKKH 245


>gi|313678561|ref|YP_004056301.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45]
 gi|312950401|gb|ADR24996.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma bovis PG45]
          Length = 315

 Score = 70.4 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 43/99 (43%), Gaps = 7/99 (7%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A D+G +PQ RER+YI+ F +      F FP P+ ++  + D LE ++DD S   +  
Sbjct: 145 LNAKDYGDIPQNRERIYIVGFKDKHSHDAFSFPLPVKLRTSINDCLEVNVDDDSFYYSAD 204

Query: 58  WEGHQKRKENNKIAGKG-FGYGLFF---ENSATTNTLSA 92
                 +           + +   +     +    TL+A
Sbjct: 205 KNVFYSKLAIEIKNSNSIYQWRRKYVRENKNGVCPTLTA 243


>gi|309789605|ref|ZP_07684186.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6]
 gi|308228341|gb|EFO81988.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6]
          Length = 342

 Score = 70.4 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 36/96 (37%), Gaps = 10/96 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  +GVPQ RERL ++        F FP PL  K  +G+ L E +      +    + 
Sbjct: 157 LNAVHYGVPQNRERLIVVGHKGG---FSFPKPLSTKVTVGEALGEMVHS----TPPESKF 209

Query: 61  HQKRKENNKIAGKGFGYGLFFEN---SATTNTLSAR 93
                +      +   Y     +      + TL+ R
Sbjct: 210 LTPSMDAYVAKYERASYCKVPRDLHLDKPSRTLTCR 245


>gi|48243617|gb|AAT40769.1| putative DNA methylase [Haemophilus influenzae]
          Length = 293

 Score = 70.4 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 36/101 (35%), Gaps = 9/101 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTIS----- 54
           + A D+GVPQ R+R+ I+       ++F+FP          D L+  +  K  IS     
Sbjct: 146 LNAADYGVPQTRQRVIIVGIRKDLDIQFEFPKQTHS-KNGNDGLKRWVSIKEAISHLPDP 204

Query: 55  --NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                           K+  + F           + T+ AR
Sbjct: 205 DGENADSVPNNEYSQYKVITRDFTGHRKTSADLPSPTILAR 245


>gi|296126993|ref|YP_003634245.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563]
 gi|296018809|gb|ADG72046.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563]
          Length = 324

 Score = 70.4 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/112 (25%), Positives = 46/112 (41%), Gaps = 15/112 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL----EEHIDDKSTIS 54
           + A D+G+PQ+RER+YI+ F       +F FP P+ +   L D L    +   +     +
Sbjct: 152 LNASDYGIPQKRERIYIVCFRKDLNIKKFDFPKPIELIKHLEDFLLEENQIPNEAYINRN 211

Query: 55  NKLWEGHQK-----RKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           + +    +      +     I  KG      +    +  TLSA    DG  I
Sbjct: 212 DIIMNYIKDDKYSKKSIRLGIINKGGQGERIYSIKGSAITLSA----DGGGI 259


>gi|302671270|ref|YP_003831230.1| DNA-cytosine methyltransferase [Butyrivibrio proteoclasticus B316]
 gi|302395743|gb|ADL34648.1| DNA-cytosine methyltransferase [Butyrivibrio proteoclasticus B316]
          Length = 579

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A D+GVPQ RERL+++ F N     VEF FP  + ++ ++ D L ++      +  K 
Sbjct: 354 LNARDYGVPQNRERLFVVGFRNDLDLDVEFSFPQAIELEKKMQDFLLDNAPGGYFLPEKG 413

Query: 58  WEGHQKRKENNKI 70
            +     K  +K 
Sbjct: 414 VDFVTSEKNLSKR 426


>gi|118138268|pdb|2I9K|A Chain A, Engineered Extrahelical Base Destabilization Enhances
           Sequence Discrimination Of Dna Methyltransferase M.Hhai
          Length = 327

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|325269501|ref|ZP_08136117.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
 gi|324988120|gb|EGC20087.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
          Length = 388

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+G+PQ RERLY + F   + +FK+P P+ ++ ++ D LE++ + +    +K  + 
Sbjct: 180 LNARDYGIPQTRERLYCVGFKKKT-KFKYPAPIPLRYKMYDFLEDYTNSEYFEKDKGVKV 238

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
               +E+ +    G     F +       +  +YY
Sbjct: 239 LTSNEEHRQAIIGGSASERFNDFIFPVREIDDKYY 273


>gi|170719133|ref|YP_001784281.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336]
 gi|168827262|gb|ACA32633.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336]
          Length = 408

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + ++G+PQ RER++++ F  +P   F+FPT + ++  + D LE++ D K  +  K  +
Sbjct: 180 MNSKNYGIPQHRERIFVVGFKTSPKGGFQFPTKIPLERTMQDFLEDYTDSKYFLKEKGIK 239

Query: 60  GHQKRKENNKIAGKGFG 76
                K   K   +  G
Sbjct: 240 FVTSSKNRQKRYTQING 256


>gi|319956919|ref|YP_004168182.1| DNA-cytosine methyltransferase [Nitratifractor salsuginis DSM
           16511]
 gi|319419323|gb|ADV46433.1| DNA-cytosine methyltransferase [Nitratifractor salsuginis DSM
           16511]
          Length = 394

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           +    +G+PQ RER +++ F + +    F+FP  + +K  L D+LE  +D+K  +++K  
Sbjct: 145 LNTKHYGLPQNRERYFLVGFKSKTAGERFRFPKKVPLKLILSDVLENKVDEKYYLTDKAL 204

Query: 59  EGH 61
           E  
Sbjct: 205 EYM 207


>gi|289167787|ref|YP_003446056.1| site-specific DNA methylase [Streptococcus mitis B6]
 gi|288907354|emb|CBJ22191.1| site-specific DNA methylase [Streptococcus mitis B6]
          Length = 346

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 10/99 (10%)

Query: 3   ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNKL 57
           A  +GVPQ+RER++I+      +  F+FP            L  IL++ ID+K   S + 
Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNVEDYTPLKVILQQDIDEKYYFSERA 220

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
            +G    K   K+       G   +    +NT+S+   K
Sbjct: 221 VQGMLNSKSGKKMNK-----GRAQDIEQPSNTVSSHLAK 254


>gi|160877870|pdb|2Z6U|A Chain A, Ternary Structure Of The Glu119ala M.Hhai, C5-Cytosine Dna
           Methyltransferase, With Unmodified Dna And Adohcy
          Length = 327

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|220929948|ref|YP_002506857.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
 gi|220000276|gb|ACL76877.1| DNA-cytosine methyltransferase [Clostridium cellulolyticum H10]
          Length = 338

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 42/103 (40%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKST----IS 54
           + A ++G+PQ RER+Y++ F N      F FP P  +K  + D L E             
Sbjct: 152 LNAVNYGIPQNRERIYMVCFRNDLNIENFNFPKPFPLKRYVEDFLLEDESQVEHLYIQRP 211

Query: 55  NKLWEGHQKRKENNKIA-----GKGFGYGLFFENSATTNTLSA 92
           +  + G +  K +NK        KG      +       TLSA
Sbjct: 212 DTYFNGVEDNKYSNKPIRLGIVNKGGQGERIYSTKGIAITLSA 254


>gi|312281368|ref|YP_004022731.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181897|gb|ADQ42066.1| DNA-cytosine methyltransferase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 319

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 46/98 (46%), Gaps = 6/98 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDIL--EEHIDDKSTISN 55
           + + ++G VPQ RER+YI+ FL+      FKFP P+ +   + DI+   E  D+K     
Sbjct: 146 LNSLEYGNVPQNRERVYIVGFLDKSMYEAFKFPEPVSLTVTIHDIIKPWEKKDEKYYYRE 205

Query: 56  -KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            K +E  ++  ++     +     +         TL+A
Sbjct: 206 GKYYELLKQNVDDPNTVYQIRRIYVRKNKKGVCPTLTA 243


>gi|161761159|pdb|2ZCJ|A Chain A, Ternary Structure Of The Glu119gln M.Hhai, C5-Cytosine Dna
           Methyltransferase, With Unmodified Dna And Adohcy
          Length = 327

 Score = 69.6 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|462658|sp|P34878|MTSB_LACLC RecName: Full=Modification methylase ScrFIB; Short=M.ScrFI-B;
           Short=M.ScrFIB; AltName: Full=Cytosine-specific
           methyltransferase ScrFIB
 gi|149495|gb|AAA16838.1| methyl-5-cytosine methylase [Lactococcus lactis]
 gi|2327032|gb|AAB66694.1| 5-methyl-cytosine-methyltransferase [Lactococcus lactis subsp.
           cremoris]
 gi|739995|prf||2004282A methyl-5-cytosine methyltransferase
          Length = 360

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A DFG+PQ RER++ I  LNP+ +F FP    +   + D+LEE++ +K  + N 
Sbjct: 201 LNARDFGIPQNRERVFCISILNPNEDFTFPQKQNLTLSMNDLLEENVSEKFYLKNN 256


>gi|127455|sp|P05102|MTH1_HAEPH RecName: Full=Modification methylase HhaI; Short=M.HhaI; AltName:
           Full=Cytosine-specific methyltransferase HhaI
 gi|1065144|pdb|1MHT|A Chain A, Covalent Ternary Structure Of Hhai Methyltransferase, Dna
           And S-Adenosyl-L-Homocysteine
 gi|1942412|pdb|3MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With
           Unmodified Dna And Adohcy
 gi|1942415|pdb|4MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Native
           Dna And Adohcy
 gi|2392799|pdb|5MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With
           Hemimethylated Dna And Adohcy
 gi|3660437|pdb|6MHT|A Chain A, Ternary Structure Of Hhai Methyltransferase With Adohcy
           And Dna Containing 4'-Thio-2'deoxycytidine At The Target
 gi|4139672|pdb|7MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX
 gi|4139675|pdb|8MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX
 gi|4139680|pdb|9MHT|A Chain A, Cytosine-Specific Methyltransferase HhaiDNA COMPLEX
 gi|4558252|pdb|10MH|A Chain A, Ternary Structure Of Hhai Methyltransferase With Adohcy
           And Hemimethylated Dna Containing
           5,6-Dihydro-5-Azacytosine At The Target
 gi|4699814|pdb|2HMY|B Chain B, Binary Complex Of Hhai Methyltransferase With Adomet
           Formed In The Presence Of A Short Nonpsecific Dna
           Oligonucleotide
 gi|24158912|pdb|1M0E|A Chain A, Zebularine: A Novel Dna Methylation Inhibitor That Forms A
           Covalent Complex With Dna Methyltransferase
 gi|52695513|pdb|1SKM|A Chain A, Hhai Methyltransferase In Complex With Dna Containing An
           Abasic South Carbocyclic Sugar At Its Target Site
 gi|85544385|pdb|2C7O|A Chain A, Hhai Dna Methyltransferase Complex With 13mer
           Oligonucleotide Containing 2-Aminopurine Adjacent To The
           Target Base (Pcgc:gmgc) And Sah
 gi|85544388|pdb|2C7P|A Chain A, Hhai Dna Methyltransferase Complex With Oligonucleotide
           Containing 2-Aminopurine Opposite To The Target Base (
           Gcgc:gmpc) And Sah
 gi|85544391|pdb|2C7Q|A Chain A, Hhai Dna Methyltransferase Complex With Oligonucleotide
           Containing 2-Aminopurine Outside The  Recognition
           Sequence (Paired With G) And Sah
 gi|116667789|pdb|2HR1|A Chain A, Ternary Structure Of Wt M.Hhai C5-Cytosine Dna
           Methyltransferase With Unmodified Dna And Adohcy
 gi|157831356|pdb|1HMY|A Chain A, Crystal Structure Of The Hhal Dna Methyltransferase
           Complexed With S-Adenosyl-L-Methionine
 gi|290560089|pdb|3EEO|A Chain A, M. Hhai Co-Crystallized With Synthetic Dsdna Containing A
           Propane Diol In Place Of The Deoxycytidine Residue
           Targeted For Methylation.
 gi|148949|gb|AAA24989.1| DNA methylase [Haemophilus haemolyticus]
          Length = 327

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|148988377|ref|ZP_01819824.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pneumoniae
           SP6-BS73]
 gi|147926058|gb|EDK77132.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pneumoniae
           SP6-BS73]
          Length = 343

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 10/99 (10%)

Query: 3   ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNKL 57
           A  +GVPQ+RER++I+      +  F+FP            L  IL++ ID+K   S + 
Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNVEDYTPLKVILQQDIDEKYYFSERA 220

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
            +G    K   K+       G   +    +NT+S+   K
Sbjct: 221 VQGMLNSKSGKKMNK-----GRAQDIEQPSNTVSSHLAK 254


>gi|159026805|emb|CAO86650.1| ngoBIM [Microcystis aeruginosa PCC 7806]
          Length = 331

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FG+PQ+RER++I+ F   +  F +P P   +  L +ILEE++ D    S K+ + 
Sbjct: 156 LNALNFGLPQKRERIFIVGFR-EARGFIWPKPALSRTSLTEILEENVSDFYYASEKIQKS 214

Query: 61  HQKRKENNKIAGKGFGYG 78
              ++E  K   +   + 
Sbjct: 215 RLLKREGKKPYSEPTIWH 232


>gi|254443346|ref|ZP_05056822.1| C-5 cytosine-specific DNA methylase superfamily [Verrucomicrobiae
           bacterium DG1235]
 gi|198257654|gb|EDY81962.1| C-5 cytosine-specific DNA methylase superfamily [Verrucomicrobiae
           bacterium DG1235]
          Length = 349

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHID-DKSTISNKL 57
           +KA DFG+ Q+RER++I+ F        F +P     + ++ DILE      +  ++ K 
Sbjct: 176 LKASDFGLAQKRERVFIVGFRKSLGVEGFSYPEKGNDRSKISDILEPSHSVGQWLLTKKS 235

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
               +      K+AG G GY +  EN 
Sbjct: 236 LACLRDHSSKQKLAGNGHGYAILDENE 262


>gi|159795737|pdb|2Z6A|A Chain A, S-Adenosyl-L-Methionine-Dependent Methyl Transfer:
           Observable Precatalytic Intermediates During Dna
           Cytosine Methylation
          Length = 327

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|189096062|pdb|2UYH|A Chain A, Hhai Dna Methyltransferase S87q-Q237s Mutant Complex With
           13mer Gcgc-Gmgc Oligonucleotide And Sah
          Length = 327

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGSGERIYSTRGIAITLSA 253


>gi|296114087|ref|YP_003628025.1| cytosine-specific methyltransferase [Moraxella catarrhalis RH4]
 gi|295921781|gb|ADG62132.1| cytosine-specific methyltransferase [Moraxella catarrhalis RH4]
 gi|326560672|gb|EGE11040.1| cytosine-specific methyltransferase [Moraxella catarrhalis 46P47B1]
          Length = 318

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 43/99 (43%), Gaps = 8/99 (8%)

Query: 1   MKACDF-GVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           M   ++  +PQ RER++II F      S+ F+FP  + +   + DIL+    D+S     
Sbjct: 147 MNTSEYANIPQNRERIFIIAFDKNIFKSINFEFPNKIPLTKTIHDILDNKKQDESFYY-H 205

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
             + HQK K   +     + +   +          TL+A
Sbjct: 206 KSKYHQKLKLEMQNKDTIYQWRRVYVRENKHGLCPTLTA 244


>gi|327463103|gb|EGF09424.1| modification methylase ScrFIA [Streptococcus sanguinis SK1]
          Length = 346

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 10/99 (10%)

Query: 3   ACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDILEEHIDDKSTISNKL 57
           A  +GVPQ+RER++I+      +  F+FP            L  IL+++ID+K   S + 
Sbjct: 161 ATKYGVPQKRERVFIVGIRKDLNFTFEFPEEPIQNEEDYTPLKAILQKNIDEKYYFSERA 220

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
            +G    K   K+       G   +    +NT+S+   K
Sbjct: 221 VKGMLNSKSGKKMNK-----GRAQDIERPSNTVSSHLAK 254


>gi|5420107|emb|CAB46561.1| cytosine-specific methyltransferase [Streptococcus thermophilus]
          Length = 316

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISN 55
           M A D+G +PQ RER+YI+ F +     +F  P  + ++  + D+++    +DDK   + 
Sbjct: 145 MNAADYGNIPQNRERIYIVAFRDKEDYADFDLPKSIPLETSIKDVIDFDSKVDDKFYYTA 204

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTN---TLSA 92
           +  +   + KEN   +   + +   +     +N   TL+A
Sbjct: 205 EKNKFFDELKENMTKSDTTYQWRRVYVRENKSNLVPTLTA 244


>gi|313677762|ref|YP_004055758.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
 gi|312944460|gb|ADR23650.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
          Length = 378

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 4/97 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A ++GVPQ+RER++II F N      F FP P  +      +  + + DK    ++ W 
Sbjct: 166 NASEYGVPQKRERVFIIGFKNYEDFAYFNFPQPTTLNDSKVKL--KEVIDKKANKDEKWF 223

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
             Q+  +      K    G         NT+S+   K
Sbjct: 224 FSQRAVDGMMRVQKKMNKGRDQNLEEPCNTISSHLAK 260


>gi|169823657|ref|YP_001691160.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328]
 gi|167832277|dbj|BAG09192.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328]
          Length = 332

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHI--DDKSTISN 55
           + A +FG +PQ RER+YI+ F + +    F+FP P+ +   + D ++     D     + 
Sbjct: 147 LNATEFGNIPQNRERIYIVAFRDKNCLDNFEFPKPIELTTTIRDFIDFENKKDTSFYYTE 206

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFEN---SATTNTLSA 92
           K ++ + + K         + +   +     S    TL+A
Sbjct: 207 KSFKQYDELKFGMDEQDTVYQWRRKYVRKNMSGVCPTLTA 246


>gi|317497298|ref|ZP_07955621.1| C-5 cytosine-specific DNA methylase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|316895367|gb|EFV17526.1| C-5 cytosine-specific DNA methylase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 363

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 36/56 (64%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+GVPQ RER++ I  LN   +F+FP    +K +L DILE+++D K  + N 
Sbjct: 204 LNARDYGVPQNRERVFCISELNGENKFEFPKSRELKLKLYDILEKNVDSKYYLKNN 259


>gi|254933776|ref|ZP_05267135.1| DNA-cytosine methyltransferase [Listeria monocytogenes HPB2262]
 gi|293585336|gb|EFF97368.1| DNA-cytosine methyltransferase [Listeria monocytogenes HPB2262]
          Length = 325

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 40/88 (45%), Gaps = 2/88 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+G+PQ RER++++  L  + EF+FP  +     L D ++  +D  +   ++  + 
Sbjct: 143 LNARDYGIPQNRERVFVVSVLGNNKEFQFPEKVKPVKSLKDYIDFDVDPTAYALSENEKQ 202

Query: 61  HQKR--KENNKIAGKGFGYGLFFENSAT 86
              R  K+         G+    +  + 
Sbjct: 203 LFFREGKQLFIHTNTKIGFQEVEQFDSV 230


>gi|291551321|emb|CBL27583.1| DNA-methyltransferase (dcm) [Ruminococcus torques L2-14]
          Length = 595

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + + ++G+PQ RERL+++ F        +F FP P+ ++ ++ D L ++      +  K 
Sbjct: 368 LNSKNYGIPQNRERLFVVGFREDLELAKKFSFPNPIPLRKKMKDFLMDNAPGGYFLPKKG 427

Query: 58  WEGHQKRKENNKI 70
            E   K K  +K 
Sbjct: 428 VEFVTKEKNLSKR 440


>gi|323968854|gb|EGB64190.1| DNA-cytosine methyltransferase [Escherichia coli TA007]
          Length = 272

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 4/57 (7%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           A DFGVPQ RER+YI+ F    V     F FPTPL  K R+GDILE+ +D+K T+S+
Sbjct: 215 AKDFGVPQNRERIYIVGFNKEKVRNHEHFTFPTPLKTKTRVGDILEKSVDNKYTLSD 271


>gi|228899601|ref|ZP_04063856.1| Modification methylase SinI [Bacillus thuringiensis IBL 4222]
 gi|228860031|gb|EEN04436.1| Modification methylase SinI [Bacillus thuringiensis IBL 4222]
          Length = 362

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 13/76 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIK---------PRLGDILEEHIDDK 50
           + A ++GVPQ+RER++II       + F+FP P   +           +G++L+    ++
Sbjct: 171 LNAANYGVPQKRERVFIIGIRQDLKKTFEFPEPTHNELGSDGKESWVTVGEVLKNLKVEE 230

Query: 51  S---TISNKLWEGHQK 63
               T S +  +  + 
Sbjct: 231 HHFQTYSPERLKYMKM 246


>gi|332310450|gb|EGJ23545.1| DNA-methyltransferase (Dcm) [Listeria monocytogenes str. Scott A]
          Length = 325

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 40/88 (45%), Gaps = 2/88 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+G+PQ RER++++  L  + EF+FP  +     L D ++  +D  +   ++  + 
Sbjct: 143 LNARDYGIPQNRERVFVVSVLGNNKEFQFPEKVKPVKSLKDYIDFDVDPTAYALSENEKQ 202

Query: 61  HQKR--KENNKIAGKGFGYGLFFENSAT 86
              R  K+         G+    +  + 
Sbjct: 203 LFFREGKQLFIHTNTKIGFQEVEQFDSV 230


>gi|325913633|ref|ZP_08175995.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B]
 gi|325476992|gb|EGC80142.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B]
          Length = 372

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 51/98 (52%), Gaps = 9/98 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           ++A DFG+ Q R+R+ I+ F +   +  F+FP        + DILE++  +   IS KL 
Sbjct: 199 LEASDFGLAQSRKRVIIVGFRSDIDDSSFEFPKGNSKHVAVKDILEDNP-EGYPISKKLQ 257

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           E +  +K++ +       Y +   ++    TL++ Y+K
Sbjct: 258 ENYLFKKDDGRP------YVVDKNSTGLAKTLNSSYHK 289


>gi|291320332|ref|YP_003515594.1| modification methylase Bsp6I [Mycoplasma agalactiae]
 gi|290752665|emb|CBH40638.1| Modification methylase Bsp6I [Mycoplasma agalactiae]
          Length = 315

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 7/99 (7%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDK--STISN 55
           + A D+G +PQ RER+YI+ F +      F FP P+ +K  L D LE ++DD      ++
Sbjct: 145 LNAKDYGDIPQNRERIYIVGFKDKHSYDIFSFPLPVKLKTSLNDCLEVNVDDDCFYYSAD 204

Query: 56  KLWEGHQKR-KENNKIAGKGFGYGLFFEN-SATTNTLSA 92
           K    ++   +  N  +   +      EN +    TL+A
Sbjct: 205 KNVFYNKLALEIKNVDSIYQWRRKYVRENKNGVCPTLTA 243


>gi|308185227|ref|YP_003929360.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori SJM180]
 gi|308061147|gb|ADO03043.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori SJM180]
          Length = 317

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 14/101 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   DFG+PQ+R R++I+     S    EF FP  +  K    D+L++ ++ K  IS K+
Sbjct: 141 LNTLDFGIPQQRNRVFIVALRKNSFTNLEFVFPAKIPCKISTLDLLDKQVELKYFISQKM 200

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFE--NSATTNTLSARYYK 96
            +            GKG    +     ++    TL+A  +K
Sbjct: 201 IKTIL---------GKGTKGYIVEPSIDTPIAKTLTATMHK 232


>gi|111607698|gb|ABH10736.1| DNA methyltransferase [Flavobacterium sp. 4H]
          Length = 408

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 40/100 (40%), Gaps = 8/100 (8%)

Query: 1   MKACDF-GVPQRRERLYIIDFL----NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + +     VPQ RER++I+ F         +F+FP P+ +   + D L++   D      
Sbjct: 238 LNSATHANVPQNRERIFIVAFDPKQVKNYSKFEFPKPIKLTKTIHDFLDKEKQDDIFYYK 297

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
           K  + + +  +        + +   +     S    TL+A
Sbjct: 298 KDHQYYPELVKTMISKDTVYQWRRVYARENKSNLCPTLTA 337


>gi|293596744|ref|ZP_05263998.2| DNA-methyltransferase [Listeria monocytogenes J2818]
 gi|293592003|gb|EFG00338.1| DNA-methyltransferase [Listeria monocytogenes J2818]
          Length = 327

 Score = 68.5 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 38/88 (43%), Gaps = 2/88 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ RER++++  L  +  F+FP  +     L D ++  +D      ++  + 
Sbjct: 150 LNARDFGIPQNRERVFVVSVLGNNTGFQFPEKIESAMSLKDYIDFEVDPTDYALSENEKQ 209

Query: 61  HQKRK--ENNKIAGKGFGYGLFFENSAT 86
              R+  +         G+    +  + 
Sbjct: 210 LFFRENNKLFIHTNTKKGFQEVEQFDSV 237


>gi|254901064|ref|ZP_05260988.1| DNA-methyltransferase (cytosine-specific) [Listeria monocytogenes
           J0161]
          Length = 320

 Score = 68.1 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 38/88 (43%), Gaps = 2/88 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ RER++++  L  +  F+FP  +     L D ++  +D      ++  + 
Sbjct: 143 LNARDFGIPQNRERVFVVSVLGNNTGFQFPEKIESAMSLKDYIDFEVDPTDYALSENEKQ 202

Query: 61  HQKRK--ENNKIAGKGFGYGLFFENSAT 86
              R+  +         G+    +  + 
Sbjct: 203 LFFRENNKLFIHTNTKKGFQEVEQFDSV 230


>gi|237742049|ref|ZP_04572530.1| modification methylase HpaII [Fusobacterium sp. 4_1_13]
 gi|229429697|gb|EEO39909.1| modification methylase HpaII [Fusobacterium sp. 4_1_13]
          Length = 385

 Score = 68.1 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 12/102 (11%)

Query: 3   ACDFGVPQRRERLYIIDFLNP---SVEFKF-PTPL-----GIKPRLGDILEEHIDDKSTI 53
           A DFG+PQRR R YII F         F   P P       I   L D+LE   D K  +
Sbjct: 170 AKDFGIPQRRLRTYIIGFRKDLLQDNNFILEPLPKNRTDLKIYKNLNDLLEFQNDIKYYV 229

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFE---NSATTNTLSA 92
           ++   +  ++ K  + + G GFG+ +       +   NT+ A
Sbjct: 230 ASGYLKTLERHKLKHSLKGNGFGFEVVNAPNIKNPIANTILA 271


>gi|50513617|pdb|1SVU|A Chain A, Structure Of The Q237w Mutant Of Hhai Dna
           Methyltransferase: An Insight Into Protein-Protein
           Interactions
 gi|50513618|pdb|1SVU|B Chain B, Structure Of The Q237w Mutant Of Hhai Dna
           Methyltransferase: An Insight Into Protein-Protein
           Interactions
          Length = 327

 Score = 68.1 bits (165), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGWGERIYSTRGIAITLSA 253


>gi|166367724|ref|YP_001659997.1| modification methylase NgoBI [Microcystis aeruginosa NIES-843]
 gi|166090097|dbj|BAG04805.1| modification methylase NgoBI [Microcystis aeruginosa NIES-843]
          Length = 330

 Score = 68.1 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FG+PQ+RER++I+ F   +  F +P P   +  L +ILEE++ D    S ++ + 
Sbjct: 156 LNALNFGLPQKRERIFIVGFR-EARGFIWPKPALSRTTLTEILEENVSDFYYASARIQKS 214

Query: 61  HQKRKENNKIAGKGFGYG 78
              ++E  K   +   + 
Sbjct: 215 RFLKREGKKPYSEPTIWH 232


>gi|310657624|ref|YP_003935345.1| cytosine-specific methyltransferase [Clostridium sticklandii DSM
           519]
 gi|308824402|emb|CBH20440.1| Cytosine-specific methyltransferase [Clostridium sticklandii]
          Length = 326

 Score = 68.1 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 14/102 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPL----GIKPRLGDILEEHIDDKSTISN 55
           M + +FGVPQ+RER+ II F      EF FP  +         L  ++E  + +K   S 
Sbjct: 154 MNSVNFGVPQKRERVIIIGFRKDLELEFNFPEEIIANEWEFLNLSMVIESEVSEKYFFSE 213

Query: 56  KLWEG-HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           K  +G  +KR   NK   +          +   NT+ A   K
Sbjct: 214 KAVQGMLKKRATMNKGRAQDI--------NKPCNTVGAHLAK 247


>gi|255279955|ref|ZP_05344510.1| modification methylase EcoRII [Bryantella formatexigens DSM 14469]
 gi|255269728|gb|EET62933.1| modification methylase EcoRII [Bryantella formatexigens DSM 14469]
          Length = 311

 Score = 67.7 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + DFGVPQ R R Y++ F N   EF FP    ++  L D+LE+ + +K  +S ++ 
Sbjct: 148 LNSADFGVPQTRNRTYLVCFSNQKAEFTFPQTEPLESTLQDLLEQDVAEKYFLSERII 205


>gi|254003164|ref|YP_003052630.1| C-5 cytosine-specific DNA methylase [Methylovorus sp. SIP3-4]
 gi|253987247|gb|ACT52103.1| C-5 cytosine-specific DNA methylase [Methylovorus sp. SIP3-4]
          Length = 550

 Score = 67.7 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 6/99 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEHIDDKSTISNKL 57
           +   ++G  + R+R  ++   +  +EF F     P     RLGD+LEE   D    +   
Sbjct: 285 LNGKEWGTLENRDRWVMVAVTHG-IEFDFSQLIPPDARPMRLGDVLEEVPLDDPRWNK-- 341

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
            +  + ++  +   GK F   +F E+S    TL+  Y K
Sbjct: 342 MQYLKDKEVRDAAEGKNFKMQIFTEDSEHIGTLTKGYAK 380


>gi|113477918|ref|YP_723979.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101]
 gi|110168966|gb|ABG53506.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101]
          Length = 337

 Score = 67.7 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 37/97 (38%), Gaps = 12/97 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL----EEHIDDKSTISNK 56
           +   DFGVPQ R+R+ +I        F FP  L  K  +G+ L         +   ++  
Sbjct: 155 LNTVDFGVPQNRQRVIVIGHKGE---FTFPQVLDKKVTVGEALEEMAFHAPPESKFLTPS 211

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           + +  +K ++ +        Y           TL+ R
Sbjct: 212 MDKYIEKYEKASSCKQPRDLY-----LDKPARTLTCR 243


>gi|148826164|ref|YP_001290917.1| modification methylase [Haemophilus influenzae PittEE]
 gi|148716324|gb|ABQ98534.1| modification methylase [Haemophilus influenzae PittEE]
 gi|162532590|gb|ABY16693.1| probable methylase [Haemophilus influenzae]
 gi|309973308|gb|ADO96509.1| Probable cytosine-specific DNA methyltransferase [Haemophilus
           influenzae R2846]
          Length = 409

 Score = 67.7 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           M + ++G+PQ RER++++ F  P    F FP  + ++  + D LE++ D K  +  K  +
Sbjct: 181 MNSKNYGIPQHRERIFVVGFKTPPQGGFMFPAEIPLEHSMQDFLEDYTDSKYYLKEKGIK 240

Query: 60  GHQKRKENNKIAGKGFG 76
                K   K   +  G
Sbjct: 241 FVTSSKNRQKRYTQING 257


>gi|239812977|ref|YP_002941924.1| DNA-cytosine methyltransferase [Geobacillus sp. WCH70]
 gi|239809042|gb|ACS26105.1| DNA-cytosine methyltransferase [Geobacillus sp. WCH70]
          Length = 370

 Score = 67.7 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 10/83 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK---------PRLGDILEEHIDDK 50
           + A D+GVPQ+RER++II   N  +++++FP P   +           +G++LE    ++
Sbjct: 172 INAADYGVPQKRERVFIIGVRNDLNIQYEFPEPTHNEDGSDGKLPWVTVGEVLENLQVEE 231

Query: 51  STISNKLWEGHQKRKENNKIAGK 73
                   E  +  K   K  G 
Sbjct: 232 HHFIPYSKERLRFMKLIPKGGGN 254


>gi|325678044|ref|ZP_08157681.1| putative DNA (cytosine-5-)-methyltransferase [Ruminococcus albus 8]
 gi|324110261|gb|EGC04440.1| putative DNA (cytosine-5-)-methyltransferase [Ruminococcus albus 8]
          Length = 324

 Score = 67.3 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 22/106 (20%), Positives = 40/106 (37%), Gaps = 19/106 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEEHIDD------K 50
           + A D+GVPQ+RER+ ++   N     + ++ FP P      +   L   + +      +
Sbjct: 155 INAADYGVPQKRERVIMVGIRNDIFQKNGDYSFPQPTNEGKWVP--LSVAVPELAIENQR 212

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
              S K  +G +  K            GL         T+++   K
Sbjct: 213 YYFSEKAVQGMKNAK-------NNMKRGLAQNLDEPCLTVTSHLAK 251


>gi|42783651|ref|NP_980898.1| DNA-cytosine methyltransferase family protein [Bacillus cereus ATCC
           10987]
 gi|42739580|gb|AAS43506.1| DNA-cytosine methyltransferase family protein [Bacillus cereus ATCC
           10987]
          Length = 362

 Score = 67.3 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKP---------RLGDILEEHIDDK 50
           + A ++GVPQ+RER++II       + F FP P   +           +G++L++    +
Sbjct: 171 LNAANYGVPQKRERVFIIGVRQDLEKTFVFPEPTHNEKGTDGKKPWVTVGEVLKQIETKE 230

Query: 51  ST---ISNKLWEGHQK 63
                 S +  +  + 
Sbjct: 231 HHYQSYSPERLKYMKM 246


>gi|313668596|ref|YP_004048880.1| DNA cytosine methyltransferase [Neisseria lactamica ST-640]
 gi|313006058|emb|CBN87519.1| DNA cytosine methyltransferase [Neisseria lactamica 020-06]
          Length = 393

 Score = 67.3 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 11/92 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER+ I+       +++KFP     + RL        + +  ++ + WE
Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKETHSEDRL--------NWEKYVTGEYWE 221

Query: 60  GHQKRKENNKIAGK--GFGYGLFFENSATTNT 89
            H + K  NK   +     YG+F        T
Sbjct: 222 KHNEPKRFNKDIAEKLQKKYGIFEPEKKPWQT 253


>gi|154173655|ref|YP_001409100.1| cytosine-specific methyltransferase NlaX [Campylobacter curvus
           525.92]
 gi|112802981|gb|EAU00325.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Campylobacter
           curvus 525.92]
          Length = 352

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 35/92 (38%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFL--NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           +   D+G+ Q RER+YI+ FL  +  + F F   + +   + D L++ +D+K  ++    
Sbjct: 152 LNTKDYGIAQNRERIYIVGFLDFDEYLNFDFAPRVPLTTAIRDYLDDEVDEKYYLNENAI 211

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
                                  E      T+
Sbjct: 212 LSMVDPNACFNGKFDP------KETDECAGTI 237


>gi|197303495|ref|ZP_03168534.1| hypothetical protein RUMLAC_02217 [Ruminococcus lactaris ATCC
           29176]
 gi|197297493|gb|EDY32054.1| hypothetical protein RUMLAC_02217 [Ruminococcus lactaris ATCC
           29176]
          Length = 496

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 44/103 (42%), Gaps = 12/103 (11%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV-------EFKFPTPLG--IKPRLGDILEEHIDDKST 52
              +FG+PQ R R+YI+ F              + P      I   + ++L+ ++DDK  
Sbjct: 165 NTREFGLPQNRPRVYIMAFSKKIYGNAIKLLNAQLPISRDETIFRDVTEVLDTNVDDKYY 224

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFE---NSATTNTLSA 92
           ++    E  ++ K   K  G GFGY +  +   +     T+ A
Sbjct: 225 MAEGYLETLKRHKARQKKNGYGFGYCVVNKSNEDHPIAYTILA 267


>gi|159026722|emb|CAO89036.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 455

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 3/48 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEE 45
           + A DFG+PQ RER++I+           FKFP PLGI P++ DILE+
Sbjct: 169 LNAYDFGLPQNRERVFIVGIRKDIDNYERFKFPLPLGIHPKVLDILED 216


>gi|309380076|emb|CBX21487.1| putative DNA cytosine methyltransferase [Neisseria lactamica
           Y92-1009]
          Length = 377

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 11/92 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER+ I+       +++KFP     + RL        + +  ++ + WE
Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKETHSEDRL--------NWEKYVTGEYWE 221

Query: 60  GHQKRKENNKIAGK--GFGYGLFFENSATTNT 89
            H + K  NK   +     YG+F        T
Sbjct: 222 KHNEPKRFNKDIAEKLQKKYGIFEPEKKPWQT 253


>gi|291087089|ref|ZP_06345376.2| modification methylase HpaII [Clostridium sp. M62/1]
 gi|291076158|gb|EFE13522.1| modification methylase HpaII [Clostridium sp. M62/1]
          Length = 490

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 40/103 (38%), Gaps = 12/103 (11%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKF-------PTPLGI--KPRLGDILEEHIDDKST 52
              +FG+PQ R R+YI+ F                P          + DIL+  + ++  
Sbjct: 182 NTRNFGLPQNRPRVYIVAFSRNYFGEHLKLIPERTPEKSEKVIFKSVRDILDVDVSERFF 241

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENS---ATTNTLSA 92
           +S+ L +  ++ K   K  G GFG  +           +T+ A
Sbjct: 242 LSSGLLKTLEEHKARQKRNGNGFGCRIANATEIECPIASTILA 284


>gi|166368611|ref|YP_001660884.1| cytosine-specific methyltransferase [Microcystis aeruginosa
           NIES-843]
 gi|166090984|dbj|BAG05692.1| cytosine-specific methyltransferase [Microcystis aeruginosa
           NIES-843]
          Length = 464

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 3/48 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEE 45
           + A DFG+PQ RER++I+           FKFP PLGI P++ DILE+
Sbjct: 177 LNAYDFGLPQNRERVFIVGIRKDIDNYERFKFPLPLGIHPKVLDILED 224


>gi|255073161|ref|XP_002500255.1| DNA methyltransferase [Micromonas sp. RCC299]
 gi|226515517|gb|ACO61513.1| DNA methyltransferase [Micromonas sp. RCC299]
          Length = 599

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 38/104 (36%), Gaps = 16/104 (15%)

Query: 8   VPQRRERLYIIDFLNP------SVEFKFP-TPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           VPQ R+R++ + F +          F +P  P      + D+LE+  + + T   ++ E 
Sbjct: 424 VPQSRKRVFFVGFRSDLRAAREDGVFTWPEEPRDCGGTVKDVLED--EHRETARCEVSEY 481

Query: 61  HQKRKENNKIAGKGFGY-------GLFFENSATTNTLSARYYKD 97
             +R        +  G        G  +       TL A Y K 
Sbjct: 482 QMERAAAFFRRTQSRGENEGSEHAGYLYPVDGVARTLCASYRKS 525


>gi|308172812|ref|YP_003919517.1| DNA (cytosine-5-)-methyltransferase [Bacillus amyloliquefaciens DSM
           7]
 gi|307605676|emb|CBI42047.1| DNA (cytosine-5-)-methyltransferase [Bacillus amyloliquefaciens DSM
           7]
          Length = 406

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 36/96 (37%), Gaps = 12/96 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRL---GDILEEHIDDKSTISNK 56
           M A D+GV Q+RER++I+         F+FP PL    +     D++ +  + +     K
Sbjct: 246 MSAWDYGVAQKRERVFIVGIRKDLGFTFEFPKPLEGDYQTRVLRDVIGDLPEPERQDCGK 305

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            W          K                 +NT+ A
Sbjct: 306 YW--------TPKSEYTYGQANRVQSLDKPSNTIPA 333


>gi|251778642|ref|ZP_04821562.1| methyl transferase [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|243082957|gb|EES48847.1| methyl transferase [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 586

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 35/73 (47%), Gaps = 3/73 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + + D+GV Q RER++++ F N       F+ P  + +  ++ D L +++  K  +++K 
Sbjct: 330 LNSKDYGVAQNRERIFVVGFRNDLELVKPFEEPEKVQLNKKMKDYLLDNVSGKYYLNSKG 389

Query: 58  WEGHQKRKENNKI 70
                  K   K 
Sbjct: 390 VAFVTDNKNLQKK 402


>gi|168335325|ref|ZP_02693422.1| DNA-cytosine methyltransferase [Epulopiscium sp. 'N.t. morphotype
           B']
          Length = 324

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+GV Q R+R++ I F    +++F+FP P   KP L DIL +  D+     +K
Sbjct: 143 LNANDYGVAQDRKRVFYIGFRKDLNIKFEFPKPQEYKPVLRDILWDLKDNAVPALDK 199


>gi|326571776|gb|EGE21785.1| DNA-cytosine methyltransferase [Moraxella catarrhalis BC7]
          Length = 458

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 37/101 (36%), Gaps = 11/101 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + D+GVPQ RER Y +     S    F+FP       +L DI+E   +DK        
Sbjct: 261 LNSYDYGVPQFRERWYCVAIRKDSDNGRFEFPKNRDRTTKLRDIIESDNNDK-------- 312

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGS 99
                 K         F      E     N++ A Y K G 
Sbjct: 313 -SLILSKFEIDRINYHFANCHINERVEHDNSMYAPYTKKGK 352


>gi|258511120|ref|YP_003184554.1| DNA-cytosine methyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477846|gb|ACV58165.1| DNA-cytosine methyltransferase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 395

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 9/68 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER++I+ F +  ++E+ FP P        D L         ++ + WE
Sbjct: 178 LNAADYGVPQKRERVFIVGFRSDLNIEWSFPNPTHSF----DALLYD----QWVTGEYWE 229

Query: 60  GHQKRKEN 67
            H+  K++
Sbjct: 230 RHRVAKKH 237


>gi|197302809|ref|ZP_03167861.1| hypothetical protein RUMLAC_01538 [Ruminococcus lactaris ATCC
           29176]
 gi|197298046|gb|EDY32594.1| hypothetical protein RUMLAC_01538 [Ruminococcus lactaris ATCC
           29176]
          Length = 333

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 41/104 (39%), Gaps = 11/104 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHID---------D 49
           + A D+G+PQ+RER+Y++ F N      F +P P  +   + + L +  +          
Sbjct: 152 LNAVDYGIPQKRERIYMVCFRNDLGITGFSYPKPFKLTRHVENFLLDDEEMVKDLYVERP 211

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +  +    + +  +     I  KG      +       TLSA 
Sbjct: 212 DTYFNGIEDDQYSNKSIRLGIVNKGGQGERIYSTKGIAITLSAS 255


>gi|59801568|ref|YP_208280.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae FA
           1090]
 gi|194097887|ref|YP_002000932.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998362|ref|ZP_04718286.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           35/02]
 gi|240113683|ref|ZP_04728173.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           MS11]
 gi|240116425|ref|ZP_04730487.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           PID18]
 gi|240117164|ref|ZP_04731226.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           PID1]
 gi|240125114|ref|ZP_04738000.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           SK-92-679]
 gi|254494438|ref|ZP_05107609.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae 1291]
 gi|260441646|ref|ZP_05795462.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           DGI2]
 gi|268594223|ref|ZP_06128390.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           35/02]
 gi|268599750|ref|ZP_06133917.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae MS11]
 gi|268602094|ref|ZP_06136261.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID18]
 gi|268602852|ref|ZP_06137019.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID1]
 gi|268683710|ref|ZP_06150572.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae
           SK-92-679]
 gi|291045024|ref|ZP_06570732.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           DGI2]
 gi|10444408|gb|AAG17898.1|AF297971_2 DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae]
 gi|59718463|gb|AAW89868.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae FA
           1090]
 gi|193933177|gb|ACF29001.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           NCCP11945]
 gi|226513478|gb|EEH62823.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae 1291]
 gi|268547612|gb|EEZ43030.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           35/02]
 gi|268583881|gb|EEZ48557.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae MS11]
 gi|268586225|gb|EEZ50901.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID18]
 gi|268586983|gb|EEZ51659.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae PID1]
 gi|268623994|gb|EEZ56394.1| plasmid encoded methyltransferase Pem [Neisseria gonorrhoeae
           SK-92-679]
 gi|291011027|gb|EFE03024.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           DGI2]
 gi|317163651|gb|ADV07192.1| DNA cytosine methyltransferase M.NgoMIII [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 377

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 11/92 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ+RER+ I+       +++KFP     + RL        + +  ++ + WE
Sbjct: 170 LNAADYGVPQKRERVVIVGIRADLDIDWKFPKRTHSEDRL--------NWEKYVTGEYWE 221

Query: 60  GHQKRKENNKIAGK--GFGYGLFFENSATTNT 89
            H + K  NK   +     YG+F        T
Sbjct: 222 KHNEPKRFNKDIAEKLQKKYGIFEPEKKPWQT 253


>gi|12084381|pdb|1FJX|A Chain A, Structure Of Ternary Complex Of Hhai Methyltransferase
           Mutant (T250g) In Complex With Dna And Adohcy
 gi|85544394|pdb|2C7R|A Chain A, Hhai Dna Methyltransferase (T250g Mutant) Complex With
           Oligonucleotide Containing 2-Aminopurine As A Target
           Base (Gpgc:gmgc) And Sah
          Length = 327

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+G+PQ+RER+Y+I F N      F+FP P  +   + D+L    + +  + ++
Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDR 209


>gi|257870038|ref|ZP_05649691.1| DNA methylase [Enterococcus gallinarum EG2]
 gi|257804202|gb|EEV33024.1| DNA methylase [Enterococcus gallinarum EG2]
          Length = 401

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           +   D+G VPQ RER+Y++ F N      F FP+ + +  +L D+++     DDK     
Sbjct: 156 LNGKDYGNVPQNRERIYVVGFRNQQAFDNFHFPSKVELTTKLSDVIDFENPKDDKYYYKK 215

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                +++ +++       + +   +     S    TL+A
Sbjct: 216 NRQPFYEQLEKSIVDDNTVYQWRRQYVRENKSGVVPTLTA 255


>gi|307140960|ref|ZP_07500316.1| DNA-cytosine methyltransferase [Escherichia coli H736]
 gi|331645014|ref|ZP_08346131.1| DNA cytosine methyltransferase M.NgoMIII [Escherichia coli H736]
 gi|331035989|gb|EGI08227.1| DNA cytosine methyltransferase M.NgoMIII [Escherichia coli H736]
          Length = 413

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIK 36
            A D+GVPQ+RER++I+ F +   +E+ FP P    
Sbjct: 193 NAADYGVPQKRERVFIVGFRDDLEIEWSFPKPTHSY 228


>gi|119493789|ref|ZP_01624358.1| type II restriction enzyme HaeII [Lyngbya sp. PCC 8106]
 gi|119452484|gb|EAW33671.1| type II restriction enzyme HaeII [Lyngbya sp. PCC 8106]
          Length = 689

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 8/87 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE--HIDDKSTISNKLW 58
           + A DFG+PQ+RER YI+ FL  ++ F FP P+  +  L +ILE    +D     S    
Sbjct: 150 LNALDFGLPQKRERTYIVGFL-ENIHFSFPKPIQKRVSLSEILEPDEQVDKSLFASE--- 205

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSA 85
               ++K   ++  K F   ++ EN +
Sbjct: 206 --FIQKKRIQRLKVKPFYPSIWHENKS 230


>gi|57506196|ref|ZP_00372116.1| C-5 cytosine-specific DNA methylase [Campylobacter upsaliensis
           RM3195]
 gi|57015523|gb|EAL52317.1| C-5 cytosine-specific DNA methylase [Campylobacter upsaliensis
           RM3195]
          Length = 315

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 4/96 (4%)

Query: 1   MKACDFG-VPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   ++G +PQ RER+YII FL+      F FP  + +  ++  +LE+ +D     ++  
Sbjct: 142 LNTSEYGNIPQNRERIYIIGFLDFHTYESFHFPAKIKLTQKIQHLLEKGVDKSFYYTSHK 201

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN-SATTNTLSA 92
           +    K++  +K     +      EN +    TL+A
Sbjct: 202 YCAQLKKEMQSKETLYQWRRHYVRENKNNLCPTLTA 237


>gi|220903553|ref|YP_002478865.1| DNA-cytosine methyltransferase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219867852|gb|ACL48187.1| DNA-cytosine methyltransferase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 308

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 35/103 (33%), Gaps = 15/103 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG---------IKPRLGDILEEHIDDK 50
           + A D+GVPQ R+R++I        V F +P                 +G+ L    D  
Sbjct: 142 LNAADYGVPQTRQRVFIAGVRKDLDVIFTYPDATHSCEGTGGLKKWRSVGEALAGLPDPD 201

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                   +  +      K+   G+      +      T++AR
Sbjct: 202 EPNDILNHDYSKY-----KLRFNGYLGHREIDPGKPAPTVTAR 239


>gi|148380278|ref|YP_001254819.1| C-5 cytosine-specific DNA methylase [Clostridium botulinum A str.
           ATCC 3502]
 gi|148289762|emb|CAL83870.1| putative C-5 cytosine-specific DNA methylase [Clostridium botulinum
           A str. ATCC 3502]
          Length = 340

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + + D+G PQ RER++ I          FKFP P+     +  IL+E++D K    NK 
Sbjct: 152 LNSKDYGSPQSRERMFCISIRKDIDACLFKFPKPMDSIVPINTILDEYVDKKYYCINKY 210


>gi|294668765|ref|ZP_06733858.1| modification methylase BsuRI [Neisseria elongata subsp. glycolytica
           ATCC 29315]
 gi|291309282|gb|EFE50525.1| modification methylase BsuRI [Neisseria elongata subsp. glycolytica
           ATCC 29315]
          Length = 313

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 31/78 (39%), Gaps = 10/78 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLG------IKPRLGDILEEHID---DK 50
           + A D+GVPQ R+R++I+   N    E+ FP P            +G+ L    D    +
Sbjct: 141 LNAADYGVPQLRKRIFIVGIRNDIGAEYTFPAPTHGTEGKPPHITIGEALRGMPDWPEGE 200

Query: 51  STISNKLWEGHQKRKENN 68
                  W    + +  +
Sbjct: 201 YYDRPFHWYYLSRNRRQD 218


>gi|254445875|ref|ZP_05059351.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
 gi|198260183|gb|EDY84491.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
          Length = 321

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 27/105 (25%), Positives = 41/105 (39%), Gaps = 14/105 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-- 56
           + A D+GVPQ R+RLYI+       S EFKFP   G + RL D+L  +    +    +  
Sbjct: 147 LNASDYGVPQARKRLYIVGIRKDLGSGEFKFPETSGARVRLKDLLLLNGAADAMRIERDD 206

Query: 57  ----------LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                     + +    +     +  KG      +       TLS
Sbjct: 207 IRITKTDIAEVLDRRPNKPVQIGVINKGGQGERIYSVEGHAITLS 251


>gi|325912423|ref|ZP_08174818.1| modification methylase HhaI [Lactobacillus iners UPII 143-D]
 gi|325475765|gb|EGC78936.1| modification methylase HhaI [Lactobacillus iners UPII 143-D]
          Length = 314

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 40/103 (38%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHID--------DK 50
           +   D+GVPQ+RER+Y++ F N      F FP P  +   + D L    +        + 
Sbjct: 131 LNPVDYGVPQKRERIYMLCFRNDINREVFTFPRPFKLNKFVEDFLISDYEVNSLIVDRED 190

Query: 51  STISNKL-WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
             ++ K+    +          GKG      +       TLSA
Sbjct: 191 LRLNEKIDINYNSISTIRVGTVGKGGQGERIYSPKGIAITLSA 233


>gi|67920370|ref|ZP_00513890.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
 gi|67857854|gb|EAM53093.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
          Length = 339

 Score = 65.8 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 38/97 (39%), Gaps = 12/97 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL----EEHIDDKSTISNK 56
           + + DFGVPQ RERL ++       +F+FP     +   G+ L     + + D   ++  
Sbjct: 157 LNSVDFGVPQNRERLMVVGHRG---KFQFPQISAKRITAGEALGELAFQVLPDSKFLTPS 213

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           + +   K ++ +                    TL+ R
Sbjct: 214 MDKYIAKYEKASCCK-----RPRDLHLDKQARTLTCR 245


>gi|110643908|ref|YP_671638.1| putative type II 5-cytosoine methyltransferase [Escherichia coli
           536]
 gi|110345500|gb|ABG71737.1| putative type II 5-cytosoine methyltransferase [Escherichia coli
           536]
          Length = 315

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 35/100 (35%), Gaps = 8/100 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGD-------ILEEHIDDKSTI 53
              D+GVPQ R R+ I+   +   VE+ +P P    P+  D       I           
Sbjct: 144 NVADYGVPQMRYRVIIVGVRDDIKVEYIYPQPTHSSPKKSDKTGLAPWISIGDALHDIPE 203

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +   +         KI  + F      + +  + T+ AR
Sbjct: 204 PDSENDLLNHVYSTYKITNRNFTGHRETDPNKPSPTILAR 243


>gi|309803758|ref|ZP_07697844.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           11V1-d]
 gi|308164167|gb|EFO66428.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           11V1-d]
          Length = 336

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + D L    + +  I N+  
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERELFVFPQPFKLNRFVEDFLLPDNEVRDLIVNRTD 211

Query: 58  --------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                      +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNINYNSPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|166163613|gb|ABY83631.1| DNA methyltransferase Cfr42I [Citrobacter freundii]
          Length = 402

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIK 36
            A D+G+PQ+RER++I+ F +   +E+ FP P    
Sbjct: 182 NAADYGIPQKRERVFIVGFRDDLEIEWSFPKPTHSY 217


>gi|24527985|emb|CAD33712.1| putative DNA methylase [Escherichia coli]
          Length = 314

 Score = 65.4 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 35/100 (35%), Gaps = 8/100 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGD-------ILEEHIDDKSTI 53
              D+GVPQ R R+ I+   +   VE+ +P P    P+  D       I           
Sbjct: 143 NVADYGVPQMRYRVIIVGVRDDIKVEYIYPQPTHSSPKKSDKTGLAPWISIGDALHDIPE 202

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +   +         KI  + F      + +  + T+ AR
Sbjct: 203 PDSENDLLNHVYSTYKITNRNFTGHRETDPNKPSPTILAR 242


>gi|77918034|ref|YP_355849.1| C-5 cytosine-specific DNA methylase [Pelobacter carbinolicus DSM
           2380]
 gi|77544117|gb|ABA87679.1| C-5 cytosine-specific DNA methylase [Pelobacter carbinolicus DSM
           2380]
          Length = 405

 Score = 65.0 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37
           + A ++GVPQ RER++I+   +   EF+FP P    P
Sbjct: 163 LNAANYGVPQVRERVFIVGSRDGK-EFQFPEPTHQNP 198


>gi|329767116|ref|ZP_08258644.1| hypothetical protein HMPREF0428_00341 [Gemella haemolysans M341]
 gi|328837841|gb|EGF87466.1| hypothetical protein HMPREF0428_00341 [Gemella haemolysans M341]
          Length = 396

 Score = 65.0 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDK--STISN 55
           +   D+G VPQ RER+YI+ FL      +F+FP  + ++ +L DI++  I +K      +
Sbjct: 145 LNGKDYGNVPQNRERIYIVGFLEKESFDKFEFPKKIKLETKLSDIIDFDIKEKEIYYYRD 204

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                + K K+        + +   +     S     L+A
Sbjct: 205 GKQPFYDKLKDEITSQNTVYQWRRQYVRENKSGVVPALTA 244


>gi|312872570|ref|ZP_07732638.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2062A-h1]
 gi|311091932|gb|EFQ50308.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2062A-h1]
          Length = 336

 Score = 65.0 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + D L    + +  I N+  
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVEDFLLPDNEVRDLIVNRTD 211

Query: 58  --------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                      +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNINYNSPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|309807025|ref|ZP_07701007.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           03V1-b]
 gi|308166645|gb|EFO68842.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           03V1-b]
          Length = 336

 Score = 65.0 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + D L    + +  I N+  
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERELFVFPQPFKLNRFVEDFLLPDNEVRDLIVNRTD 211

Query: 58  --------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                      +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNINYNSPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|329920363|ref|ZP_08277095.1| modification methylase HhaI [Lactobacillus iners SPIN 1401G]
 gi|328936039|gb|EGG32492.1| modification methylase HhaI [Lactobacillus iners SPIN 1401G]
          Length = 336

 Score = 65.0 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + D L    + +  I N+  
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDVERESFVFPQPFKLNRFVEDFLLPDNEVRDLIVNRTD 211

Query: 58  --------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                      +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNINYNSPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|309804726|ref|ZP_07698791.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           09V1-c]
 gi|312871535|ref|ZP_07731628.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           3008A-a]
 gi|325913106|ref|ZP_08175476.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B]
 gi|308166118|gb|EFO68336.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LactinV
           09V1-c]
 gi|311092930|gb|EFQ51281.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           3008A-a]
 gi|325477527|gb|EGC80669.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII 60-B]
          Length = 336

 Score = 65.0 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + D L    + +  I N+  
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERELFVFPQPFKLNRFVEDFLLPDNEVRDLIVNRTD 211

Query: 58  --------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                      +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNINYNSPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|237739124|ref|ZP_04569605.1| C-5 cytosine-specific DNA methylase [Fusobacterium sp. 2_1_31]
 gi|229423724|gb|EEO38771.1| C-5 cytosine-specific DNA methylase [Fusobacterium sp. 2_1_31]
          Length = 361

 Score = 65.0 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 40/100 (40%), Gaps = 15/100 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A ++GV Q+RERL I+   N  +    F FPTP   KP L DIL +  + K    ++ 
Sbjct: 179 LNAWNYGVAQKRERLIIVGIRNDLINKLNFLFPTPHKYKPVLRDILLDCPESKGIAYSE- 237

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97
                  K+         GY            ++  Y K 
Sbjct: 238 ------YKKKIFEMVPPGGYWKDIPKE-----IAKEYMKS 266


>gi|281420197|ref|ZP_06251196.1| modification methylase HgiDII [Prevotella copri DSM 18205]
 gi|281405692|gb|EFB36372.1| modification methylase HgiDII [Prevotella copri DSM 18205]
          Length = 353

 Score = 64.6 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 43/126 (34%), Gaps = 33/126 (26%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQRR+R+ I+          F++P P   K  + + +    +     S+   
Sbjct: 157 LDAQDYGVPQRRKRVVIVGERKDHKIPLFEYPKPQEHKITVREAIAYLPEPPEDGSDHPH 216

Query: 59  EGHQKR----------------------------KENNKIAGKGFGYGLFFEN---SATT 87
               +R                             + +K++ K  G+   +         
Sbjct: 217 ISLHRRDRLSAKNIARLQALKPGQGRDFLPPELLADCHKVSSKLIGHRNVYGRMPWDDVA 276

Query: 88  NTLSAR 93
            T++AR
Sbjct: 277 PTITAR 282


>gi|23100788|ref|NP_694255.1| cytosine-specific DNA-methyltransferase [Oceanobacillus iheyensis
           HTE831]
 gi|22779022|dbj|BAC15289.1| cytosine-specific DNA-methyltransferase [Oceanobacillus iheyensis
           HTE831]
          Length = 370

 Score = 64.6 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 44/99 (44%), Gaps = 7/99 (7%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEE-HIDDKSTISNK 56
           M   D+G +PQ RER++I+ F +     +F++P  +G+   + ++++     D +    +
Sbjct: 177 MNTMDYGNIPQNRERIFIVGFKDEEKYNKFQWPQKIGLTKSIDNVIDRSKKQDDAYYYTE 236

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
             + +    E+ K     +     +     S    TL+A
Sbjct: 237 ESQYYSMIVESMKNRNTVYQLRRVYMRENQSNVCPTLTA 275


>gi|255018626|ref|ZP_05290752.1| DNA-methyltransferase (cytosine-specific) [Listeria monocytogenes
           FSL F2-515]
          Length = 172

 Score = 64.6 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49
           + A DFG+PQ RER++++  L  + EF+FP  +     L D ++  ++ 
Sbjct: 110 LNARDFGIPQNRERVFVVSVLGNNKEFQFPEKVEPVKSLKDYIDFDVEP 158


>gi|238025826|ref|YP_002910057.1| DNA cytosine methyltransferase M.NgoMIII [Burkholderia glumae BGR1]
 gi|237875020|gb|ACR27353.1| DNA cytosine methyltransferase M.NgoMIII [Burkholderia glumae BGR1]
          Length = 407

 Score = 64.6 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR 38
            A D+GVPQ+RER++I+ F +   V++ FP P      
Sbjct: 183 NAADYGVPQKRERVFIVGFRSDLDVDWSFPRPTHSYDS 220


>gi|2765225|emb|CAA73243.1| methylase [Lactococcus lactis subsp. cremoris]
          Length = 317

 Score = 64.6 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 8/99 (8%)

Query: 2   KACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEE--HIDDKSTISNK 56
            A ++G +PQ RER+YI+ F        F+ P  + +K  + D+++     DDK   +++
Sbjct: 146 NASEYGNIPQNRERIYIVAFKNKKDYANFELPKSIPLKTTIHDVIDFSKKQDDKFYYTSE 205

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTN---TLSA 92
             +   + KEN       + +   +     +N   TL+A
Sbjct: 206 KNKFFDELKENMTNHDTTYQWRRVYVRENKSNLVPTLTA 244


>gi|254421659|ref|ZP_05035377.1| C-5 cytosine-specific DNA methylase superfamily [Synechococcus sp.
           PCC 7335]
 gi|196189148|gb|EDX84112.1| C-5 cytosine-specific DNA methylase superfamily [Synechococcus sp.
           PCC 7335]
          Length = 427

 Score = 64.6 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 27/54 (50%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A ++G+PQ RERL+++   N +    +P PL   P     L +  D +   S
Sbjct: 161 LNARNYGIPQNRERLFLVGARNNTCLPIYPKPLKHSPTCTHALGDLPDVEQFHS 214


>gi|189339547|pdb|2UZ4|A Chain A, Hhai Dna Methyltransferase R165n Mutant Complex With 13mer
           Gcgc-Gmgc Oligonucleotide And Sah
          Length = 327

 Score = 64.6 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RE +Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKRENIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|189096047|pdb|2UYC|A Chain A, Hhai Dna Methyltransferase R163n Mutant Complex With 13mer
           Gcgc-Gmgc Oligonucleotide And Sah
          Length = 327

 Score = 64.6 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+ ER+Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKNERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|260890220|ref|ZP_05901483.1| modification methylase EcoRII [Leptotrichia hofstadii F0254]
 gi|260859840|gb|EEX74340.1| modification methylase EcoRII [Leptotrichia hofstadii F0254]
          Length = 293

 Score = 64.6 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 46/100 (46%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISN 55
           + A ++G VPQ RER+YII F        F+   PL ++ ++GDI++    +D+K     
Sbjct: 115 LNASEYGNVPQNRERIYIIGFRKKEDYDNFEDIKPLKLEKKIGDIIDFDKKVDEKYYYRK 174

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
           +    + + ++        + +   +     S    TL+A
Sbjct: 175 EKNIFYDELEKEITKKDTIYQWRRKYVRENKSNLCPTLTA 214


>gi|256819660|ref|YP_003140939.1| DNA-cytosine methyltransferase [Capnocytophaga ochracea DSM 7271]
 gi|256581243|gb|ACU92378.1| DNA-cytosine methyltransferase [Capnocytophaga ochracea DSM 7271]
          Length = 318

 Score = 64.6 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 38/100 (38%), Gaps = 8/100 (8%)

Query: 1   MKACDF-GVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           +   ++  +PQ RER++I+ F    V    EF+FP  + +   +   LE+   +      
Sbjct: 148 LNTMEYANIPQNRERIFIVAFDPKQVPNYKEFQFPEKIKLTKTIHSFLEKGKQNDYFYYQ 207

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
              +   +  +        + +   +     +    TL+A
Sbjct: 208 LSHKYSPELIKIVTRKDTIYQWRRVYVRENKNNVCPTLTA 247


>gi|224436796|ref|ZP_03657794.1| modification methylase HaeIII [Helicobacter cinaedi CCUG 18818]
 gi|313143285|ref|ZP_07805478.1| cytosine specific DNA methyltransferase [Helicobacter cinaedi CCUG
           18818]
 gi|313128316|gb|EFR45933.1| cytosine specific DNA methyltransferase [Helicobacter cinaedi CCUG
           18818]
          Length = 305

 Score = 64.6 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 39/94 (41%), Gaps = 6/94 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GV Q R+R+ II    +   E  FP PL  KP+    L E I D     ++   
Sbjct: 148 LNASDYGVAQNRKRVIIIGRRVDIKQEIDFPKPLHKKPKT---LREAIFDLPLEYDENIA 204

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            H   K  +KI   G+             T++ R
Sbjct: 205 NHTGSK--HKININGYVGNRILAWDKPAPTITGR 236


>gi|304311589|ref|YP_003811187.1| C-5 cytosine-specific DNA methylase [gamma proteobacterium HdN1]
 gi|301797322|emb|CBL45542.1| C-5 cytosine-specific DNA methylase [gamma proteobacterium HdN1]
          Length = 387

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 32/95 (33%), Gaps = 8/95 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW- 58
           + A D+GVPQ RER+ II   +  ++ + FP P   + R   +L +              
Sbjct: 170 INAADYGVPQVRERVIIIGLRSDLNLNWSFPEPTHSQDR---LLWDIHVSGEYWEQHRVS 226

Query: 59  ---EGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
              +                 YGL         T+
Sbjct: 227 AKEKAIVLASTEKMANRIYCRYGLLEPEHLPWKTI 261


>gi|218248203|ref|YP_002373574.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|257060473|ref|YP_003138361.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|218168681|gb|ACK67418.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|256590639|gb|ACV01526.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 460

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFG+PQ R+R++++   N       ++FP PL I P++ DIL++  + K     KL
Sbjct: 168 LNAYDFGLPQNRDRVFLVGIRNDIEGSQNYQFPDPLNIHPKVLDILDDLKNIKPIKKVKL 227

Query: 58  WE 59
            E
Sbjct: 228 SE 229


>gi|291165856|gb|EFE27903.1| modification methylase EcoRII [Filifactor alocis ATCC 35896]
          Length = 375

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 41/104 (39%), Gaps = 13/104 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFK--------FPTPLG--IKPRLGDILEEHIDDKS 51
            + +FG+PQ R R YI+ F                 PT     +   L  +LE   + K 
Sbjct: 165 NSRNFGIPQNRPRTYIMAFNRQLYGADTLLGIGNLLPTEKNRYLYEDLNSLLEFRAEPKY 224

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFE---NSATTNTLSA 92
            +S+  +    + +E  +  G GFGY +  E        NT+ A
Sbjct: 225 YMSSGYFNTLVRHRERERKKGNGFGYRVVNEPGIEHPVANTIMA 268


>gi|82752078|ref|YP_417819.1| DNA modification methylase [Staphylococcus aureus RF122]
 gi|82657609|emb|CAI82057.1| DNA modification methylase [Staphylococcus aureus RF122]
          Length = 402

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEE--HIDDKSTISN 55
           + A D+G +PQ RER+YI+ F        F+FP  + +K  + DI+     ID++     
Sbjct: 156 LNAKDYGDIPQNRERIYIVGFKCRKAFDLFEFPEKIDLKTGIKDIINFESEIDERYYYRL 215

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                + + ++  K +   + +   +     S    TL+A
Sbjct: 216 NKQPFYDELEKEMKDSNLIYQWRRRYVRANKSGVVPTLTA 255


>gi|307152213|ref|YP_003887597.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
 gi|306982441|gb|ADN14322.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
          Length = 317

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFG+PQ+RER++I+  L   + F++P P+     L +ILE  +      S ++
Sbjct: 159 LNALDFGLPQKRERIFIVGCL-EPIPFEWPMPVRTIKPLKEILETTVAASYYASEQI 214


>gi|327399867|ref|YP_004346898.1| cytosine-specific methyltransferase [Lactobacillus amylovorus GRL
           1112]
 gi|327182537|gb|AEA32972.1| cytosine-specific methyltransferase [Lactobacillus amylovorus GRL
           1112]
          Length = 401

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 41/100 (41%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISN 55
           +   D+G +PQ RER+Y++ F N      F FP P+ +   L DI++ H   D+K     
Sbjct: 153 LNGKDYGNIPQNRERIYVVGFDNKEDYDRFDFPAPIKLTKTLHDIIDFHGKKDEKYYYRE 212

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                + K           + +   +     S    TL+A
Sbjct: 213 GKQPFYDKLVPEITSQDTAYQWRRQYVRANKSNVLPTLTA 252


>gi|158431504|pdb|2Z6Q|A Chain A, Ternary Structure Of Arg165ala M.Hhai C5-Cytosine Dna
           Methyltransferase With Unmodified Dna And Adohcy
          Length = 327

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+G+PQ+RE +Y+I F N      F+FP P  +   + D+L    + +  + ++  
Sbjct: 152 LNALDYGIPQKREAIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211

Query: 58  -------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   E    +     I GKG      +       TLSA
Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSA 253


>gi|239999928|ref|ZP_04719852.1| NgoIM [Neisseria gonorrhoeae 35/02]
 gi|240116859|ref|ZP_04730921.1| NgoIM [Neisseria gonorrhoeae PID1]
 gi|240127204|ref|ZP_04739865.1| NgoIM [Neisseria gonorrhoeae SK-93-1035]
          Length = 278

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D + +    L + 
Sbjct: 105 LNTLDFGLPQKRERIYIVGF-SDNIPFYFPEPINQYRPLGELLENDRDVEPSYF--LSDT 161

Query: 61  HQKRKENNKIAG 72
            ++++       
Sbjct: 162 LKQKRLAALKKA 173


>gi|296313699|ref|ZP_06863640.1| modification methylase NgoBI [Neisseria polysaccharea ATCC 43768]
 gi|296839717|gb|EFH23655.1| modification methylase NgoBI [Neisseria polysaccharea ATCC 43768]
          Length = 315

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LGD+LE   D + +    L + 
Sbjct: 142 LNTLDFGLPQKRERIYIVGF-SDNIPFYFPEPINQYRPLGDLLENDRDVEPSYF--LSDA 198

Query: 61  HQKRKENNKIAG 72
            ++++       
Sbjct: 199 LKQKRLAALKKA 210


>gi|209524941|ref|ZP_03273486.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
 gi|209494590|gb|EDZ94900.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
          Length = 442

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 7/80 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDIL----EEHIDDKSTI 53
           + A DFG+PQ R+R++I+           F+FP PL + P+L D +    ++ +  K   
Sbjct: 160 INASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNLHPKLFDFVEGVSQKPVIKKKFS 219

Query: 54  SNKLWEGHQKRKENNKIAGK 73
              L+  H            
Sbjct: 220 PQVLFGNHIPPARGRFQKND 239


>gi|67922277|ref|ZP_00515790.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
 gi|67855853|gb|EAM51099.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
          Length = 226

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++II      + F F  P   +  L +I+E+ + +    S  + +
Sbjct: 167 LNALDFGLPQKRERIFIIGLR-DPLNFTFKKPNISRKPLSEIIEKSVSEFYYASEHIQK 224


>gi|268595734|ref|ZP_06129901.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae 35/02]
 gi|291044897|ref|ZP_06570606.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293397972|ref|ZP_06642178.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|268549123|gb|EEZ44541.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae 35/02]
 gi|291011791|gb|EFE03787.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291611918|gb|EFF40987.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
          Length = 320

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D + +    L + 
Sbjct: 147 LNTLDFGLPQKRERIYIVGF-SDNIPFYFPEPINQYRPLGELLENDRDVEPSYF--LSDT 203

Query: 61  HQKRKENNKIAG 72
            ++++       
Sbjct: 204 LKQKRLAALKKA 215


>gi|315222617|ref|ZP_07864506.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211]
 gi|315188303|gb|EFU22029.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211]
          Length = 348

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+GVPQ R+R++ + F    +++F+ P P   K    D + +  D       K
Sbjct: 150 LNASDYGVPQDRKRVFYVGFRKDLNIKFEPPKPYESKLTFKDAIFDLKDSAIPALEK 206


>gi|171911881|ref|ZP_02927351.1| DNA-cytosine methyltransferase [Verrucomicrobium spinosum DSM 4136]
          Length = 330

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 34/97 (35%), Gaps = 12/97 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD----ILEEHIDDKSTISNK 56
           + +  FGVPQ+RERL ++  L     F FP P        D    +L     +   ++  
Sbjct: 156 LNSVHFGVPQKRERLVVVGHLGG---FVFPAPSAKVWTSADALEGMLYATPPESRFLTPS 212

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           + +     ++ +                    TL+ R
Sbjct: 213 MDKYIANYEKASAC-----VRPRDLHLDLPARTLTCR 244


>gi|268597921|ref|ZP_06132088.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA19]
 gi|268551709|gb|EEZ46728.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA19]
          Length = 320

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D + +    L + 
Sbjct: 147 LNTLDFGLPQKRERIYIVGF-SDNIPFYFPEPINQYRPLGELLENDRDVEPSYF--LSDT 203

Query: 61  HQKRKENNKIAG 72
            ++++       
Sbjct: 204 LKQKRLAALKKA 215


>gi|308063322|gb|ADO05209.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Sat464]
          Length = 348

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|188527268|ref|YP_001909955.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Shi470]
 gi|188143508|gb|ACD47925.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Shi470]
          Length = 348

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|317483873|ref|ZP_07942812.1| C-5 cytosine-specific DNA methylase [Bilophila wadsworthia 3_1_6]
 gi|316924890|gb|EFV46037.1| C-5 cytosine-specific DNA methylase [Bilophila wadsworthia 3_1_6]
          Length = 401

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 36/90 (40%), Gaps = 9/90 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+G+PQRRER++I+ F +   V + FP        +  +L         IS + W+ 
Sbjct: 179 NAADYGIPQRRERVFIVGFRHDLGVRWSFPETTH---SMEGLLYS-----QWISGEYWDH 230

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTL 90
           H+   +            +        +TL
Sbjct: 231 HKVSFKARGPLNDKHKTRIEKLRGMDASTL 260


>gi|126660265|ref|ZP_01731380.1| putative DNA modification methylase (N.MgoV) [Cyanothece sp.
           CCY0110]
 gi|126618440|gb|EAZ89194.1| putative DNA modification methylase (N.MgoV) [Cyanothece sp.
           CCY0110]
          Length = 458

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDIL----EEHIDDKSTI 53
           + + DFGVPQ RER++I+           ++FP PL ++ RL D+L       + +K  +
Sbjct: 173 INSYDFGVPQNRERVFIVGIRKDRKNCHHYQFPKPLKVQIRLLDVLDELKHCQVTEKVKL 232

Query: 54  SNKLW 58
           + ++ 
Sbjct: 233 TPEIL 237


>gi|145638078|ref|ZP_01793692.1| putative type II 5-cytosoine methyltransferase [Haemophilus
           influenzae PittHH]
 gi|145268726|gb|EDK08715.1| putative type II 5-cytosoine methyltransferase [Haemophilus
           influenzae PittHH]
          Length = 226

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A D+GVPQ R+R+ I+       ++F+FP          D L+  +  K  IS
Sbjct: 147 LNAADYGVPQTRQRVIIVGIRKDLDIQFEFPKQTHS-KNGNDGLKRWVSIKEAIS 200


>gi|194099739|ref|YP_002002874.1| NgoIM [Neisseria gonorrhoeae NCCP11945]
 gi|240013125|ref|ZP_04720038.1| NgoIM [Neisseria gonorrhoeae DGI18]
 gi|240015568|ref|ZP_04722108.1| NgoIM [Neisseria gonorrhoeae FA6140]
 gi|240114103|ref|ZP_04728593.1| NgoIM [Neisseria gonorrhoeae MS11]
 gi|240114658|ref|ZP_04728720.1| NgoIM [Neisseria gonorrhoeae PID18]
 gi|240120196|ref|ZP_04733158.1| NgoIM [Neisseria gonorrhoeae PID24-1]
 gi|240122493|ref|ZP_04735449.1| NgoIM [Neisseria gonorrhoeae PID332]
 gi|240126658|ref|ZP_04739544.1| NgoIM [Neisseria gonorrhoeae SK-92-679]
 gi|254492718|ref|ZP_05105889.1| modification methylase NgoBI [Neisseria gonorrhoeae 1291]
 gi|260441536|ref|ZP_05795352.1| NgoIM [Neisseria gonorrhoeae DGI2]
 gi|268600171|ref|ZP_06134338.1| modification methylase NgoBI [Neisseria gonorrhoeae MS11]
 gi|268600304|ref|ZP_06134471.1| modification methylase NgoBI [Neisseria gonorrhoeae PID18]
 gi|268602536|ref|ZP_06136703.1| modification methylase NgoBI [Neisseria gonorrhoeae PID1]
 gi|268681085|ref|ZP_06147947.1| modification methylase NgoBI [Neisseria gonorrhoeae PID332]
 gi|268685237|ref|ZP_06152099.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-92-679]
 gi|268685565|ref|ZP_06152427.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-93-1035]
 gi|193935029|gb|ACF30853.1| NgoIM [Neisseria gonorrhoeae NCCP11945]
 gi|226511758|gb|EEH61103.1| modification methylase NgoBI [Neisseria gonorrhoeae 1291]
 gi|268584302|gb|EEZ48978.1| modification methylase NgoBI [Neisseria gonorrhoeae MS11]
 gi|268584435|gb|EEZ49111.1| modification methylase NgoBI [Neisseria gonorrhoeae PID18]
 gi|268586667|gb|EEZ51343.1| modification methylase NgoBI [Neisseria gonorrhoeae PID1]
 gi|268621369|gb|EEZ53769.1| modification methylase NgoBI [Neisseria gonorrhoeae PID332]
 gi|268625521|gb|EEZ57921.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-92-679]
 gi|268625849|gb|EEZ58249.1| modification methylase NgoBI [Neisseria gonorrhoeae SK-93-1035]
 gi|317165226|gb|ADV08767.1| NgoIM [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 315

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D + +    L + 
Sbjct: 142 LNTLDFGLPQKRERIYIVGF-SDNIPFYFPEPINQYRPLGELLENDRDVEPSYF--LSDT 198

Query: 61  HQKRKENNKIAG 72
            ++++       
Sbjct: 199 LKQKRLAALKKA 210


>gi|218902126|ref|YP_002449960.1| cytosine-specific methyltransferase NlaX [Bacillus cereus AH820]
 gi|218538919|gb|ACK91317.1| cytosine-specific methyltransferase NlaX [Bacillus cereus AH820]
          Length = 350

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 44/104 (42%), Gaps = 12/104 (11%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH---IDDKSTIS 54
           + + ++G VPQ RER+YI+ FL    + +F FP P+ +   L  ++  +    D+K    
Sbjct: 153 LNSMEYGNVPQNRERIYIVGFLENELTAKFDFPAPIPLTNTLNTVINRNSSINDEKYKAF 212

Query: 55  NKLWEGHQKRKENNKIAGKG---FGYGLFF---ENSATTNTLSA 92
             L E      E  +        + +   +     +    TL+A
Sbjct: 213 YYLPEKVSFYNELQEGMTSHDTVYQWRRVYVRENKNNVCPTLTA 256


>gi|163938820|ref|YP_001643704.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4]
 gi|163861017|gb|ABY42076.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4]
          Length = 350

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 44/104 (42%), Gaps = 12/104 (11%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH---IDDKSTIS 54
           + + ++G VPQ RER+YI+ FL    + +F FP P+ +   L  ++  +    D+K    
Sbjct: 153 LNSMEYGNVPQNRERIYIVGFLENELTAKFDFPAPIPLTNTLNTVINRNSSINDEKYKAF 212

Query: 55  NKLWEGHQKRKENNKIAGKG---FGYGLFF---ENSATTNTLSA 92
             L E      E  +        + +   +     +    TL+A
Sbjct: 213 YYLPEKVSFYNELQEGMTSHDTVYQWRRVYVRENKNNVCPTLTA 256


>gi|59802299|ref|YP_209011.1| NgoIM [Neisseria gonorrhoeae FA 1090]
 gi|240081825|ref|ZP_04726368.1| NgoIM [Neisseria gonorrhoeae FA19]
 gi|59719194|gb|AAW90599.1| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae FA 1090]
          Length = 315

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D + +    L + 
Sbjct: 142 LNTLDFGLPQKRERIYIVGF-SDNIPFYFPEPINQYRPLGELLENDRDVEPSYF--LSDT 198

Query: 61  HQKRKENNKIAG 72
            ++++       
Sbjct: 199 LKQKRLAALKKA 210


>gi|193216537|ref|YP_001999779.1| cytosine-specific methyltransferase, related to HhaI [Mycoplasma
           arthritidis 158L3-1]
 gi|193001860|gb|ACF07075.1| cytosine-specific methyltransferase, related to HhaI [Mycoplasma
           arthritidis 158L3-1]
          Length = 327

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 22/104 (21%), Positives = 39/104 (37%), Gaps = 14/104 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKP----------RLGDILEEHID 48
           + + +FGVPQ+RER+Y++ F        F FP P  +               +++    D
Sbjct: 152 LNSLNFGVPQKRERIYMVCFRRDLNIKNFSFPKPFKLSTFLEDLLLSEEETSNLIINRPD 211

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
               + +   + +  +       GKG      +       TLSA
Sbjct: 212 --LVLKDIEIKNNMIKPIRIGTVGKGGQGERIYSPKGIAVTLSA 253


>gi|254411906|ref|ZP_05025682.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196181628|gb|EDX76616.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 456

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 34/80 (42%), Gaps = 7/80 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILE----EHIDDKSTI 53
           + + DFG+PQ R+R++I+   N   +   F FP PLG   +L D++          K   
Sbjct: 173 LNSYDFGLPQDRDRVFIVGIRNDIEKSKSFDFPKPLGKPIKLYDVINGIERCQFTKKKFP 232

Query: 54  SNKLWEGHQKRKENNKIAGK 73
           +  L++G             
Sbjct: 233 AEILFDGKIPAARGRFQKID 252


>gi|325912401|ref|ZP_08174796.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII
           143-D]
 gi|325475743|gb|EGC78914.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners UPII
           143-D]
          Length = 336

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L    + +  I N+  
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIKRESFVFPQPFKLNRFVENFLLPDNEVRDLIVNRTD 211

Query: 58  --------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                      +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNINYNAPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|317181803|dbj|BAJ59587.1| Type II DNA modification enzyme [Helicobacter pylori F57]
          Length = 351

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|319779706|ref|YP_004130619.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9]
 gi|317109730|gb|ADU92476.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9]
          Length = 329

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 40/104 (38%), Gaps = 14/104 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKS------- 51
           + +CD+G+PQ R R++++ F       EFKFP P  +   + DIL    +          
Sbjct: 152 LNSCDYGIPQSRARIFMVAFREDLKHQEFKFPAPKNLDKYVEDILLPDSETSHLVRQRDD 211

Query: 52  ---TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                S+ L   ++  +      G        +     + T SA
Sbjct: 212 ICLYRSDPLNNVNETYRIGIVGKGGQ--GERVYSPKGLSVTFSA 253


>gi|309809622|ref|ZP_07703479.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners SPIN
           2503V10-D]
 gi|308170103|gb|EFO72139.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners SPIN
           2503V10-D]
          Length = 336

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L    + +  I N+  
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVENFLLPDNEVRDLIVNRTD 211

Query: 58  --------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                      +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNINYNAPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|315586449|gb|ADU40830.1| possible DNA (cytosine-5-)-methyltransferase [Helicobacter pylori
           35A]
          Length = 351

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|172039424|ref|YP_001805925.1| putative site-specific DNA-methyltransferase [Cyanothece sp. ATCC
           51142]
 gi|171700878|gb|ACB53859.1| putative site-specific DNA-methyltransferase [Cyanothece sp. ATCC
           51142]
          Length = 729

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 37/89 (41%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ RER+ II  LN    F         P L   L++  + +     +    
Sbjct: 146 LNAKDFGVPQNRERIIIIGTLNKKFNFDLIDIQKNVPSLRSFLDQKGNFEYLDPKEYTLI 205

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNT 89
            + +K+ + +   G+     ++     NT
Sbjct: 206 QEPKKQLSGLIFIGYRNKNIWKKGIRPNT 234


>gi|34451619|gb|AAQ72366.1| TspRI methylase [Thermus sp. R]
          Length = 431

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           + A DFGVPQ R+R++ +      +EF++P P  
Sbjct: 215 LNAADFGVPQHRKRIFFVGVRPG-IEFRWPRPTH 247


>gi|281491829|ref|YP_003353809.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
 gi|281375540|gb|ADA65046.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
          Length = 351

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 10/94 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP----RLGDILEEHIDDKSTISN 55
           ++A ++G+PQ+RER++I+   N  + +F F  P    P     L  +L++  D+K   S+
Sbjct: 159 LRAVEYGIPQKRERVFIVGIRNDLNKKFHFADPPIQSPLDYTPLKKVLQKDFDEKYYFSD 218

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNT 89
           +  EG  K K +  +       G   + +  +NT
Sbjct: 219 RAVEGMLKSKMSKIMNK-----GRAQDINQPSNT 247


>gi|259500984|ref|ZP_05743886.1| modification methylase EcoRII [Lactobacillus iners DSM 13335]
 gi|302190566|ref|ZP_07266820.1| DNA-cytosine methyltransferase [Lactobacillus iners AB-1]
 gi|259167678|gb|EEW52173.1| modification methylase EcoRII [Lactobacillus iners DSM 13335]
          Length = 336

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L    + +  I N+  
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVENFLLPDNEVRDLIVNRTD 211

Query: 58  --------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                      +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNINYNAPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|167465361|ref|ZP_02330450.1| DNA-cytosine methyltransferase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 432

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 41/126 (32%), Gaps = 36/126 (28%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--------------------------PSVEFKFPTPLG 34
           + +  +GVPQ RER++II   +                           +  F +P    
Sbjct: 144 LNSKFYGVPQSRERVFIICSRDVEPEAWSTEGNGVLTKAKRRLQMMGARTFNFDWPKNSE 203

Query: 35  IKPRLGDILEEHIDDKSTIS-NKLWEGHQKRKENNKI---------AGKGFGYGLFFENS 84
           +  RL DILE  +D+K  +S +K  +  ++                          +   
Sbjct: 204 VTTRLRDILETEVDEKYYLSPDKTLKLLEEISSKPDSVSVIGRLDGVNGHDICKRVYSTE 263

Query: 85  ATTNTL 90
           +   T+
Sbjct: 264 SVAPTI 269


>gi|218439646|ref|YP_002377975.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424]
 gi|218172374|gb|ACK71107.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424]
          Length = 320

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFG+PQ+RER++I+  L   + F +P        L +ILE  +      S ++
Sbjct: 159 LNALDFGLPQKRERIFIVGCL-DPIPFIWPNSTRPFKPLQEILETQVSSSYYASEQI 214


>gi|254779148|ref|YP_003057253.1| M. Hpy99XI, type II cytosine specific DNA methyltransferase
           [Helicobacter pylori B38]
 gi|254001059|emb|CAX29005.1| M. Hpy99XI, type II cytosine specific DNA methyltransferase
           [Helicobacter pylori B38]
          Length = 348

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQVRERVILVGVLKRFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|317500279|ref|ZP_07958506.1| cytosine-specific methyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087487|ref|ZP_08336423.1| hypothetical protein HMPREF1025_00006 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|316898322|gb|EFV20366.1| cytosine-specific methyltransferase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330410467|gb|EGG89898.1| hypothetical protein HMPREF1025_00006 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 410

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHID 48
           + A DFGVPQ+RERL  +   N     V F FP     KP L DIL +  +
Sbjct: 227 LNAWDFGVPQKRERLITVGIRNDLVGKVSFSFPKEHNYKPVLRDILLDCPE 277


>gi|85703012|ref|ZP_01034116.1| DNA cytosine methyltransferase M.NgoMIII [Roseovarius sp. 217]
 gi|85671940|gb|EAQ26797.1| DNA cytosine methyltransferase M.NgoMIII [Roseovarius sp. 217]
          Length = 387

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 33/75 (44%), Gaps = 5/75 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + ++GVPQRRER++++ F   + +E+ FP P   +     +L     D+         
Sbjct: 180 LNSANYGVPQRRERVFLVGFRADTGIEWHFPKPTHSR---DALLWSQWRDEVYWDLHRVA 236

Query: 60  GHQKRKENNKIAGKG 74
             + R E      + 
Sbjct: 237 -RKNRPEGGAAKARS 250


>gi|158320884|ref|YP_001513391.1| DNA-cytosine methyltransferase [Alkaliphilus oremlandii OhILAs]
 gi|158141083|gb|ABW19395.1| DNA-cytosine methyltransferase [Alkaliphilus oremlandii OhILAs]
          Length = 329

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A DF VPQ R+R++ I F       +FKFP P+  +  L D + +  +      +K
Sbjct: 145 LNANDFQVPQDRKRVFYIGFRKDLGIADFKFPKPIEPRLTLKDAIWDLRETAIPALDK 202


>gi|208434405|ref|YP_002266071.1| type II DNA modification enzyme [Helicobacter pylori G27]
 gi|208432334|gb|ACI27205.1| type II DNA modification enzyme [Helicobacter pylori G27]
          Length = 348

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGTLKRFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|167043721|gb|ABZ08413.1| putative C-5 cytosine-specific DNA methylase [uncultured marine
           crenarchaeote HF4000_APKG3B16]
          Length = 377

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 37/98 (37%), Gaps = 10/98 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+G+PQ R+R++I+        EF+FP P         +  +    K   S +   
Sbjct: 167 LDAKDYGLPQDRQRIFIVGVRKDLEYEFEFPKPTHGPGLKPYVTMKDYGIKDIHSLET-- 224

Query: 60  GHQKRKENNKIAGKGFGYGLFFEN-----SATTNTLSA 92
             +  ++        FG      N     +  + T+ A
Sbjct: 225 --EVFRDGKSHGVDYFGARYMSRNRLRKWNDVSFTIPA 260


>gi|160947479|ref|ZP_02094646.1| hypothetical protein PEPMIC_01413 [Parvimonas micra ATCC 33270]
 gi|158446613|gb|EDP23608.1| hypothetical protein PEPMIC_01413 [Parvimonas micra ATCC 33270]
          Length = 348

 Score = 63.1 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+GVPQ R+R++ + F     V+F+ P P   K    D + +  D       K
Sbjct: 150 LNASDYGVPQDRKRVFYVGFRKDLKVKFEPPKPYETKLTFKDTIFDLKDSAIPALEK 206


>gi|6272296|gb|AAF06073.1|AF072715_4 putative methylase [Mycoplasma mycoides subsp. capri]
          Length = 390

 Score = 62.7 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 37/102 (36%), Gaps = 12/102 (11%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
            + D+G  Q RER++ I +L+    F FP PL  K  +  I++   D K    N L +  
Sbjct: 230 NSTDYGSCQNRERVFCISYLDKQKNFTFPKPLITKKEIDSIIKNDDDMKEC--NHLLKYL 287

Query: 62  ----------QKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                       +   +K           +       TL+A 
Sbjct: 288 NNDFKPTQNNITKTRLDKKYTNFNSEAYVYLAKGYGPTLTAS 329


>gi|229824483|ref|ZP_04450552.1| hypothetical protein GCWU000282_01806 [Catonella morbi ATCC 51271]
 gi|229786084|gb|EEP22198.1| hypothetical protein GCWU000282_01806 [Catonella morbi ATCC 51271]
          Length = 406

 Score = 62.7 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDD--KSTISN 55
           +   D G +PQ RER+YI+ F +      F+FP  + +  +L D+++ HI +  K   ++
Sbjct: 156 LNGKDHGNIPQNRERIYIVGFRDKQAFDAFQFPESVDLTTKLDDVIDFHIAENAKYYYTS 215

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                +++  +        + +   +     S    TL+A
Sbjct: 216 DKQRFYRELADTITSQETVYQWRRQYVRENKSGVVPTLTA 255


>gi|296491874|ref|YP_003662339.1| putative DNA (cytosine-5-)-methyltransferase [Xenorhabdus
           nematophila ATCC 19061]
 gi|289176759|emb|CBJ92924.1| putative DNA (cytosine-5-)-methyltransferase [Xenorhabdus
           nematophila ATCC 19061]
          Length = 575

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 42/99 (42%), Gaps = 5/99 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL---GDILEEHIDDKSTISNKL 57
           +   +FGV +RR+RL ++   +    F+      ++ +     +ILE    D      K 
Sbjct: 315 LDGNEFGVIERRKRLCVVALSHGIDGFELEKVQPVRTKESRIHEILEPVPLDSERW--KS 372

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           ++    ++  +K AGKGF   L   +     T+   Y K
Sbjct: 373 FDYLADKELRDKAAGKGFSRQLLTGDDEYCGTIGKDYAK 411


>gi|332362221|gb|EGJ40021.1| DNA methylase [Streptococcus sanguinis SK1056]
          Length = 412

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 39/100 (39%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEE--HIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        F+FP  + +   L D++     +D+      
Sbjct: 164 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTTLQDVINFGDQLDEVYYYRE 223

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                + + K         + +   +     +    TL+A
Sbjct: 224 GKQNFYDQLKFEVTSQDTVYQWRRQYVRENKNGVVPTLTA 263


>gi|314055145|ref|YP_004063483.1| putative cytosine-specific methyltransferase [Ostreococcus tauri
           virus 2]
 gi|313575036|emb|CBI70049.1| putative cytosine-specific methyltransferase [Ostreococcus tauri
           virus 2]
          Length = 349

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 32/58 (55%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           +KA + GVPQ+RERL+I+   +    F+FP P   +  L DIL   ++    +  +L 
Sbjct: 152 LKAHEHGVPQKRERLFIVGSRDADFTFEFPEPSNNEVGLKDILRFDMEGALQVPKELI 209


>gi|295110826|emb|CBL24779.1| DNA-methyltransferase (dcm) [Ruminococcus obeum A2-162]
          Length = 312

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 35/98 (35%), Gaps = 5/98 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRL---GDILEEHIDDKSTISNK 56
           + A D+GVPQ R+R+ II   N  + E+ +P P   K       + +             
Sbjct: 142 LNAADYGVPQTRQRVIIIGVRNDINFEYIYPLPTNSKNGKDGLPEWISVSEAMAHIPDPD 201

Query: 57  LWEGHQKRK-ENNKIAGKGFGYGLFFENSATTNTLSAR 93
           L            K+   G+      +      T++AR
Sbjct: 202 LPNDLPNHVYSKYKLNFNGYLGHRPLDPDKPAPTVTAR 239


>gi|284051619|ref|ZP_06381829.1| DNA-cytosine methyltransferase [Arthrospira platensis str. Paraca]
          Length = 443

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDIL----EEHIDDKSTI 53
           + A DFG+PQ R+R++I+           F+FP PL   P+L + +    +E +  K   
Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVEGVSQEAVIKKKFS 219

Query: 54  SNKLWEGHQKRKENNKIAGK 73
              L+  H            
Sbjct: 220 PQVLFGNHIPPARGRFQKND 239


>gi|317127845|ref|YP_004094127.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522]
 gi|315472793|gb|ADU29396.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522]
          Length = 363

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID-DKSTISNKLWE 59
           + A D+GVPQ R R++ +  L+ +  F+FP          D L +    +K   S+  +E
Sbjct: 152 LNAADYGVPQHRHRVFFVGVLDGA--FEFPRKKNEVISTKDALSDLPSLEKFEGSDVEFE 209

Query: 60  GH 61
            H
Sbjct: 210 YH 211


>gi|282899425|ref|ZP_06307392.1| DNA-cytosine methyltransferase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195689|gb|EFA70619.1| DNA-cytosine methyltransferase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 384

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 25/60 (41%), Gaps = 4/60 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A ++G+PQRRER++I+      ++ + FP P         +L               +
Sbjct: 176 LDAANYGIPQRRERVFIVGIRQDLNINWSFPQPSHSYDS---LLWSQFVSYDYWERHQIK 232


>gi|291570812|dbj|BAI93084.1| cytosine-specific DNA methyltransferase [Arthrospira platensis
           NIES-39]
          Length = 443

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDIL----EEHIDDKSTI 53
           + A DFG+PQ R+R++I+           F+FP PL   P+L + +    +E +  K   
Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVEGVSQEAVIKKKFS 219

Query: 54  SNKLWEGHQKRKENNKIAGK 73
              L+  H            
Sbjct: 220 PQVLFGNHIPPARGRFQKND 239


>gi|317009105|gb|ADU79685.1| type II DNA modification [Helicobacter pylori India7]
          Length = 348

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGVLKSFKQKFYFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|328946253|gb|EGG40397.1| modification methylase Sau96I [Streptococcus sanguinis SK1087]
          Length = 333

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 41/100 (41%), Gaps = 15/100 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A D+GV Q+RER+ ++   N   +   F++P P   KP L DIL +         + +
Sbjct: 151 LNAWDYGVAQKRERMIMVGIRNDLTDKITFEYPEPHDYKPVLKDILLD-------CPSSV 203

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97
              + + K+         GY      +     ++  Y K 
Sbjct: 204 GAQYSEYKKKIFELVPPGGYWRDIPEN-----IAKEYMKS 238


>gi|325269502|ref|ZP_08136118.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
 gi|324988121|gb|EGC20088.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
          Length = 393

 Score = 62.7 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 38/91 (41%), Gaps = 14/91 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK---- 56
           +   D+GVPQ R+R+Y I F   + +FK+P P+ +   + D L++  + +  +  K    
Sbjct: 180 LNGKDYGVPQSRDRIYCIGFKKET-DFKYPAPIPLVKTVYDYLQKKFEKRYLLRQKGVNF 238

Query: 57  ---LWEGHQKRKEN------NKIAGKGFGYG 78
                   +   +        +   + F + 
Sbjct: 239 ITRSINYQKSYTQINGDILLCQKRNQQFNWH 269


>gi|322376119|ref|ZP_08050628.1| DNA modification methylase [Streptococcus sp. C300]
 gi|321278887|gb|EFX55931.1| DNA modification methylase [Streptococcus sp. C300]
          Length = 406

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 39/100 (39%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEE--HIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        F+FP  + +   L D++     +D+      
Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDSFEFPEEIKLTTSLQDVINFGDKLDEVYYYRE 217

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                + + K         + +   +     +    TL+A
Sbjct: 218 GKQNFYDQLKFEVTSQDTVYQWRRQYVRENKNGVVPTLTA 257


>gi|261840146|gb|ACX99911.1| cytosine-specific methyltransferase [Helicobacter pylori 52]
          Length = 343

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDD 49
           + A + GV Q+RERL+I+      +  F FP PL  K  L DIL +    
Sbjct: 151 LNASNHGVAQKRERLFIVGIRKDLNRSFNFPKPLKNKKVLKDILLDVPKS 200


>gi|291618717|ref|YP_003521459.1| HsdRM [Pantoea ananatis LMG 20103]
 gi|291153747|gb|ADD78331.1| HsdRM [Pantoea ananatis LMG 20103]
          Length = 313

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 34/101 (33%), Gaps = 23/101 (22%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLG--------IKPRLGDILEEHIDDKS 51
           + A D+GVPQ R+R++I+    N +VE+ FP P                  L E    + 
Sbjct: 141 LNAMDYGVPQERKRIFIVGIKDNINVEYSFPEPTHGIGGHDFVTIKDAISHLPEWPTGEF 200

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                 W    + +  N                  + T+ A
Sbjct: 201 YDQGFHWYYMSRNRRQNWEQ--------------VSKTIVA 227


>gi|12229862|sp|Q59603|MTB1_NEIGO RecName: Full=Modification methylase NgoBI; Short=M.NgoBI; AltName:
           Full=Cytosine-specific methyltransferase NgoBI;
           Short=M.NgoI
 gi|5924404|gb|AAB03206.2| cytosine DNA methylase M.NgoI [Neisseria gonorrhoeae]
          Length = 317

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YI+ F + ++ F FP P+     LG++LE   D + +    L + 
Sbjct: 142 LNTLDFGLPQKRERIYIVGF-SDNIPFYFPEPINQYRPLGELLENDRDVEPSYF--LSDT 198

Query: 61  HQKRKENNKIAG 72
            ++++       
Sbjct: 199 LKQKRLAALKKA 210


>gi|9622224|gb|AAF89681.1| cytosine-specific methyltransferase [Bacillus sp. LU11]
          Length = 365

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37
           + A D+GVPQRR+R++I+      ++F FP P   + 
Sbjct: 146 LNAADYGVPQRRKRIFIVGTREG-IKFNFPLPTHNEK 181


>gi|322383485|ref|ZP_08057261.1| hypothetical protein PL1_3347 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321152224|gb|EFX45054.1| hypothetical protein PL1_3347 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 425

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 43/126 (34%), Gaps = 36/126 (28%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--------------------------PSVEFKFPTPLG 34
           + +  +GVPQ RER++I+   +                           +  F +P    
Sbjct: 144 LNSKFYGVPQSRERVFIVCSRDVEPEAWSIEGNGVLAKAKRRLQAMGARTFNFDWPKNGE 203

Query: 35  IKPRLGDILEEHIDDKSTISN----KLWEGHQKRKENNK------IAGKGFGYGLFFENS 84
           +  RL DILE  +D+K  +S     KL E    + ++ +                 +   
Sbjct: 204 VMTRLRDILEPEVDEKYYLSPDKTLKLSEEISSKSDSVRVVGRLAEVNGHDICKRVYSAE 263

Query: 85  ATTNTL 90
           +   T+
Sbjct: 264 SVAPTI 269


>gi|77409601|ref|ZP_00786278.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae COH1]
 gi|77171795|gb|EAO74987.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae COH1]
          Length = 333

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDD 49
           + A D+GV Q+RER+ ++   N  V    F++P P   KP L DIL +    
Sbjct: 151 LNAWDYGVAQKRERMIMVGIRNDLVNMTSFEYPKPHDYKPVLRDILLDCPPS 202


>gi|257061088|ref|YP_003138976.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|256591254|gb|ACV02141.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 331

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 30/78 (38%), Gaps = 2/78 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ RER+ II   +   +F         P+L + L++  +     S +    
Sbjct: 146 LNAKDFGVPQHRERIVIIATRHKKFDFNLIQQQKPIPKLREFLDKTGNFDYLHSKEY--T 203

Query: 61  HQKRKENNKIAGKGFGYG 78
                +         GY 
Sbjct: 204 LIDNPKEQLSGLIFVGYR 221


>gi|126740127|ref|ZP_01755817.1| DNA modification methylase M.NGOI [Roseobacter sp. SK209-2-6]
 gi|126718946|gb|EBA15658.1| DNA modification methylase M.NGOI [Roseobacter sp. SK209-2-6]
          Length = 319

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R R+ I+      S +F +P P       +G+ L + + ++     + W
Sbjct: 145 LNASDYGVPQLRPRVAIVALRKEFSGQFNWPEPLPHNPRTVGETLLDLMQERGWRGAEAW 204

Query: 59  E 59
            
Sbjct: 205 A 205


>gi|308071385|ref|YP_003872990.1| Modification methylase AquI alpha subunit (cytosine-specific
           methyltransferase AquI alpha subunit) [Paenibacillus
           polymyxa E681]
 gi|305860664|gb|ADM72452.1| Modification methylase AquI alpha subunit (Cytosine-specific
           methyltransferase AquI alpha subunit) [Paenibacillus
           polymyxa E681]
          Length = 366

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 27/82 (32%), Gaps = 13/82 (15%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK------------PRLGDILEEHID 48
            A D+GVPQ+RER++++      +  F FP P   +              + D L   + 
Sbjct: 173 NAADYGVPQKRERVFLVGMRRDLNRTFLFPEPTHNELGTDGKKRWVTVRDVFDRLGNIVH 232

Query: 49  DKSTISNKLWEGHQKRKENNKI 70
                S       +        
Sbjct: 233 HHVNYSQDRLNYMRMIPIGGGN 254


>gi|331270911|ref|YP_004385622.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
 gi|329127303|gb|AEB77247.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
          Length = 318

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEF--KFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           M   D+G+P  R RLYI+       +F  KFPT + +K  + D+LE+ ++DK  +++K++
Sbjct: 151 MNTSDYGLPHTRRRLYIVGQRKDLGDFDYKFPTEIELKLNVQDLLEKDVNDKYYLTDKMY 210

Query: 59  EGHQ 62
           +   
Sbjct: 211 KTVM 214


>gi|170680813|ref|YP_001746263.1| DNA-cytosine methyltransferase family protein [Escherichia coli
           SMS-3-5]
 gi|307315390|ref|ZP_07594959.1| DNA-cytosine methyltransferase [Escherichia coli W]
 gi|33413740|gb|AAN28260.1| Mth [Enterobacteria phage WPhi]
 gi|170518531|gb|ACB16709.1| DNA-cytosine methyltransferase family protein [Escherichia coli
           SMS-3-5]
 gi|306905264|gb|EFN35809.1| DNA-cytosine methyltransferase [Escherichia coli W]
 gi|315063217|gb|ADT77544.1| DNA cytosine methylase [Escherichia coli W]
 gi|323380718|gb|ADX52986.1| DNA-cytosine methyltransferase [Escherichia coli KO11]
          Length = 312

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/101 (14%), Positives = 32/101 (31%), Gaps = 11/101 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG-----IKPRLGDILEEH---IDDKS 51
           + A  +GV Q R+R++I+       + +KFP P           + D +         + 
Sbjct: 141 LNASHYGVSQDRKRIFIVGIRKDYGITYKFPKPTHGDGLTPYSTIRDAIGHMPVWPVGEF 200

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFF--ENSATTNTL 90
             ++  W    + +  +                    + TL
Sbjct: 201 YDADFHWYYLSRNRRQDWDQISKTIVANPRHMPLHPISPTL 241


>gi|317010732|gb|ADU84479.1| type II DNA modification (methyltransferase) [Helicobacter pylori
           SouthAfrica7]
          Length = 348

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P  +   L D L +    +S  +     
Sbjct: 145 LNALDYGVPQMRERVILVGVLKSFKQKFYFPKPTKMHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|291549830|emb|CBL26092.1| DNA-methyltransferase (dcm) [Ruminococcus torques L2-14]
          Length = 410

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHID 48
           + A D+GVPQ+RERL  I   N  VE   F FP     KP L DIL +  +
Sbjct: 227 LNAWDYGVPQKRERLITIGIRNDLVEKTSFTFPKEQEYKPVLRDILLDCPE 277


>gi|261837889|gb|ACX97655.1| type II m5C methylase [Helicobacter pylori 51]
          Length = 348

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGTLKSFKQKFHFPKPIKAHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|329769727|ref|ZP_08261128.1| hypothetical protein HMPREF0433_00892 [Gemella sanguinis M325]
 gi|328838089|gb|EGF87707.1| hypothetical protein HMPREF0433_00892 [Gemella sanguinis M325]
          Length = 406

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDK--STISN 55
           +   D+G +PQ RER+YI+ FL      +F+FP  + ++ +L DI++  I +K      +
Sbjct: 155 LNGKDYGNIPQNRERIYIVGFLEKESYDKFEFPNEIKLETKLSDIIDFDIKEKEIYYYRD 214

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                + K K+        + +   +     S     L+A
Sbjct: 215 GKQPFYDKLKDKIISQNTVYQWRRQYVRENKSGVVPALTA 254


>gi|254804105|ref|YP_003082326.1| putative type II DNA modification methyltransferase [Neisseria
           meningitidis alpha14]
 gi|254667647|emb|CBA03458.1| putative type II DNA modification methyltransferase [Neisseria
           meningitidis alpha14]
          Length = 315

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   DFG+PQ+RER+YII F + ++ F FP P+     LG++LE   D + +    L + 
Sbjct: 142 LNTLDFGLPQKRERIYIIGF-SDNIPFYFPEPINQYRPLGELLENDRDVEPSYF--LSDA 198

Query: 61  HQKRKENNKIAG 72
            ++++       
Sbjct: 199 LKQKRLAALKKA 210


>gi|57506146|ref|ZP_00372067.1| cytosine specific DNA methyltransferase (DDEM) [Campylobacter
           upsaliensis RM3195]
 gi|57015541|gb|EAL52334.1| cytosine specific DNA methyltransferase (DDEM) [Campylobacter
           upsaliensis RM3195]
          Length = 316

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 38/94 (40%), Gaps = 6/94 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A  + VPQ R+R+ II        E  FP PL I+P+   IL + I D     ++   
Sbjct: 143 LNANAYAVPQNRKRVIIIGRRKDIKREIDFPKPLNIEPK---ILFQAIGDLPKDYDENIS 199

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            H      +KI   G+             T++ R
Sbjct: 200 NHTG--STHKIRINGYIGNRALSWDKPAPTITGR 231


>gi|317180646|dbj|BAJ58432.1| Type II DNA modification enzyme [Helicobacter pylori F32]
          Length = 348

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|229060735|ref|ZP_04198090.1| Modification methylase Eco47II [Bacillus cereus AH603]
 gi|228718382|gb|EEL70014.1| Modification methylase Eco47II [Bacillus cereus AH603]
          Length = 198

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 39/115 (33%), Gaps = 15/115 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK--- 56
           + A  F V Q R+R++I+   N  +V F FPT +       D + +     +  S +   
Sbjct: 35  LDAVMFEVAQHRKRVFIVGVRNDMNVSFNFPTGISAVVTPRDAIGDLPSPDTIKSREKVL 94

Query: 57  --------LWEGHQKRKENNK---IAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
                    W      +  +         F           + T+++   KDG E
Sbjct: 95  GTFPKHTATWTSPTPERILDLITNPKPNQFNGVRKLSWDQPSYTITSHIAKDGRE 149


>gi|296126560|ref|YP_003633812.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563]
 gi|296018376|gb|ADG71613.1| DNA-cytosine methyltransferase [Brachyspira murdochii DSM 12563]
          Length = 311

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/100 (22%), Positives = 41/100 (41%), Gaps = 9/100 (9%)

Query: 1   MKACDF-GVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + + ++  +PQ RER++I  F    V     FKFP P+ +   + D ++    D     N
Sbjct: 141 LNSAEYSNIPQNRERIFIAAFSKEKVCSYSNFKFPEPVELTKTIHDFIDHEKQDDIYYYN 200

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
              + ++   EN       + +   +     S    TL+A
Sbjct: 201 ST-KYYKIFNENIINKDTVYQWRRHYVRENKSNLCPTLTA 239


>gi|269121452|ref|YP_003309629.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
 gi|268615330|gb|ACZ09698.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
          Length = 372

 Score = 62.3 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS-NKLWE 59
           + A ++ +PQ RERL+ +  L+  V++ FP P  +   L D+LE+ +D+K  I+  K   
Sbjct: 150 LNALNYEIPQNRERLFCLSILDDKVKYNFPGPKKLNILLKDLLEKEVDEKYFINEEKTKA 209

Query: 60  GHQKRKENNKI 70
             +K K+    
Sbjct: 210 FIEKYKDKILE 220


>gi|315653956|ref|ZP_07906872.1| modification methylase EcoRII [Lactobacillus iners ATCC 55195]
 gi|315488652|gb|EFU78298.1| modification methylase EcoRII [Lactobacillus iners ATCC 55195]
          Length = 336

 Score = 61.9 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL- 57
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L    + +  I N+  
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIKRESFVFPQPFKLNRFVENFLLPDNEVRDLIVNRTD 211

Query: 58  --------WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                      +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNIHYNSPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|171920707|ref|ZP_02931926.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 13
           str. ATCC 33698]
 gi|185179015|ref|ZP_02964765.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 5
           str. ATCC 27817]
 gi|188024024|ref|ZP_02996783.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 7
           str. ATCC 27819]
 gi|188518336|ref|ZP_03003849.1| cytosine-specific methyltransferase NlaX [Ureaplasma urealyticum
           serovar 11 str. ATCC 33695]
 gi|188524309|ref|ZP_03004347.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           12 str. ATCC 33696]
 gi|198273488|ref|ZP_03206024.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           4 str. ATCC 27816]
 gi|225550923|ref|ZP_03771872.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           2 str. ATCC 27814]
 gi|225551062|ref|ZP_03772008.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           8 str. ATCC 27618]
 gi|171903447|gb|EDT49736.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 13
           str. ATCC 33698]
 gi|184209104|gb|EDU06147.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 5
           str. ATCC 27817]
 gi|188019052|gb|EDU57092.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 7
           str. ATCC 27819]
 gi|188997975|gb|EDU67072.1| cytosine-specific methyltransferase NlaX [Ureaplasma urealyticum
           serovar 11 str. ATCC 33695]
 gi|195660089|gb|EDX53469.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           12 str. ATCC 33696]
 gi|198250008|gb|EDY74788.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           4 str. ATCC 27816]
 gi|225378877|gb|EEH01242.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           8 str. ATCC 27618]
 gi|225380077|gb|EEH02439.1| DNA (cytosine-5-)-methyltransferase [Ureaplasma urealyticum serovar
           2 str. ATCC 27814]
          Length = 319

 Score = 61.9 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 39/98 (39%), Gaps = 6/98 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   D+G VPQ RER+YI+ F        FK+P P+ +   + D+++ +           
Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEAFKYPCPITLTNTIRDVIDFNDKKLEKYYYNN 205

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
            + +   K         + +   +     S    TL+A
Sbjct: 206 SKYYSLLKPIMTKQDTIYQWRRVYCRENKSNVCPTLTA 243


>gi|317179147|dbj|BAJ56935.1| Type II DNA modification enzyme [Helicobacter pylori F30]
          Length = 351

 Score = 61.9 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|195867949|ref|ZP_03079946.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           9 str. ATCC 33175]
 gi|195660345|gb|EDX53605.1| cytosine-specific methyltransferase [Ureaplasma urealyticum serovar
           9 str. ATCC 33175]
          Length = 319

 Score = 61.9 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 39/98 (39%), Gaps = 6/98 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   D+G VPQ RER+YI+ F        FK+P P+ +   + D+++ +           
Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEAFKYPCPITLTNTIRDVIDFNDKKLEKYYYNN 205

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
            + +   K         + +   +     S    TL+A
Sbjct: 206 SKYYSLLKPIMTKQDTIYQWRRVYCRENKSNVCPTLTA 243


>gi|170077805|ref|YP_001734443.1| Type II cytosine-5 DNA methyltransferase [Synechococcus sp. PCC
           7002]
 gi|462645|sp|P34882|MTAA_SYNP2 RecName: Full=Modification methylase AquI subunit alpha;
           Short=M.AquI subunit alpha; Short=M.AquiA; AltName:
           Full=Cytosine-specific methyltransferase AquI subunit
           alpha
 gi|2126509|pir||I39659 modification methylase AquI, alpha protein - Synechococcus sp. (PCC
           7002)
 gi|142180|gb|AAA22067.1| M.AquI alpha protein [Synechococcus sp. PCC 7002]
 gi|169885474|gb|ACA99187.1| DNA-cytosine methyltransferase [Synechococcus sp. PCC 7002]
          Length = 248

 Score = 61.9 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           + A DFGVPQ RER++I+        F+FP P  
Sbjct: 161 LNAADFGVPQFRERVFIVGNRLGK-TFQFPEPTH 193


>gi|313667088|gb|ADR72987.1| M2.BsmFI [Geobacillus stearothermophilus]
          Length = 365

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37
           + A D+GVPQRR+R++I+      V+F FP P   + 
Sbjct: 146 LNAADYGVPQRRKRIFIVGTREG-VKFNFPLPTHNEK 181


>gi|254412384|ref|ZP_05026158.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196180694|gb|EDX75684.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 221

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 1/58 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + D+GV Q RER++I+        F+FP P   K      L     +K    N L 
Sbjct: 161 LNSADYGVAQLRERVFIVATR-IKPSFRFPLPTHSKFDSQLSLFPPPREKPLTINALI 217


>gi|79835495|gb|ABB52098.1| Mod [Arthrospira platensis]
          Length = 412

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDIL----EEHIDDKSTI 53
           + A DFG+PQ R+R++I+           F+FP PL   P+L + +    +E +  K   
Sbjct: 160 LNASDFGLPQDRDRVFIVGIRRDINQGQNFQFPQPLNQHPQLFNFVEGVSQEAVIKKKFS 219

Query: 54  SNKLWEGHQKRKENNKIAGK 73
              L+  H            
Sbjct: 220 PQVLFGNHIPPARGRFQKND 239


>gi|331091845|ref|ZP_08340677.1| hypothetical protein HMPREF9477_01320 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402744|gb|EGG82311.1| hypothetical protein HMPREF9477_01320 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 410

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHID 48
           + A DFGVPQ+RERL  +   N     V F FP     KP L D+L +  +
Sbjct: 227 LNAWDFGVPQKRERLITVGIRNDLVGKVSFSFPKEHDYKPVLRDVLLDCPE 277


>gi|307710826|ref|ZP_07647254.1| DNA-cytosine methyltransferase family protein [Streptococcus mitis
           SK321]
 gi|307617432|gb|EFN96604.1| DNA-cytosine methyltransferase family protein [Streptococcus mitis
           SK321]
          Length = 406

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 39/100 (39%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEE--HIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        F+FP  + +   L D++     +D+      
Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTSLQDVINFGDKLDEVYYYRE 217

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                + + K         + +   +     +    TL+A
Sbjct: 218 GKQNFYDQLKFEVASQDTVYQWRRQYVRENKNGVVPTLTA 257


>gi|320326171|gb|EFW82226.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea
           str. B076]
          Length = 404

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIK 36
            A D+GVPQ+RER+++I F +   VE+ FP P    
Sbjct: 182 NAADYGVPQKRERVFLIGFRDDLEVEWSFPAPTHSY 217


>gi|261839303|gb|ACX99068.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori 52]
          Length = 348

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|217033040|ref|ZP_03438509.1| hypothetical protein HPB128_193g7 [Helicobacter pylori B128]
 gi|298736593|ref|YP_003729119.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
 gi|216945239|gb|EEC23921.1| hypothetical protein HPB128_193g7 [Helicobacter pylori B128]
 gi|298355783|emb|CBI66655.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
          Length = 351

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|322392562|ref|ZP_08066022.1| DNA methylase [Streptococcus peroris ATCC 700780]
 gi|321144554|gb|EFX39955.1| DNA methylase [Streptococcus peroris ATCC 700780]
          Length = 406

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 39/100 (39%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEE--HIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        F+FP  + +   L D++     +D+      
Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTSLQDVINFGDQLDEVYYYRE 217

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                + + K         + +   +     +    TL+A
Sbjct: 218 GKQNFYDQLKFEVTSQDTVYQWRRQYVRENKNGVVPTLTA 257


>gi|218247578|ref|YP_002372949.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|218168056|gb|ACK66793.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
          Length = 727

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 29/78 (37%), Gaps = 2/78 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ RER+ II   +   +F         P+L + L++  +       +    
Sbjct: 146 LNAKDFGVPQHRERIVIIATRHKKFDFNLIQQQKPIPKLREFLDKTGNFDYLHPKEY--T 203

Query: 61  HQKRKENNKIAGKGFGYG 78
                +         GY 
Sbjct: 204 LIDNPKEQLSGLIFVGYR 221


>gi|224796590|ref|YP_002641667.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 64b]
 gi|223929176|gb|ACN23896.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 64b]
 gi|312149869|gb|ADQ29935.1| DNA-cytosine methyltransferase [Borrelia burgdorferi N40]
          Length = 324

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FGVPQ RER+Y       +      ++  P     K  L DILE+ +     I  
Sbjct: 155 LNASNFGVPQARERVYFACLRKDTGTSEKLKYSKPKETFKKIYLEDILEKDVPKSMYIDR 214

Query: 56  KLWE------GHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
           K  E       ++ R     I  KG      +       TLSA
Sbjct: 215 KDIEITKKIPTNELRPIRIGIVNKGGQGERIYSPKGHAITLSA 257


>gi|254475144|ref|ZP_05088530.1| DNA-cytosine methyltransferase [Ruegeria sp. R11]
 gi|214029387|gb|EEB70222.1| DNA-cytosine methyltransferase [Ruegeria sp. R11]
          Length = 324

 Score = 61.9 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R R+ I+      S +F +P P     P +G+ L + + ++     + W
Sbjct: 145 LNASDYGVPQLRPRVAIVALRKEFSGQFAWPDPLPHNPPTVGETLLDLMQERGWRGAEAW 204

Query: 59  E 59
            
Sbjct: 205 A 205


>gi|167630879|ref|YP_001681378.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1]
 gi|167593619|gb|ABZ85367.1| DNA-cytosine methyltransferase [Heliobacterium modesticaldum Ice1]
          Length = 319

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R R+  +   N    +F FPT +   P +G+IL + +     I  K W
Sbjct: 145 LNASDYGVPQLRPRVVFVAIRNDLAADFTFPTEIMHAPTVGEILGDLMGANGWIGVKQW 203


>gi|290343528|ref|YP_003494895.1| hypothetical protein OTV1_055 [Ostreococcus tauri virus 1]
 gi|260160943|emb|CAY39643.1| hypothetical protein OTV1_055 [Ostreococcus tauri virus 1]
          Length = 351

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +KA + GVPQ+RERL+I+   +    F FP P      L DIL+  ++    +  +L +
Sbjct: 154 LKAHEHGVPQKRERLFIVGSRDVDFTFDFPEPSANDVGLKDILKFDMEGALKVPKELID 212


>gi|219724141|ref|YP_002477179.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Borrelia
           burgdorferi 156a]
 gi|225575842|ref|YP_002724642.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 118a]
 gi|219693145|gb|ACL34349.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Borrelia
           burgdorferi 156a]
 gi|225546742|gb|ACN92742.1| DNA-cytosine methyltransferase [Borrelia burgdorferi 118a]
          Length = 311

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/103 (27%), Positives = 39/103 (37%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A +FGVPQ RER+Y       +      ++  P     K  L DILE+ +     I  
Sbjct: 142 LNASNFGVPQARERVYFACLRKDTGTSEKLKYSKPKETFKKIYLEDILEKDVPKSMYIDR 201

Query: 56  KLWE------GHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
           K  E       ++ R     I  KG      +       TLSA
Sbjct: 202 KDIEITKKIPTNELRPIRIGIVNKGGQGERIYSPKGHAITLSA 244


>gi|118601986|ref|YP_908686.1| cytosine-specific DNA methylase [Photobacterium damselae subsp.
           piscicida]
 gi|118614724|ref|YP_908507.1| cytosine-specific DNA methylase [Photobacterium damselae subsp.
           piscicida]
 gi|134044487|ref|YP_001101821.1| C-5 cytosine-specific DNA methylase [Yersinia ruckeri]
 gi|134044859|ref|YP_001102203.1| C-5 cytosine-specific DNA methylase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|134047248|ref|YP_001101999.1| C-5 cytosine-specific DNA methylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|165937989|ref|ZP_02226549.1| cytosine-specific DNA methylase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|229516190|ref|ZP_04405639.1| site-specific DNA methylase [Vibrio cholerae RC9]
 gi|237640283|ref|YP_002891138.1| Dcm [Escherichia coli]
 gi|237810027|ref|YP_002894466.1| Dcm [Escherichia coli]
 gi|237810223|ref|YP_002894662.1| Dcm [Salmonella enterica]
 gi|118596815|dbj|BAF38119.1| cytosine-specific DNA methylase [Photobacterium damselae subsp.
           piscicida]
 gi|118596995|dbj|BAF38298.1| cytosine-specific DNA methylase [Photobacterium damselae subsp.
           piscicida]
 gi|133904850|gb|ABO40867.1| C-5 cytosine-specific DNA methylase [Yersinia ruckeri]
 gi|133905167|gb|ABO41182.1| C-5 cytosine-specific DNA methylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|133905393|gb|ABO42155.1| C-5 cytosine-specific DNA methylase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165914012|gb|EDR32629.1| cytosine-specific DNA methylase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|229346840|gb|EEO11809.1| site-specific DNA methylase [Vibrio cholerae RC9]
 gi|229561502|gb|ACQ77705.1| Dcm [Escherichia coli]
 gi|229561707|gb|ACQ77909.1| Dcm [Salmonella enterica]
 gi|229561882|gb|ACQ78083.1| Dcm [Escherichia coli]
 gi|324008172|gb|EGB77391.1| C-5 cytosine-specific DNA methylase [Escherichia coli MS 57-2]
 gi|327536569|gb|AEA95402.1| C-5 cytosine-specific DNA methylase [Salmonella enterica subsp.
           enterica serovar Dublin]
 gi|332144438|dbj|BAK19658.1| C-5 cytosine-specific DNA methylase [Salmonella enterica subsp.
           enterica serovar Typhimurium]
          Length = 541

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 43/99 (43%), Gaps = 5/99 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG---DILEEHIDDKSTISNKL 57
           +   +FGV +RR+RL ++   +    F+      ++ +     DILE    D      K 
Sbjct: 281 LDGNEFGVIERRKRLCVVALSHGIDGFELEKVQPVRTKESRIQDILEPVPLDSERW--KS 338

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           ++   +++  +K AGKGF   L   +     T+   Y K
Sbjct: 339 FDYLAEKELRDKAAGKGFSRQLLTGDDEFCGTIGKDYAK 377


>gi|268680341|ref|YP_003304772.1| DNA-cytosine methyltransferase [Sulfurospirillum deleyianum DSM
           6946]
 gi|268618372|gb|ACZ12737.1| DNA-cytosine methyltransferase [Sulfurospirillum deleyianum DSM
           6946]
          Length = 335

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 41/100 (41%), Gaps = 7/100 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK-LW 58
           + A D+ VPQ R+RL+ + F    ++ F+FP    +K  L D++ +  D+      K   
Sbjct: 143 LNAHDYKVPQDRQRLFFVGFRKDLNMTFEFPKAFPLKRYLKDVIWDLKDNALPAKEKNYT 202

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN-----SATTNTLSAR 93
            GH     N++     F       N        + T+ A 
Sbjct: 203 NGHACTLANHEYMTGSFSTIFMSRNRVRNWDEPSFTIQAG 242


>gi|200388503|ref|ZP_03215115.1| modification methylase HaeIII [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199605601|gb|EDZ04146.1| modification methylase HaeIII [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 361

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 39/99 (39%), Gaps = 9/99 (9%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG-IKPRLGDILEEHIDDKSTISN-KLW 58
            A  +GVPQ R+RL+II   N   + F+FP        +    L+ ++     I +  LW
Sbjct: 153 NARAYGVPQSRKRLFIIGVRNDLGQCFEFPAETHGKATKKNPHLKPYVSHGEAIRDLPLW 212

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN-----SATTNTLSA 92
              +  +  +   G  F +     N      +   T+ A
Sbjct: 213 PEGEFYERPHDPEG-HFSWYFMSRNRKALWDSPAYTVVA 250


>gi|312874943|ref|ZP_07734962.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2053A-b]
 gi|311089688|gb|EFQ48113.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2053A-b]
          Length = 336

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 40/103 (38%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHID--------DK 50
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L    +          
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIKRESFVFPQPFKLNRFVENFLLPDNEVRDLIVNRPD 211

Query: 51  STISNKL-WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
             +++K+    +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNIHYNSPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|168821212|ref|ZP_02833212.1| modification methylase HaeIII [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205342142|gb|EDZ28906.1| modification methylase HaeIII [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320088731|emb|CBY98489.1| C-5 cytosine-specific DNA methylase family protein [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 361

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 39/99 (39%), Gaps = 9/99 (9%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG-IKPRLGDILEEHIDDKSTISN-KLW 58
            A  +GVPQ R+RL+II   N   + F+FP        +    L+ ++     I +  LW
Sbjct: 153 NARAYGVPQSRKRLFIIGVRNDLGQSFEFPAETHGKATKKNPHLKPYVSHGEAIRDLPLW 212

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN-----SATTNTLSA 92
              +  +  +   G  F +     N      +   T+ A
Sbjct: 213 PEGEFYERPHDPEG-HFSWYFMSRNRKALWDSPAYTVVA 250


>gi|157151353|ref|YP_001449946.1| cytosine-specific methyltransferase [Streptococcus gordonii str.
           Challis substr. CH1]
 gi|157076147|gb|ABV10830.1| cytosine-specific methyltransferase [Streptococcus gordonii str.
           Challis substr. CH1]
          Length = 406

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/100 (21%), Positives = 40/100 (40%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEE--HIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        FKFP  + +   L D++     +D+     +
Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFKFPEAIKLTTSLQDVINFGDKLDEVYYYRD 217

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                + + K         + +   +     +    TL+A
Sbjct: 218 GKQNFYDQLKFEVTSQDTVYQWRRQYVRENKNGVVPTLTA 257


>gi|254442311|ref|ZP_05055787.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
 gi|198256619|gb|EDY80927.1| DNA-cytosine methyltransferase superfamily [Verrucomicrobiae
           bacterium DG1235]
          Length = 338

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 5/66 (7%)

Query: 3   ACDFGVPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + DFGVPQ RER+Y +         + +F FP        LG  L+   D    +S+  +
Sbjct: 156 SVDFGVPQMRERVYFVGVRKDLVNSNFDFTFPEKAKRVKGLGSYLKSK-DPSYALSDAGY 214

Query: 59  EGHQKR 64
              +K 
Sbjct: 215 AYLEKY 220


>gi|312874304|ref|ZP_07734336.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2052A-d]
 gi|311090177|gb|EFQ48589.1| DNA (cytosine-5-)-methyltransferase [Lactobacillus iners LEAF
           2052A-d]
          Length = 336

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/103 (21%), Positives = 40/103 (38%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHID--------DK 50
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + + L    +          
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVENFLLPDNEVRDLIVNRPD 211

Query: 51  STISNKL-WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
             +++K+    +          GKG      +       TLSA
Sbjct: 212 LVLNDKVNIHYNSPSTIRVGTVGKGGQGERIYSPKGIAITLSA 254


>gi|270686639|ref|ZP_06222860.1| modification methylase DsaV [Haemophilus influenzae HK1212]
 gi|270316163|gb|EFA28145.1| modification methylase DsaV [Haemophilus influenzae HK1212]
          Length = 225

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHID 48
          +KA D+G+PQ R R ++I F +  V   F FP P+ +K  + D+ +   D
Sbjct: 18 LKASDYGLPQLRPRAFMIGFRDDHVLGNFSFPEPIPLKFTMSDVWKGKCD 67


>gi|306824635|ref|ZP_07457980.1| DNA methylase [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304433203|gb|EFM36174.1| DNA methylase [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 410

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 39/100 (39%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEE--HIDDKSTISN 55
           +   D+G +PQ RER+YI+ F        F+FP  + +   L D++     +D+      
Sbjct: 158 LNGKDYGNIPQNRERIYIVGFDTKEAYDLFEFPEEIKLTTTLQDVINFGDKLDEVYYYRE 217

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
                + + K         + +   +     +    TL+A
Sbjct: 218 GKQNFYDQLKFEVTSQDTVYQWRRQYVRENKNGVVPTLTA 257


>gi|242348041|ref|YP_002995602.1| C-5 cytosine-specific DNA methylase [Aeromonas hydrophila]
 gi|224831860|gb|ACN66991.1| C-5 cytosine-specific DNA methylase [Aeromonas hydrophila]
          Length = 541

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 43/99 (43%), Gaps = 5/99 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG---DILEEHIDDKSTISNKL 57
           +   +FGV +RR+RL ++   +    F+      ++ +     DILE    D      K 
Sbjct: 281 LDGNEFGVIERRKRLCVVALSHGIDGFELEKVQPVRTKESRIQDILESVPLDSERW--KS 338

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           ++   +++  +K AGKGF   L   +     T+   Y K
Sbjct: 339 FDYLAEKELRDKAAGKGFSRQLLTGDDEFCGTIGKDYAK 377


>gi|268607976|ref|ZP_06141707.1| cytosine-specific DNA-methyltransferase Sau96I [Ruminococcus
           flavefaciens FD-1]
          Length = 407

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 37/100 (37%), Gaps = 15/100 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A D+GV Q+RERL  I   N       F FPTP   KP L D+L +    + T  ++ 
Sbjct: 224 LNAWDYGVAQKRERLITIGIRNDLTNQIKFTFPTPHEYKPVLRDVLLDCPKSEGTPYSE- 282

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97
                  K          GY            ++  Y K 
Sbjct: 283 ------YKRKIFELVPPGGYWRDIPED-----IAKEYMKS 311


>gi|209554428|ref|YP_002284952.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 10
           str. ATCC 33699]
 gi|209541929|gb|ACI60158.1| DNA-cytosine methyltransferase [Ureaplasma urealyticum serovar 10
           str. ATCC 33699]
          Length = 319

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 39/98 (39%), Gaps = 6/98 (6%)

Query: 1   MKACDFG-VPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   D+G VPQ RER+YI+ F        FK+P P+ +   + D+++ +           
Sbjct: 146 LNTMDYGNVPQNRERIYIVGFLSKKAYEVFKYPCPITLTNTIRDVIDFNDKKLEKYYYNN 205

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
            + +   K         + +   +     S    TL+A
Sbjct: 206 SKYYSLLKPIMTKQDTIYQWRRVYCRENKSNVCPTLTA 243


>gi|148826843|ref|YP_001291596.1| modification methylase HaeII [Haemophilus influenzae PittGG]
 gi|148718085|gb|ABQ99212.1| modification methylase HaeII [Haemophilus influenzae PittGG]
          Length = 318

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKL 57
           +   DFG+PQ+RER+YI+ FL   + F+FP P+G    L +ILE    + +   +S++L
Sbjct: 144 LNTLDFGLPQKRERIYIVGFL-DKLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL 201


>gi|83854666|ref|ZP_00948196.1| DNA modification methylase M.NGOI [Sulfitobacter sp. NAS-14.1]
 gi|83842509|gb|EAP81676.1| DNA modification methylase M.NGOI [Sulfitobacter sp. NAS-14.1]
          Length = 254

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R R+ I+       + F +P P     P +G+ L++ +  +     + W
Sbjct: 80  LNASDYGVPQLRPRVVIVALPKDRADFFDWPEPNPHNPPTVGETLKDLMAARGWRGAEDW 139

Query: 59  E 59
            
Sbjct: 140 A 140


>gi|319776347|ref|YP_004138835.1| Cytosine-specific methyltransferase [Haemophilus influenzae F3047]
 gi|329123500|ref|ZP_08252064.1| modification methylase HaeII [Haemophilus aegyptius ATCC 11116]
 gi|317450938|emb|CBY87164.1| Cytosine-specific methyltransferase [Haemophilus influenzae F3047]
 gi|327471082|gb|EGF16537.1| modification methylase HaeII [Haemophilus aegyptius ATCC 11116]
          Length = 318

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKL 57
           +   DFG+PQ+RER+YI+ FL   + F+FP P+G    L +ILE    + +   +S++L
Sbjct: 144 LNTLDFGLPQKRERIYIVGFL-DKLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL 201


>gi|12229852|sp|O30868|MTH2_HAEAE RecName: Full=Modification methylase HaeII; Short=M.HaeII; AltName:
           Full=Cytosine-specific methyltransferase HaeII
 gi|2425087|gb|AAB70829.1| HaeII methylase [Haemophilus aegyptius ATCC 11116]
          Length = 318

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKL 57
           +   DFG+PQ+RER+YI+ FL   + F+FP P+G    L +ILE    + +   +S++L
Sbjct: 144 LNTLDFGLPQKRERIYIVGFL-DKLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL 201


>gi|297379680|gb|ADI34567.1| DNA-cytosine methyltransferase [Helicobacter pylori v225d]
          Length = 265

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 59  LNALDYGVPQIRERVILVGALKSFKQKFHFPKPIKTHFSLKDALGDLPPIQSGENGDALG 118

Query: 60  GHQK 63
             + 
Sbjct: 119 YLKN 122


>gi|160934346|ref|ZP_02081733.1| hypothetical protein CLOLEP_03217 [Clostridium leptum DSM 753]
 gi|156867019|gb|EDO60391.1| hypothetical protein CLOLEP_03217 [Clostridium leptum DSM 753]
          Length = 433

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDI-LEEHIDDKSTISNK 56
           + A D+GV Q+RERL  I   N     ++F FP P   KP L DI L+    + S  S+ 
Sbjct: 251 LNAWDYGVAQKRERLITIGIRNDLVQKIKFDFPAPHKYKPVLRDILLDCPQSEGSQYSDH 310


>gi|68250112|ref|YP_249224.1| modification methylase HaeII [Haemophilus influenzae 86-028NP]
 gi|68058311|gb|AAX88564.1| modification methylase HaeII [Haemophilus influenzae 86-028NP]
          Length = 318

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKL 57
           +   DFG+PQ+RER+YI+ FL   + F+FP P+G    L +ILE    + +   +S++L
Sbjct: 144 LNTLDFGLPQKRERIYIVGFL-DKLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL 201


>gi|317057160|ref|YP_004105627.1| XRE family transcriptional regulator [Ruminococcus albus 7]
 gi|315449429|gb|ADU22993.1| transcriptional regulator, XRE family [Ruminococcus albus 7]
          Length = 407

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 38/100 (38%), Gaps = 15/100 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A D+GV Q+RERL  I   N     + F FPTP   KP L D+L +    + T  ++ 
Sbjct: 224 LNAWDYGVAQKRERLITIGIRNNLTDKISFSFPTPHEYKPVLRDVLLDCPKSEGTPYSE- 282

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97
                  K          GY            ++  Y K 
Sbjct: 283 ------YKRKIFELVPPGGYWRDIPED-----IAKEYMKS 311


>gi|227486883|ref|ZP_03917199.1| DNA restriction-modification system, DNA methylase [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227541955|ref|ZP_03972004.1| DNA restriction-modification system DNA methylase [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227092957|gb|EEI28269.1| DNA restriction-modification system, DNA methylase [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227182398|gb|EEI63370.1| DNA restriction-modification system DNA methylase [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 332

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +++ D+GVPQ R R  ++         F+FP P+  +  +G+ L   +++K      LW 
Sbjct: 150 IQSADYGVPQLRPRFILVALRKEYSPYFEFPEPMPHRITVGEALHGLMEEKGWPGADLWA 209


>gi|331084584|ref|ZP_08333682.1| hypothetical protein HMPREF0992_02606 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330400654|gb|EGG80261.1| hypothetical protein HMPREF0992_02606 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 324

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 43/106 (40%), Gaps = 14/106 (13%)

Query: 1   MKACDFG-VPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILE--EHIDDKSTISN 55
           + A  +G V Q RER+YI+ F +     +F +P  + +   + DI++    +D+K   + 
Sbjct: 146 LNAMTYGNVAQNRERIYIVAFRDEEDYEKFHWPLSIPLTNSVKDIIDFENKVDEKYYYTP 205

Query: 56  KLWEGHQKRKENNKIAGKG------FGYGLFF---ENSATTNTLSA 92
             ++G         +          + +   +     S    TL+A
Sbjct: 206 GKYKGEIYDALVEAMKNDDPKNPAIYQWRRKYVRKNQSGVVPTLTA 251


>gi|238751088|ref|ZP_04612584.1| Modification methylase FnuDI [Yersinia rohdei ATCC 43380]
 gi|238710778|gb|EEQ03000.1| Modification methylase FnuDI [Yersinia rohdei ATCC 43380]
          Length = 362

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 36/99 (36%), Gaps = 9/99 (9%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG--IKPRLGDILEEHIDDKSTISNKLW 58
            A ++GVPQ R+RL+II       + F+FP      +  +   +        +     LW
Sbjct: 153 NAKEYGVPQSRKRLFIIGVRKDLDQYFEFPLATHGKLSQKNPHLKPYASHGDAICDLPLW 212

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN-----SATTNTLSA 92
              +  +  +   G  F +     N      +   T+ A
Sbjct: 213 PEGEFYERPHDPEG-HFSWYFMSRNRKAKWDSPAYTVVA 250


>gi|172038109|ref|YP_001804610.1| putative modification methylase [Cyanothece sp. ATCC 51142]
 gi|171699563|gb|ACB52544.1| putative modification methylase [Cyanothece sp. ATCC 51142]
          Length = 344

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW-E 59
           + A +FG+PQ+RER++I+ F    + F +  P  +   L +I+E+ + +    S ++   
Sbjct: 167 LNALNFGLPQKRERVFIVGFR-DPLAFIWKQPNILMKPLSEIIEKSVSEFYYASEQIQRN 225

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSAT 86
              K + N++     +        SA 
Sbjct: 226 RLAKYQGNHQHKITIWHENKAGHISAY 252


>gi|303231468|ref|ZP_07318199.1| modification methylase HhaI family protein [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513905|gb|EFL55916.1| modification methylase HhaI family protein [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 411

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEH--IDDKSTISN 55
           +   D+G +PQ RER+YI+ FL       F FP  + +   L DI++ +  +D+    + 
Sbjct: 154 LNGKDYGNIPQNRERIYIVGFLEKSAYDAFIFPDEIPLTTSLSDIIDFNGKMDEYYYYTE 213

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
              + + + K   K +   + +   +     +    TL+A
Sbjct: 214 DKNKFYDELKSAIKSSETIYQWRRQYVRENKTGVVPTLTA 253


>gi|317054725|ref|YP_004103193.1| cytosine specific DNA methyltransferase [Paracoccus aminophilus]
 gi|294869157|gb|ADF47149.1| cytosine specific DNA methyltransferase [Paracoccus aminophilus]
          Length = 363

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 40/95 (42%), Gaps = 6/95 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE- 59
           + A D+GVPQ R R ++I   +   ++ FP P      + D+   ++     + + L + 
Sbjct: 149 LNAADYGVPQARPRFFLIGTRDGE-KYNFPDPSHAPTSVNDLFLSNMPRHLNVWDALSDL 207

Query: 60  -GHQKRKENNKIAGK---GFGYGLFFENSATTNTL 90
              ++ + + ++         Y L    + +  TL
Sbjct: 208 PYIEQGEGSEEMKNSTQAHNAYQLERRGNRSAGTL 242


>gi|145629543|ref|ZP_01785341.1| modification methylase HaeII [Haemophilus influenzae 22.1-21]
 gi|144978386|gb|EDJ88150.1| modification methylase HaeII [Haemophilus influenzae 22.1-21]
          Length = 219

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKL 57
           +   DFG+PQ+RER+YI+ FL   + F+FP P+G    L +ILE    + +   +S++L
Sbjct: 45  LNTLDFGLPQKRERIYIVGFL-DKLHFEFPKPIGKYEELSNILESDDVVPNNYFLSDEL 102


>gi|317008995|gb|ADU79575.1| DNA-cytosine methyltransferase [Helicobacter pylori India7]
          Length = 309

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   ++  +PQ RER+YII FL+ +    F FP  +     + D+LE  + ++     K 
Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDENHYKRFHFPLKINHTQSIKDLLEIKVGEEFYY--KQ 199

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
           +  ++  K+        + +   +     +    TL+A
Sbjct: 200 YRFYEALKKEITKRDTCYQWRRHYVRENKNNLCPTLTA 237


>gi|262200549|ref|YP_003271757.1| DNA-cytosine methyltransferase [Gordonia bronchialis DSM 43247]
 gi|262083896|gb|ACY19864.1| DNA-cytosine methyltransferase [Gordonia bronchialis DSM 43247]
          Length = 399

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 34/89 (38%), Gaps = 12/89 (13%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+GVPQ+R R++ + F +    E+ FP+P          L    D+ S      WE 
Sbjct: 179 NAADYGVPQQRWRVFFVGFRSDVDAEWSFPSPTHSAA----ALRAAQDNGSY-----WEW 229

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNT 89
           H+  K+      +     L         T
Sbjct: 230 HKVAKKYRTPTVR--TAALVDGPLKPWRT 256


>gi|227540760|ref|ZP_03970809.1| DNA-cytosine methyltransferase [Corynebacterium glucuronolyticum
           ATCC 51866]
 gi|227183472|gb|EEI64444.1| DNA-cytosine methyltransferase [Corynebacterium glucuronolyticum
           ATCC 51866]
          Length = 387

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGI 35
            A D+GVPQ R R++I+ F +  +  + FP P   
Sbjct: 181 DAADYGVPQHRHRVFIVGFRSDINAGWNFPQPTHS 215


>gi|331091171|ref|ZP_08340013.1| hypothetical protein HMPREF9477_00656 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330405393|gb|EGG84929.1| hypothetical protein HMPREF9477_00656 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 375

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 26/104 (25%), Positives = 43/104 (41%), Gaps = 13/104 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS--------VEFKFPTPLG--IKPRLGDILEEHIDDKS 51
            + +FG+PQ R R YI+ F            +E   P      +   L ++LE H + K 
Sbjct: 165 NSRNFGIPQNRPRTYIMAFNRQRYGAAALAGIENCLPIENDWYLYEDLNELLEFHAEAKY 224

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFE---NSATTNTLSA 92
            +++   +   + +E     G GFGY +  E        NT+ A
Sbjct: 225 YMASGYLDTLIRHREREHGKGNGFGYRIVNEPGIEHPVANTIMA 268


>gi|119511510|ref|ZP_01630619.1| type II DNA modification enzyme (methyltransferase) [Nodularia
           spumigena CCY9414]
 gi|119463821|gb|EAW44749.1| type II DNA modification enzyme (methyltransferase) [Nodularia
           spumigena CCY9414]
          Length = 371

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 17/99 (17%), Positives = 35/99 (35%), Gaps = 14/99 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG--IKPRLGDIL----EEHIDDKSTIS 54
           + A  +GVPQ+RERL+ +        +++P           G+ L         +   ++
Sbjct: 162 LNAAHYGVPQKRERLFCVAHKG---SWQWPEKTHFYSPYTAGEALGKSAYLAPPNSKILT 218

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
             + E  +K +  +K                   T++ R
Sbjct: 219 PSMDEYIKKYEIASKCINP-----RDINLDTPARTVTCR 252


>gi|254410261|ref|ZP_05024041.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196183297|gb|EDX78281.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 384

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 28/78 (35%), Gaps = 2/78 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + + DFGVPQ RER+ I+   N    F          +L + L    + +    +     
Sbjct: 144 LNSKDFGVPQNRERIIIVATKNKQFNFNKLKKNKCVAKLKNFLFNSENFEYLEPDSY--T 201

Query: 61  HQKRKENNKIAGKGFGYG 78
              + +  +      GY 
Sbjct: 202 LIDKPKQQQSGLIFVGYR 219


>gi|269119458|ref|YP_003307635.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
 gi|268613336|gb|ACZ07704.1| DNA-cytosine methyltransferase [Sebaldella termitidis ATCC 33386]
          Length = 383

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+ +PQRR+R++ +     + ++ FP P+ +K RL D+LE+ + +K  + +   + 
Sbjct: 148 LNAKDYRIPQRRKRVFCVSIF-GNEKYVFPKPVELKLRLRDMLEKEVPEKYYLKD--IDN 204

Query: 61  HQKRKENNKIAGKGFGYGLFF 81
           ++     NK  G      +  
Sbjct: 205 NKFHVNMNKKQGYFISGEVAN 225


>gi|148555377|ref|YP_001262959.1| DNA-cytosine methyltransferase [Sphingomonas wittichii RW1]
 gi|148500567|gb|ABQ68821.1| DNA-cytosine methyltransferase [Sphingomonas wittichii RW1]
          Length = 412

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37
           + A  FGVPQ RER++I+        FKFP P     
Sbjct: 169 LNAASFGVPQLRERVFIVASREGK-NFKFPQPTHGPK 204


>gi|210610944|ref|ZP_03288669.1| hypothetical protein CLONEX_00859 [Clostridium nexile DSM 1787]
 gi|210152244|gb|EEA83251.1| hypothetical protein CLONEX_00859 [Clostridium nexile DSM 1787]
          Length = 278

 Score = 60.4 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHID 48
           + A D+GVPQ+RERL  I   N  V    F FP     KP L D+L +  D
Sbjct: 95  LNAWDYGVPQKRERLITIGIRNDLVNRIKFHFPEAHDYKPVLRDVLLDCPD 145


>gi|330998524|ref|ZP_08322345.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT
           11841]
 gi|329568255|gb|EGG50071.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT
           11841]
          Length = 379

 Score = 60.4 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 4/57 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+GVPQRRER+ I+   N  +V + FP           +L +     S     
Sbjct: 171 LNAADYGVPQRRERVVIVGIRNDLNVAWNFPEGTH---SQEALLWDKYVTGSYWERH 224


>gi|308061704|gb|ADO03592.1| DNA-cytosine methyltransferase [Helicobacter pylori Cuz20]
 gi|308063214|gb|ADO05101.1| DNA-cytosine methyltransferase [Helicobacter pylori Sat464]
 gi|317180749|dbj|BAJ58535.1| DNA-cytosine methyltransferase [Helicobacter pylori F32]
          Length = 309

 Score = 60.4 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   ++  +PQ RER+YII FL+ +    F FP  +     + D+LE  + ++     K 
Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYY--KQ 199

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
           +  ++  K+        + +   +     +    TL+A
Sbjct: 200 YRFYETLKKEITKRDTCYQWRRHYVRENKNNLCPTLTA 237


>gi|228473386|ref|ZP_04058140.1| Cytosine-specific methyltransferase HphIA [Capnocytophaga
           gingivalis ATCC 33624]
 gi|228275288|gb|EEK14086.1| Cytosine-specific methyltransferase HphIA [Capnocytophaga
           gingivalis ATCC 33624]
          Length = 358

 Score = 60.4 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           + A D+GVPQ R R +++   +  +EF+FP P   K  + + + +  D
Sbjct: 149 LWASDYGVPQNRNRFFMVGNRHG-IEFEFPEPFEKKITVEEAIGDLPD 195


>gi|308229532|gb|ADO24181.1| M.ApaI [Acetobacter pasteurianus subsp. pasteurianus]
          Length = 349

 Score = 60.4 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 35/102 (34%), Gaps = 10/102 (9%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62
           A D+GVPQ+R RL I+     +  F FP P          +            +  +   
Sbjct: 145 AADYGVPQKRRRLIIVGMKKGT--FWFPKPTHGPDTNIPHVASGRVIDKACRLEPPDCPV 202

Query: 63  KRKENNKIAGKGFGYGLFF------ENSATTNTL--SARYYK 96
              +        +   ++       + SA  +TL  SA  YK
Sbjct: 203 IYAKCPDPRRSPYAGHVYNGGGRPIDLSAPCHTLLASAGGYK 244


>gi|225862883|ref|YP_002748261.1| DNA (cytosine-5-)-methyltransferase [Bacillus cereus 03BB102]
 gi|225787129|gb|ACO27346.1| DNA (cytosine-5-)-methyltransferase [Bacillus cereus 03BB102]
          Length = 367

 Score = 60.4 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 37/84 (44%), Gaps = 3/84 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE-HIDDKSTISNKLWE 59
           + A D+GVPQ R+R++ +  L+    F++P     K    + L +  + DK    N+++ 
Sbjct: 152 LNAADYGVPQNRQRVFFVGVLDGH--FEYPELDENKVSTLEALSDLPVLDKIEQYNEVYN 209

Query: 60  GHQKRKENNKIAGKGFGYGLFFEN 83
                + + +   +     +   N
Sbjct: 210 YSCDPQNSYQSIMRKNSNEILNHN 233


>gi|325270473|ref|ZP_08137075.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
 gi|324987196|gb|EGC19177.1| DNA (cytosine-5-)-methyltransferase [Prevotella multiformis DSM
           16608]
          Length = 365

 Score = 60.4 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 46/97 (47%), Gaps = 3/97 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +KA ++G+PQRRER+ I+   +     +++P P+  +     +    + D+  I++  + 
Sbjct: 158 LKAVEYGIPQRRERVIIVGIRDDLTFNYEYPAPVCTEAEATPL--SAVIDELAITDSKYY 215

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
             ++  +  K A      GL+   S    T++A   K
Sbjct: 216 FSERAVQGVKKAKNNMKRGLWQSLSQPCLTITAHLAK 252


>gi|317181696|dbj|BAJ59480.1| DNA-cytosine methyltransferase [Helicobacter pylori F57]
          Length = 309

 Score = 60.4 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   ++  +PQ RER+YII FL+ +    F FP  +     + D+LE  + ++     K 
Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYY--KQ 199

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
           +  ++  K+        + +   +     +    TL+A
Sbjct: 200 YRFYETLKKEITKRDTCYQWRRHYVRENKNNLCPTLTA 237


>gi|188527161|ref|YP_001909848.1| DNA-cytosine methyltransferase [Helicobacter pylori Shi470]
 gi|188143401|gb|ACD47818.1| DNA-cytosine methyltransferase [Helicobacter pylori Shi470]
          Length = 309

 Score = 60.4 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 43/98 (43%), Gaps = 8/98 (8%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   ++  +PQ RER+YII FL+ +    F FP  +     + D+LE  + ++     K 
Sbjct: 142 LNTYEYSTIPQNRERIYIIGFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYY--KQ 199

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
           +  ++  K+        + +   +     +    TL+A
Sbjct: 200 YRFYETLKKEITKRDTCYQWRRHYVRENKNNLCPTLTA 237


>gi|317013900|gb|ADU81336.1| type II DNA modification (methyltransferase) [Helicobacter pylori
           Gambia94/24]
          Length = 351

 Score = 60.4 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFYFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|254467362|ref|ZP_05080773.1| DNA-cytosine methyltransferase [Rhodobacterales bacterium Y4I]
 gi|206688270|gb|EDZ48752.1| DNA-cytosine methyltransferase [Rhodobacterales bacterium Y4I]
          Length = 319

 Score = 60.4 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-LGIKPRLGDILEEHIDDK 50
           + A DFGVPQ R R+ I+      S +F +P P     P +G  L + + ++
Sbjct: 145 LNASDFGVPQLRPRVAIVALRKEFSGQFNWPEPLPHNPPTVGATLIDLMKER 196


>gi|10955252|ref|NP_052188.1| DNA-methyltransferase [Escherichia coli]
 gi|1237268|gb|AAC37145.1| eco29kIM [Escherichia coli]
 gi|2660513|emb|CAA04944.1| DNA-methyltransferase [Escherichia coli]
          Length = 382

 Score = 60.4 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 31/78 (39%), Gaps = 4/78 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ I+   +  + ++ FP+          +L E             +
Sbjct: 170 INAADYGVPQIRERVIIVGVRSDLNKKWSFPSVTH---TQEKLLWEQHVTGDYWRKHNID 226

Query: 60  GHQKRKENNKIAGKGFGY 77
               +  + ++  +   +
Sbjct: 227 AVIDKGISERLMKRFGIF 244


>gi|19718332|ref|NP_604405.1| plasmid encoded methyltransferase Pem [Salmonella enteritidis]
 gi|19526586|gb|AAL87019.1| plasmid encoded methyltransferase Pem [Salmonella enterica subsp.
           enterica serovar Enteritidis]
          Length = 382

 Score = 60.4 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 31/78 (39%), Gaps = 4/78 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ I+   +  + ++ FP+          +L E             +
Sbjct: 170 INAADYGVPQIRERVIIVGVRSDLNKKWSFPSVTH---TQEKLLWEQHVTGDYWRKHNID 226

Query: 60  GHQKRKENNKIAGKGFGY 77
               +  + ++  +   +
Sbjct: 227 AVIDKGISERLMKRFGIF 244


>gi|168185144|ref|ZP_02619808.1| modification methylase SinI [Clostridium botulinum Bf]
 gi|182671812|gb|EDT83773.1| modification methylase SinI [Clostridium botulinum Bf]
          Length = 363

 Score = 60.0 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK 36
           + A D+G+ Q+RER++I+      + +F+FP     K
Sbjct: 172 INAADYGIAQKRERVFIVGIRKDLNKKFEFPEKTHNK 208


>gi|159027646|emb|CAO89510.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 728

 Score = 60.0 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 24/57 (42%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFGVPQ RER+ II   N    F         P+L D L    + +     + 
Sbjct: 146 LNAKDFGVPQNRERIIIIATQNKKFNFNSLKYTSPIPKLRDFLSPQGNFEYLDKKEY 202


>gi|328766176|gb|EGF76234.1| hypothetical protein BATDEDRAFT_28720 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 373

 Score = 60.0 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34
            A D+GVPQ+RER++II   N    E+ FP P  
Sbjct: 182 NARDYGVPQQRERVFIIGIRNDIEFEYDFPAPTH 215


>gi|163738696|ref|ZP_02146110.1| DNA-cytosine methyltransferase [Phaeobacter gallaeciensis BS107]
 gi|163741592|ref|ZP_02148983.1| DNA modification methylase M.NGOI [Phaeobacter gallaeciensis 2.10]
 gi|161385326|gb|EDQ09704.1| DNA modification methylase M.NGOI [Phaeobacter gallaeciensis 2.10]
 gi|161388024|gb|EDQ12379.1| DNA-cytosine methyltransferase [Phaeobacter gallaeciensis BS107]
          Length = 324

 Score = 60.0 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R R+ I+      S +F +P P       +G+ L + + ++     + W
Sbjct: 145 LNASDYGVPQLRPRVAIVALRKEFSGQFNWPDPLPHNPRTVGETLLDLMKERGWRGAEDW 204

Query: 59  E 59
            
Sbjct: 205 A 205


>gi|258593909|emb|CAA33765.2| DNA(cytosine-5)methyltransferase [Lysinibacillus sphaericus]
          Length = 396

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34
           + A D+GVPQ RER+ I+   N     +++P    
Sbjct: 198 LNARDYGVPQIRERVIIVGVRNDIDFNYEYPEITH 232


>gi|312902257|ref|ZP_07761465.1| helix-turn-helix protein [Enterococcus faecalis TX0635]
 gi|283466064|emb|CBG92839.1| hypothetical protein [Enterococcus casseliflavus]
 gi|310634316|gb|EFQ17599.1| helix-turn-helix protein [Enterococcus faecalis TX0635]
          Length = 470

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEEHIDDK 50
           + A ++GV Q+RER+ II   N   E     FKFP     +P L D+L++    +
Sbjct: 286 LNAWNYGVAQKRERIVIIGIRNDLFEQQQYSFKFPKEYTYQPVLRDVLKDVPKSE 340


>gi|261839203|gb|ACX98968.1| DNA-cytosine methyltransferase [Helicobacter pylori 52]
          Length = 309

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 42/96 (43%), Gaps = 4/96 (4%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISN-K 56
           +   ++  +PQ RER+YI+ FL+ +    F FP  +     + D+LE  + ++      +
Sbjct: 142 LNTYEYSTIPQNRERIYIVGFLDKNHYKRFHFPLKVNHTQSIKDLLEIKVGEEFYYKQYR 201

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            +E  +K         +   + +    +    TL+A
Sbjct: 202 FYETLKKEITKTDTCYQWRRHYVRENKNNLCPTLTA 237


>gi|153870185|ref|ZP_01999636.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS]
 gi|152073352|gb|EDN70367.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS]
          Length = 235

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + + DFG+PQ+RER  I+ F   ++ F FP PLGIKP L  IL     +K +   K    
Sbjct: 144 LNSLDFGIPQKRERTIIVGF-QENIAFSFPKPLGIKPDLTKIL-----EKDSEVEKNILL 197

Query: 61  HQKRKENNKIAGK 73
               K+       
Sbjct: 198 LMSLKKRECKKLN 210


>gi|257867246|ref|ZP_05646899.1| DNA methyltransferase [Enterococcus casseliflavus EC30]
 gi|257873580|ref|ZP_05653233.1| DNA methyltransferase [Enterococcus casseliflavus EC10]
 gi|257801302|gb|EEV30232.1| DNA methyltransferase [Enterococcus casseliflavus EC30]
 gi|257807744|gb|EEV36566.1| DNA methyltransferase [Enterococcus casseliflavus EC10]
          Length = 470

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEEHIDDK 50
           + A ++GV Q+RER+ II   N   E     FKFP     +P L D+L++    +
Sbjct: 286 LNAWNYGVAQKRERIVIIGIRNDLFEQQQYSFKFPKEYTYQPVLRDVLKDVPKSE 340


>gi|289167263|ref|YP_003445530.1| type II DNA modification enzyme (methyltransferase
           cytosine-specific) [Streptococcus mitis B6]
 gi|288906828|emb|CBJ21662.1| type II DNA modification enzyme (methyltransferase
           cytosine-specific) [Streptococcus mitis B6]
          Length = 387

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTI--SNKL 57
           + A D+GVPQ RER+++I   N  ++EF++  P          L + I D  ++  +++ 
Sbjct: 169 LNAKDYGVPQNRERVFLIGVRNDLNIEFEWSFPEKCTSENPFNLRDAIGDLPSLGNNDRA 228

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
            +  +  + + +I  +G    LF   S
Sbjct: 229 DQYVEDPQTDYQILMRGNQDQLFNHVS 255


>gi|332970702|gb|EGK09683.1| DNA (cytosine-5-)-methyltransferase [Kingella kingae ATCC 23330]
          Length = 197

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDD 49
           + A +FGVPQ+RER++I+ F +     +F+FP  L  K  L   L+E  + 
Sbjct: 144 LNASEFGVPQKRERVFIVGFRDDEDFFKFQFPETLPEKIPLKYALDEQANH 194


>gi|307294815|ref|ZP_07574657.1| DNA-cytosine methyltransferase [Sphingobium chlorophenolicum L-1]
 gi|306879289|gb|EFN10507.1| DNA-cytosine methyltransferase [Sphingobium chlorophenolicum L-1]
          Length = 394

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 29/83 (34%), Gaps = 7/83 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A ++GVPQRRER+    F     +E+ FP P      L  +L +              
Sbjct: 187 LNAANYGVPQRRERVVFAGFRADLGIEWSFPEPTH---SLDALLWDQARSADYWDRHKVA 243

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
              +R           G  L  +
Sbjct: 244 ---RRDRVIDARLHARGRALVEK 263


>gi|298286911|sp|P13906|MTB1_BACSH RecName: Full=Modification methylase BspRI; Short=M.BspRI; AltName:
           Full=Cytosine-specific methyltransferase BspRI
 gi|258593908|emb|CAA33764.2| DNA(cytosine-5)methyltransferase [Lysinibacillus sphaericus]
          Length = 424

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34
           + A D+GVPQ RER+ I+   N     +++P    
Sbjct: 226 LNARDYGVPQIRERVIIVGVRNDIDFNYEYPEITH 260


>gi|332530473|ref|ZP_08406414.1| DNA cytosine methyltransferase M.NgoMIII [Hylemonella gracilis ATCC
           19624]
 gi|332040042|gb|EGI76427.1| DNA cytosine methyltransferase M.NgoMIII [Hylemonella gracilis ATCC
           19624]
          Length = 413

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGI 35
            A ++GVPQRRER++I+ F     +++ FP     
Sbjct: 188 NAANYGVPQRRERVFIVGFRRDLPIQWSFPRETHS 222


>gi|632681|gb|AAB31678.1| DNA (cytosine-5)-methyltransferase, m5C-MTase {BspRI
           restriction-modification system} [Escherichia coli,
           Peptide, 424 aa]
          Length = 424

 Score = 60.0 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34
           + A D+GVPQ RER+ I+   N     +++P    
Sbjct: 226 LNARDYGVPQIRERVIIVGVRNDIDFNYEYPEITH 260


>gi|15611502|ref|NP_223153.1| type II DNA modification (methyltransferase [Helicobacter pylori
           J99]
 gi|4154963|gb|AAD06007.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter
           pylori J99]
          Length = 351

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F FP P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQVRERVILVGALKSFKQKFYFPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|331086924|ref|ZP_08336001.1| hypothetical protein HMPREF0987_02304 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330410090|gb|EGG89525.1| hypothetical protein HMPREF0987_02304 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 438

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 37/95 (38%), Gaps = 2/95 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK--LW 58
           + A D+GVPQRR R+  I +       ++P P         +L+   D  +    +  + 
Sbjct: 181 LNAADYGVPQRRNRIIFIGYRRGLTPPQYPEPTVKPNEQLSLLDAIGDLITDSRKRHAVN 240

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
             H K ++++         G    +    NT  +R
Sbjct: 241 PTHTKYQQDSINGRTPGVDGKPIPSKKLLNTELSR 275


>gi|330718183|ref|ZP_08312783.1| cytosine-specific methyltransferase [Leuconostoc fallax KCTC 3537]
          Length = 414

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/110 (20%), Positives = 44/110 (40%), Gaps = 18/110 (16%)

Query: 1   MKACDFG-VPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHI---------- 47
           + A ++G +PQ RER+Y++ F +      F FP  + +  +L DI++             
Sbjct: 152 LNAKEYGNIPQNRERIYVVGFKDKKAFDNFSFPEKIDLTTKLSDIIDFDAKIGEITKFGD 211

Query: 48  --DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFF---ENSATTNTLSA 92
             +D+          + +  E  K +   + +   +     S    TL+A
Sbjct: 212 FLEDRFFYKEDKQTFYPQLVEAMKSSETVYQWRRQYVRENKSGVIPTLTA 261


>gi|291544225|emb|CBL17334.1| DNA-methyltransferase (dcm) [Ruminococcus sp. 18P13]
          Length = 407

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 37/100 (37%), Gaps = 15/100 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A ++GV Q+RERL  I   N       F FPTP   KP L D+L +    + T  ++ 
Sbjct: 224 LNAWNYGVAQKRERLITIGIRNDLTNQIKFTFPTPHEYKPVLRDVLLDCPKSEGTPYSE- 282

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97
                  K          GY            ++  Y K 
Sbjct: 283 ------YKRKIFELVPPGGYWRDIPED-----IAKEYMKS 311


>gi|218441855|ref|YP_002380184.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424]
 gi|218174583|gb|ACK73316.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424]
          Length = 342

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 35/97 (36%), Gaps = 12/97 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL----EEHIDDKSTISNK 56
           + A  +  PQ RER++II       +F FP  L      G+ L             ++  
Sbjct: 167 LNASWYETPQNRERVFIIGHRG---KFTFPCRLSNSITAGEALGDLAISIPPGAKFLTES 223

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           + +   K ++ +K       Y         + T++ R
Sbjct: 224 MNQYVAKYEKASKCKQPRDLY-----LDKPSRTVTCR 255


>gi|119716511|ref|YP_923476.1| DNA-cytosine methyltransferase [Nocardioides sp. JS614]
 gi|119537172|gb|ABL81789.1| DNA-cytosine methyltransferase [Nocardioides sp. JS614]
          Length = 399

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGI 35
            A D+GVPQ R R+ ++ F     + + FP P   
Sbjct: 203 NAADYGVPQNRWRVVLVGFRKDLGISWSFPDPTHS 237


>gi|331270912|ref|YP_004385623.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
 gi|329127304|gb|AEB77248.1| putative cytosine-specific DNA methylotransferase [Clostridium
           botulinum BKT015925]
          Length = 349

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 2/84 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A +FG+PQ RER+++I       + + KF        RL DIL+  +D++  I N   
Sbjct: 149 LNAKNFGIPQNRERIFVIGIREYIDNKQMKFNEGKDYGYRLKDILQNQVDERFYIDNDKC 208

Query: 59  EGHQKRKENNKIAGKGFGYGLFFE 82
               ++ ++     K      + E
Sbjct: 209 SILLEKLDDEVTKIKQATKKGYDE 232


>gi|322511205|gb|ADX06517.1| putative C-5 cytosine specific DNA methyltransferase [Organic Lake
           phycodnavirus]
          Length = 384

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 37/99 (37%), Gaps = 9/99 (9%)

Query: 1   MKACDF-GVPQRRERLYIIDFLN----PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           +   D  G+P  RER+YI+   +          FP       ++ + LE  I +K   ++
Sbjct: 214 LNTADITGIPHHRERIYIVCIKSKNVFDKFNLDFPKINKK--KISEFLEHDIPEKYYYTD 271

Query: 56  K--LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
           K   WE  ++         +     +    S    TL+A
Sbjct: 272 KSSTWEVVKESVVKKDTIYQYRRVYVRENKSGECPTLTA 310


>gi|294678239|ref|YP_003578854.1| cytosine-specific DNA-methyltransferase [Rhodobacter capsulatus SB
           1003]
 gi|294477059|gb|ADE86447.1| site-specific DNA-methyltransferase (cytosine-specific)
           [Rhodobacter capsulatus SB 1003]
          Length = 451

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 25/59 (42%), Gaps = 2/59 (3%)

Query: 6   FGVPQRRERLYIIDFLNPSVEFKFPTPLGI--KPRLGDILEEHIDDKSTISNKLWEGHQ 62
           FGVPQ RER  I+        F +P P     +  +  +L+E   +   +  +  +  +
Sbjct: 149 FGVPQVRERAIIVGSRTGLRHFSWPEPTHQLDQVTIKSVLDEKPKEARPLGPRFIQYLE 207


>gi|209901299|ref|YP_002290938.1| putative DNA methylase [Clostridium phage phiCD27]
 gi|199612180|gb|ACH91353.1| putative DNA methylase [Clostridium phage phiCD27]
          Length = 276

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 35/94 (37%), Gaps = 3/94 (3%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + +FGVPQ RER++I+  F   S    FP     +  L  +                 
Sbjct: 150 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSRKNLEQLNNPTHSTNRIYDAVGIA 209

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
              + +     A  G  +    +NS    T++AR
Sbjct: 210 RCIRSQAGGGGAKTGLYFIDLNKNSKV--TINAR 241


>gi|86137701|ref|ZP_01056277.1| DNA modification methylase M.NGOI [Roseobacter sp. MED193]
 gi|85825293|gb|EAQ45492.1| DNA modification methylase M.NGOI [Roseobacter sp. MED193]
          Length = 319

 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDIL 43
           + A DFGVPQ R R+ I+       + F +P P     P +G+ L
Sbjct: 145 LNASDFGVPQLRPRVAIVALRKEYSDQFNWPDPLPHNPPTVGETL 189


>gi|967022|emb|CAA62381.1| DNA (cytosine-5-)-methyltransferase [Geobacillus
           stearothermophilus]
 gi|1262297|gb|AAA96793.1| m5C-multispecific methyltransferase [Geobacillus
           stearothermophilus]
 gi|1589631|prf||2211376A cytosine-C5-DNA methyltransferase
          Length = 534

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRL---GDILEEHIDDKSTISNK 56
           + A D+GV Q+RER++I+         F+FP P     R     D++ +  +   T   +
Sbjct: 155 INAWDYGVAQKRERVFIVGIRADLGFAFEFPEPRPGDYRTQVLRDVIGDLPEPVDTCGRR 214

Query: 57  LWE 59
           + +
Sbjct: 215 VKK 217


>gi|320326214|gb|EFW82269.1| cytosine-specific DNA-methyltransferase [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 448

 Score = 59.6 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 33/62 (53%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   +FG+PQ RER+YI+  L P  +F +P        +  +L++H  D   +S ++ + 
Sbjct: 149 LSPHNFGIPQIRERVYIVGSLIPLEDFSWPKKTDAPTSIDTVLDDHPADAKKLSTQVTDC 208

Query: 61  HQ 62
            +
Sbjct: 209 LE 210


>gi|261364680|ref|ZP_05977563.1| modification methylase Eco47II [Neisseria mucosa ATCC 25996]
 gi|288566964|gb|EFC88524.1| modification methylase Eco47II [Neisseria mucosa ATCC 25996]
          Length = 419

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 36/86 (41%), Gaps = 3/86 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +KA  + VPQ+RERL++I         VEF +P+P      L D L+     K  +    
Sbjct: 220 LKAVFYKVPQKRERLFLIGIRKDLADKVEFHWPSPYHRILTLQDALKAGELYKDDVPQSP 279

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN 83
            + + +RK          GY     +
Sbjct: 280 GQKYPQRKAEIMAQVPAGGYWKDLPD 305


>gi|288928693|ref|ZP_06422539.1| modification methylase NgoBI (Cytosine-specific methyltransferase
           NgoBI) [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329677|gb|EFC68262.1| modification methylase NgoBI (Cytosine-specific methyltransferase
           NgoBI) [Prevotella sp. oral taxon 317 str. F0108]
          Length = 309

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLN----PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A DFG+PQ+RER+ I+ F +     + +F F         + +  E+ ID K   S  
Sbjct: 142 LNAMDFGLPQKRERVIIVGFRDKMAYENFDFTFKKKPFNLATILEE-EKDIDPKLYASKT 200

Query: 57  LWEGHQ 62
           + E  +
Sbjct: 201 IREKRK 206


>gi|325955715|ref|YP_004293189.1| modification methylase BsuRI [Lactobacillus acidophilus 30SC]
 gi|325334695|gb|ADZ08248.1| modification methylase BsuRI [Lactobacillus acidophilus 30SC]
          Length = 406

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 39/99 (39%), Gaps = 15/99 (15%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE-FKF--PTPLGIKPRLGDI--LEEHIDDKSTISNK 56
            A D+GVPQ RER++++   N   + F++  P P            L+E I D       
Sbjct: 225 NAKDYGVPQSRERVFLVGVRNDIADKFQYTVPEPTNGPDTDKPYITLKEAISDLPEHPAD 284

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTL--SAR 93
            +EG       ++   K +           + T+  SAR
Sbjct: 285 YFEGTYSSIYMSRNRKKSW--------DDVSFTIQASAR 315


>gi|108562472|ref|YP_626788.1| cytosine specific DNA methyltransferase [Helicobacter pylori HPAG1]
 gi|107836245|gb|ABF84114.1| cytosine specific DNA methyltransferase [Helicobacter pylori HPAG1]
          Length = 355

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 29/89 (32%), Gaps = 2/89 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI--LEEHIDDKSTISNKLW 58
           + A D+GVPQ RER +I+     S +FK   P         I  L     ++    +   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFKLLEPSQSVNVQDAISDLAYLCSNEGAFESDYL 212

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATT 87
              Q   +          Y     N +  
Sbjct: 213 NHIQSSYQALMRKNSPKLYNHKATNHSQA 241


>gi|315604954|ref|ZP_07880010.1| modification methylase [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315313349|gb|EFU61410.1| modification methylase [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 322

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKLW 58
           + A DFGVPQ R R+  + F + +   F++P+P     P +G+ L + + ++       W
Sbjct: 147 LNASDFGVPQLRPRVIAVGFRHDTAPSFEYPSPFQNAAPTVGETLADLMAERGWEGASAW 206

Query: 59  EGHQKRKEN 67
                R   
Sbjct: 207 AAQANRIAP 215


>gi|258514794|ref|YP_003191016.1| DNA-cytosine methyltransferase [Desulfotomaculum acetoxidans DSM
           771]
 gi|257778499|gb|ACV62393.1| DNA-cytosine methyltransferase [Desulfotomaculum acetoxidans DSM
           771]
          Length = 402

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 9/67 (13%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+GVPQ R R+ I+ F N  +  + FP     +    D L      K  IS + WE 
Sbjct: 181 NAADYGVPQSRHRVIIVGFRNDLNANWSFPDATHSQ----DALRY---SKW-ISGEYWEE 232

Query: 61  HQKRKEN 67
           H+  K  
Sbjct: 233 HKIAKAK 239


>gi|260642764|ref|ZP_05417219.2| modification methylase NgoMIV [Bacteroides finegoldii DSM 17565]
 gi|260620609|gb|EEX43480.1| modification methylase NgoMIV [Bacteroides finegoldii DSM 17565]
          Length = 327

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKP 37
           + A D+GVPQ R R+ II       + F FP  +  K 
Sbjct: 144 LNASDYGVPQLRPRVIIIGIRRDLADVFMFPEKIPEKT 181


>gi|167920593|ref|ZP_02507684.1| cytosine-specific DNA methylase [Burkholderia pseudomallei BCC215]
          Length = 454

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 34/62 (54%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   +FG+PQ RER+YI+    P   F++P  +     +  IL+++ DD   +S ++ E 
Sbjct: 149 LSPHNFGIPQIRERVYIVGSTEPLTSFQWPEMIDATTSIETILDKNPDDARQLSAQVKEC 208

Query: 61  HQ 62
            +
Sbjct: 209 LE 210


>gi|126698504|ref|YP_001087401.1| putative DNA methylase [Clostridium difficile 630]
 gi|115249941|emb|CAJ67761.1| putative phage DNA modification methylase [Clostridium difficile]
          Length = 357

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 35/94 (37%), Gaps = 3/94 (3%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + +FGVPQ RER++I+  F   S    FP     +  L  +                 
Sbjct: 150 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSRKNLEQLNNPTHSTNRIYDAVGIA 209

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
              + +     A  G  +    +NS    T++AR
Sbjct: 210 RCIRSQAGGGGAKTGLYFIDLNKNSKV--TINAR 241


>gi|308185228|ref|YP_003929361.1| DNA-cytosine methyltransferase [Helicobacter pylori SJM180]
 gi|308061148|gb|ADO03044.1| DNA-cytosine methyltransferase [Helicobacter pylori SJM180]
          Length = 368

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 43/117 (36%), Gaps = 31/117 (26%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEH------------ 46
           + A ++G+PQ R RL+++ F        F FP+P  +   + D+L+++            
Sbjct: 187 LDARNYGIPQGRRRLFLVGFKEQEKCANFTFPSPKELTITMQDLLQDNIKEGNLLSKNAI 246

Query: 47  -----------IDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                      +D+K  +S KL +             K F +     +      L +
Sbjct: 247 LDTKSFLGGELVDEKYFLSEKLLKY------CLSAGTKNFYHADAKIDLPIARALLS 297


>gi|67922668|ref|ZP_00516173.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
 gi|67855516|gb|EAM50770.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
          Length = 282

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 35/94 (37%), Gaps = 5/94 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEHIDDKSTISNKL- 57
           + A D+GVPQ R R+  +     + EF FP       K      + +  ++  T      
Sbjct: 153 LLASDYGVPQNRRRVIFVGVPK-NYEFNFPIGDFTENKITCSQAMNDLPEESMTDGEPYP 211

Query: 58  WEGHQKRKENNKIAGKG-FGYGLFFENSATTNTL 90
                  ++  +I     + + +   +  T NT+
Sbjct: 212 INPLSSYQKLMRIGSDQVYNHQITKHSQKTINTI 245


>gi|297621903|ref|YP_003710040.1| C-5 cytosine-specific DNA methylase [Waddlia chondrophila WSU
           86-1044]
 gi|297377204|gb|ADI39034.1| C-5 cytosine-specific DNA methylase [Waddlia chondrophila WSU
           86-1044]
          Length = 410

 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 41/103 (39%), Gaps = 20/103 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +K+  + VPQ+RERL+I+   N  V   +FK+P+P      L D L++        S+  
Sbjct: 220 LKSIFYQVPQKRERLFIVGVRNDLVKKAKFKWPSPFKKVLTLKDALKQG---SLYDSDVP 276

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSE 100
               Q   +  K        G               Y+KD SE
Sbjct: 277 TSNGQLYPQRKKEILSHVPQG--------------GYWKDLSE 305


>gi|58580230|ref|YP_199246.1| modification methylase XorII [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58424824|gb|AAW73861.1| Modification methylase XorII [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 442

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ R RL ++          +P P G +  +GD + +  D +S    +LWE 
Sbjct: 173 LNAADYGVPQDRRRLILMGARKGLPLPAYPEPTG-RTTVGDAIGDIPDAESF--PELWER 229

Query: 61  HQKRKENNKIAGKG 74
              + +  K +   
Sbjct: 230 DWVKAKYGKPSTYA 243


>gi|62297515|sp|P52311|MTX2_XANOR RecName: Full=Modification methylase XorII; Short=M.XorII; AltName:
           Full=Cytosine-specific methyltransferase XorII
          Length = 424

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ R RL ++          +P P G +  +GD + +  D +S    +LWE 
Sbjct: 155 LNAADYGVPQDRRRLILMGARKGLPLPAYPEPTG-RTTVGDAIGDIPDAESF--PELWER 211

Query: 61  HQKRKENNKIAGKG 74
              + +  K +   
Sbjct: 212 DWVKAKYGKPSTYA 225


>gi|124262880|ref|YP_001023350.1| C-5 cytosine-specific DNA methylase [Methylibium petroleiphilum
           PM1]
 gi|124262126|gb|ABM97115.1| C-5 cytosine-specific DNA methylase [Methylibium petroleiphilum
           PM1]
          Length = 473

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 41/98 (41%), Gaps = 6/98 (6%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFP---TPLGIKPRLGDILEEHIDDKSTISNKLW 58
            + ++ V + RERL ++      +EF F     P  +  RLG+I++E   D    S    
Sbjct: 289 NSAEWNVLEHRERLCVVAVTKG-IEFSFDGLERPEPVSRRLGEIMDEVPVDAPCWSE--M 345

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
              + ++  ++  G  F   +   +S     L+   +K
Sbjct: 346 AYLKDKRARDEAKGNNFKMTVLTPDSEKVPCLNKSLWK 383


>gi|458402|gb|AAA50432.1| M-XorII [Xanthomonas oryzae]
          Length = 424

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ R RL ++          +P P G +  +GD + +  D +S    +LWE 
Sbjct: 155 LNAADYGVPQDRRRLILMGARKGLPLPAYPEPTG-RTTVGDAIGDIPDAESF--PELWER 211

Query: 61  HQKRKENNKIAGKG 74
              + +  K +   
Sbjct: 212 DWVKAKYGKPSTYA 225


>gi|24527986|emb|CAD33713.1| putative DNA methylase [Escherichia coli]
          Length = 310

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 29/98 (29%), Gaps = 5/98 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   D+GVPQ R R+ I+           F  P     +                 +   
Sbjct: 142 LNCADYGVPQTRMRVIILGVRKDLPDIENFPPPKTHEKEGINLPKWISVGQALQRFTEPR 201

Query: 58  WEGHQKRKENNKIAGKGFGY--GLFFENSATTNTLSAR 93
            +   K  E++       G+    F +      T++ R
Sbjct: 202 VDSQFKNHEHSLYKLTFNGHLGHRFMDPDKPAPTVTGR 239


>gi|291530357|emb|CBK95942.1| DNA-methyltransferase (dcm) [Eubacterium siraeum 70/3]
          Length = 317

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 42/97 (43%), Gaps = 6/97 (6%)

Query: 2   KACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHI--DDKSTISNKL 57
            ACD+G+PQ R R YI+ F +   SV F FP    ++  + D++++    D    +    
Sbjct: 144 DACDYGIPQHRTRTYIVAFRDFAKSVLFDFPQKQQLQKHIFDVIDKRTKADKSFYLDCNS 203

Query: 58  WEGHQKRKENNKIAGKGFG--YGLFFENSATTNTLSA 92
            + ++ ++  +          YG+         TL A
Sbjct: 204 RQYYKMKQSIDDNNQIYRFSDYGIQKSKDGICFTLKA 240


>gi|196037189|ref|ZP_03104504.1| modification methylase HaeIII [Bacillus cereus W]
 gi|195990293|gb|EDX54346.1| modification methylase HaeIII [Bacillus cereus W]
          Length = 415

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 39/86 (45%), Gaps = 6/86 (6%)

Query: 2   KACDFGVPQRRERLYIIDFLNP---SVEFKF--PTPLGIKPRLGDI-LEEHIDDKSTISN 55
            + D+GVPQ RER++I+   N       F++  P P   + ++  + L++ I +    + 
Sbjct: 232 NSRDYGVPQLRERVFIVGIRNDIHEKYGFEYEVPEPTHGEGKIPYVTLKDTISNLPLDAK 291

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFF 81
            ++EG       ++   K +    F 
Sbjct: 292 DVYEGSFSSMYMSRNRKKNWNEQSFT 317


>gi|300869073|ref|ZP_07113674.1| Cytosine-specific methyltransferase (fragment) [Oscillatoria sp.
           PCC 6506]
 gi|300332930|emb|CBN58870.1| Cytosine-specific methyltransferase (fragment) [Oscillatoria sp.
           PCC 6506]
          Length = 345

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A +FG+PQ RER++II       +F         P+L D L+   D +    +K 
Sbjct: 141 LNAKNFGLPQHRERIFIIGTKGKEFKFSKLK-TKFPPKLRDFLDVEGDFEILDRSKY 196


>gi|25011412|ref|NP_735807.1| hypothetical protein gbs1370 [Streptococcus agalactiae NEM316]
 gi|24412950|emb|CAD47029.1| unknown [Streptococcus agalactiae NEM316]
          Length = 450

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER+++I         F FP      P   + L      K  +S ++  
Sbjct: 148 LNSKDFQVPQNRERVFLIGHSRRYRPRFLFPLRREGSPTDIERLGNINPSKHGMSGQV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 206 YLTSGLAPTLTRGKGEGTKIAVP 228


>gi|237742048|ref|ZP_04572529.1| site-specific DNA-methyltransferase [Fusobacterium sp. 4_1_13]
 gi|229429696|gb|EEO39908.1| site-specific DNA-methyltransferase [Fusobacterium sp. 4_1_13]
          Length = 440

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 6/94 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A ++GVPQ R RL +I F N   E K+P     K  L + L +  + +        + 
Sbjct: 189 LNASNYGVPQNRHRLILIGFRNDMKEPKYPKEFKQKVTLREALSDLTNYELD-----NKK 243

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARY 94
           +Q   +  +         +  +     N LS  Y
Sbjct: 244 YQNSSKKGRTKNIVTNETILEKK-KYNNDLSKHY 276


>gi|315639354|ref|ZP_07894516.1| DNA (cytosine-5-)-methyltransferase [Campylobacter upsaliensis
           JV21]
 gi|315480680|gb|EFU71322.1| DNA (cytosine-5-)-methyltransferase [Campylobacter upsaliensis
           JV21]
          Length = 320

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 6/94 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A  + VPQ R+R+ II        E +FP PL I+P+    L + I D     ++   
Sbjct: 147 LNANAYAVPQNRKRVIIIGRRKDIKREVEFPKPLNIEPKT---LFQAIGDLPKDYDENIS 203

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            H      +KI   G+          +  T++ R
Sbjct: 204 NHTG--STHKIRINGYIGNRALSWDKSAPTITGR 235


>gi|315506801|ref|YP_004085688.1| DNA-cytosine methyltransferase [Micromonospora sp. L5]
 gi|315413420|gb|ADU11537.1| DNA-cytosine methyltransferase [Micromonospora sp. L5]
          Length = 412

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           ++A D+GVPQ R R  ++      +  F +P P G  P +GD L E + ++     + W 
Sbjct: 148 LQASDYGVPQLRPRFILVALKTEDAPYFHWPEPQGAPPTVGDTLVELMAERGWRGAQAWA 207


>gi|269976808|ref|ZP_06183783.1| DNA methyltransferase Cfr42I [Mobiluncus mulieris 28-1]
 gi|269935005|gb|EEZ91564.1| DNA methyltransferase Cfr42I [Mobiluncus mulieris 28-1]
          Length = 404

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 22/59 (37%), Gaps = 5/59 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GVPQRR R++++ F +     + FP P          L    D           
Sbjct: 183 DAADYGVPQRRHRVFMVGFRSDVDAGWSFPAPTHS----ASALRAAQDSGEYWERHRIA 237


>gi|110643909|ref|YP_671639.1| putative type II 5-cytosoine methyltransferase [Escherichia coli
           536]
 gi|110345501|gb|ABG71738.1| putative type II 5-cytosoine methyltransferase [Escherichia coli
           536]
          Length = 305

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/98 (16%), Positives = 29/98 (29%), Gaps = 5/98 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   D+GVPQ R R+ I+           F  P     +                 +   
Sbjct: 137 LNCADYGVPQTRMRVIILGVRKDLPDIENFPPPKTHEKEGINLPKWISVGQALQRFTEPR 196

Query: 58  WEGHQKRKENNKIAGKGFGY--GLFFENSATTNTLSAR 93
            +   K  E++       G+    F +      T++ R
Sbjct: 197 VDSQFKNHEHSLYKLTFNGHLGHRFMDPDKPAPTVTGR 234


>gi|295110825|emb|CBL24778.1| DNA-methyltransferase (dcm) [Ruminococcus obeum A2-162]
          Length = 311

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 33/98 (33%), Gaps = 6/98 (6%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE---FKFPTPL-GIKPRLGDILEEHID--DKSTISN 55
              ++GVPQ R+R+ II       E   F+FP P      +         D  D     +
Sbjct: 143 NMANYGVPQTRQRVLIIGQRKDYGEEMLFQFPQPTFSKDGKDLPRWISIKDAIDHFPDPD 202

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                        K+  + +      + +  + T+ AR
Sbjct: 203 TENNVINHIYSAYKVEYRNYTGHRKTDPNKPSPTILAR 240


>gi|116627564|ref|YP_820183.1| site-specific DNA methylase [Streptococcus thermophilus LMD-9]
 gi|116100841|gb|ABJ65987.1| Site-specific DNA methylase [Streptococcus thermophilus LMD-9]
          Length = 406

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 28/89 (31%), Gaps = 1/89 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A ++GVPQ RER+ II          FP P    P   ++        +  + +    
Sbjct: 147 LNAAEYGVPQARERVIIIGNRIGIDN-PFPKPTHKIPDENELDLFPELPDAITTEEAIGF 205

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNT 89
               +  N               +   +T
Sbjct: 206 LADVELQNGKIADHIVVDGRKIYNHIAST 234


>gi|328946815|gb|EGG40952.1| modification methylase DdeI [Streptococcus sanguinis SK1087]
          Length = 387

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 29/101 (28%), Gaps = 11/101 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIK--------PRLGDILEEHIDD 49
           + A DFGVPQ RER+++I          E+ FP    +              IL  +   
Sbjct: 169 INAKDFGVPQNRERVFLIGIRKDLKIKFEWTFPEETTLNNEITLRDAISDLPILGNNEQK 228

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            + I     E     + N                      L
Sbjct: 229 NNYICEPRTEYQALLRGNQTELLNHVSRNHGERLQKIMRAL 269


>gi|160939240|ref|ZP_02086591.1| hypothetical protein CLOBOL_04134 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438203|gb|EDP15963.1| hypothetical protein CLOBOL_04134 [Clostridium bolteae ATCC
           BAA-613]
          Length = 366

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 32/100 (32%), Gaps = 5/100 (5%)

Query: 2   KACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            + D+GVPQ RER+YII      S    FP     K     I+      +   +  +   
Sbjct: 149 NSKDYGVPQSRERVYIIGDLTGRSTGKIFPLRSPGKTAPAQIIGGPQGSRIYDTGGVSPT 208

Query: 61  HQKRKENNKIAGKGFGYGLFFEN----SATTNTLSARYYK 96
                         +      ++       + T+ A Y K
Sbjct: 209 ITSGTGGLGAKTGLYFVAKDEQSGLVTKPYSGTIDASYGK 248


>gi|256545597|ref|ZP_05472956.1| modification methylase HaeIII (cytosine-specificmethyltransferase
           HaeIII) [Anaerococcus vaginalis ATCC 51170]
 gi|256398722|gb|EEU12340.1| modification methylase HaeIII (cytosine-specificmethyltransferase
           HaeIII) [Anaerococcus vaginalis ATCC 51170]
          Length = 340

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+GVPQ R+R++ + F    ++ F   P P   K    D + +  D+      K
Sbjct: 142 LNASDYGVPQDRKRVFYVGFRKDLNISFDLPPKPYDYKLTFRDAIYDLKDNAIPALEK 199


>gi|309379398|emb|CBX21965.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 223

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 7  GVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRK 65
          G PQ RER++++ F  P +  F+FP  + ++  + D LE++ D K  +  K  +     K
Sbjct: 2  GFPQHRERIFVVGFHTPPINGFQFPEKIELEHTMQDFLEDYTDSKYFLREKGVKFVTSSK 61

Query: 66 ENNKIAGKGFGY 77
             K   +  G 
Sbjct: 62 NRQKRYTQINGE 73


>gi|317010333|gb|ADU84080.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           SouthAfrica7]
          Length = 361

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 30/89 (33%), Gaps = 2/89 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI--LEEHIDDKSTISNKLW 58
           + A D+GVPQ RER +I+   + S +F    P         I  L     ++    +   
Sbjct: 153 LNAKDYGVPQSRERAFIVGATHFSFDFDLLEPSQSVSVQEAISDLAYLHSNEGAFESDYL 212

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATT 87
              Q   +          Y     N + +
Sbjct: 213 NPIQSNYQALMRKNSPKLYNHQATNHSQS 241


>gi|254456253|ref|ZP_05069682.1| Cytosine-specific methyltransferase HphIA [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207083255|gb|EDZ60681.1| Cytosine-specific methyltransferase HphIA [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 342

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP 32
           + + D+GVPQ R R++I+      + +F+FP P
Sbjct: 144 LNSADYGVPQIRHRVFIVGIKKELNKKFEFPKP 176


>gi|126658057|ref|ZP_01729209.1| DNA cytosine methylase [Cyanothece sp. CCY0110]
 gi|126620695|gb|EAZ91412.1| DNA cytosine methylase [Cyanothece sp. CCY0110]
          Length = 358

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 1   MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A  F +PQ RER+YI+ F    L   VEF FP        +   +E ++ +  +IS  
Sbjct: 181 LDAALFNLPQVRERIYIVGFCRDYLKERVEFNFPVGRKNNVFIDQFIETNV-EGYSISKH 239

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96
           L + +  +K++ +         +  +NS     T  + Y+K
Sbjct: 240 LQKTYLFKKDDGRP-------QIVDQNSKVKVKTFVSTYHK 273


>gi|294673665|ref|YP_003574281.1| prophage PRU01 DNA methylase, C-5 cytosine-specific family
           [Prevotella ruminicola 23]
 gi|294471747|gb|ADE81136.1| prophage PRU01, DNA methylase, C-5 cytosine-specific family
           [Prevotella ruminicola 23]
          Length = 330

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 31/83 (37%), Gaps = 12/83 (14%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+GV Q R+R++ I F N  +++FKFP       +           K T+ + +W+ 
Sbjct: 145 NAKDYGVAQERKRVFYIGFRNDLNIDFKFPEGSTRDDK----------KKITLRDIIWD- 193

Query: 61  HQKRKENNKIAGKGFGYGLFFEN 83
            +                +    
Sbjct: 194 LKDSAVPALEKNHHNPEAINNNE 216


>gi|261837515|gb|ACX97281.1| cytosine-methyltransferase [Helicobacter pylori 51]
          Length = 355

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|261838928|gb|ACX98693.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori
           52]
          Length = 355

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|210134246|ref|YP_002300685.1| cytosine specific DNA methyltransferase [Helicobacter pylori P12]
 gi|210132214|gb|ACJ07205.1| cytosine specific DNA methyltransferase [Helicobacter pylori P12]
          Length = 355

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|188526860|ref|YP_001909547.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori
           Shi470]
 gi|188143100|gb|ACD47517.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori
           Shi470]
          Length = 355

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|317179558|dbj|BAJ57346.1| cytosine specific DNA methyltransferase [Helicobacter pylori F30]
          Length = 355

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|49476997|ref|YP_035183.1| modification methylase DdeI; cytosine-specific methyltransferase
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|49328553|gb|AAT59199.1| modification methylase DdeI; possible cytosine-specific
           methyltransferase [Bacillus thuringiensis serovar
           konkukian str. 97-27]
          Length = 450

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/91 (16%), Positives = 36/91 (39%), Gaps = 12/91 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLG----------DILEEHID 48
           +   ++GVPQ RER++I+   N      F +P        L           D+ + ++ 
Sbjct: 193 LNCANYGVPQNRERVFIVGINNKYENTYFSYPQQTHGSDYLMPVVTVGQAILDLPDVNVL 252

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGL 79
           +++ +  +     +   + ++     F  G+
Sbjct: 253 EENEVYEQDNNYIENIDDPSRKNFLKFVRGI 283


>gi|257438608|ref|ZP_05614363.1| modification methylase NgoMIV [Faecalibacterium prausnitzii A2-165]
 gi|257198937|gb|EEU97221.1| modification methylase NgoMIV [Faecalibacterium prausnitzii A2-165]
          Length = 293

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 2/61 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFP-TPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R R+ I+         F++P       P +G+ L + +        K W
Sbjct: 124 LNASDYGVPQLRPRVVIVGIRKDQAGAFEYPQEHPRESPTVGETLCDLMSQNGWKGAKKW 183

Query: 59  E 59
            
Sbjct: 184 A 184


>gi|237728463|ref|ZP_04558944.1| DNA-cytosine methyltransferase [Citrobacter sp. 30_2]
 gi|226909941|gb|EEH95859.1| DNA-cytosine methyltransferase [Citrobacter sp. 30_2]
          Length = 318

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 2/60 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGI-KPRLGDILEEHIDDKSTISNKLW 58
           + A D+GV Q R R+  +         F +P PL    P +G++L + +          W
Sbjct: 145 LNASDYGVSQLRPRVVFVGIRKDLAAGFSWPEPLKTEPPTVGELLHDLMAANGWRGADRW 204


>gi|225571452|ref|ZP_03780448.1| hypothetical protein CLOHYLEM_07550 [Clostridium hylemonae DSM
           15053]
 gi|225159928|gb|EEG72547.1| hypothetical protein CLOHYLEM_07550 [Clostridium hylemonae DSM
           15053]
          Length = 377

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ+RER+ II          +   +  K  L DILE+ ID K   S ++   
Sbjct: 222 LNALDFGLPQKRERIIIIGSKK-PFLMDWTFNVEKKKTLDDILEKDIDKKHYASPEIVAK 280

Query: 61  HQKR 64
            + +
Sbjct: 281 RKAK 284


>gi|309809233|ref|ZP_07703103.1| modification methylase HaeIII [Lactobacillus iners SPIN 2503V10-D]
 gi|308170467|gb|EFO72490.1| modification methylase HaeIII [Lactobacillus iners SPIN 2503V10-D]
          Length = 340

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+GVPQ R+R++ + F    ++ F   P P   K    D + +  D+      K
Sbjct: 142 LNASDYGVPQDRKRVFYVGFRKDLNINFDIPPKPYDYKLTFRDAIYDLKDNAIPALEK 199


>gi|134287405|ref|YP_001110788.1| putative cytosine-C5 specific DNA methylase [Clostridium phage
           phiC2]
 gi|93117243|gb|ABE99533.1| putative cytosine-C5 specific DNA methylase [Clostridium phage
           phiC2]
          Length = 316

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 35/94 (37%), Gaps = 3/94 (3%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + +FGVPQ RER++I+  F   S    FP     +  L  +                 
Sbjct: 133 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSRKNLEQLNNPTHSTNRIYDAVGIA 192

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
              + +     A  G  +    +NS    T++AR
Sbjct: 193 RCIRSQAGGGGAKTGLYFIDLNKNSKV--TINAR 224


>gi|308062920|gb|ADO04807.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           Sat464]
          Length = 355

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|226324849|ref|ZP_03800367.1| hypothetical protein COPCOM_02636 [Coprococcus comes ATCC 27758]
 gi|225207297|gb|EEG89651.1| hypothetical protein COPCOM_02636 [Coprococcus comes ATCC 27758]
          Length = 473

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 35/112 (31%), Gaps = 16/112 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDIL-------EEHIDDKST 52
           + + DFGVPQ RER +I+  L      K FP           +             D+  
Sbjct: 176 LNSKDFGVPQNRERCFIVGHLRGRGSAKVFPVERADGENSVSLNLFGCLNGRNSQRDRVY 235

Query: 53  ISNKLWEGHQKRKENNKIAGKG--FGYGLFFENSAT------TNTLSARYYK 96
            S  L      +   N        F      ++           TL++R YK
Sbjct: 236 SSEGLAPTISTKPGGNTEPKVPIIFDTSYIGQDEKVREYEGICPTLTSRDYK 287


>gi|217032842|ref|ZP_03438321.1| hypothetical protein HPB128_165g1 [Helicobacter pylori B128]
 gi|298737011|ref|YP_003729541.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
 gi|216945425|gb|EEC24089.1| hypothetical protein HPB128_165g1 [Helicobacter pylori B128]
 gi|298356205|emb|CBI67077.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
          Length = 361

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|15644682|ref|NP_206852.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori
           26695]
 gi|2313124|gb|AAD07117.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter pylori
           26695]
          Length = 355

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|291539766|emb|CBL12877.1| DNA-methyltransferase (dcm) [Roseburia intestinalis XB6B4]
          Length = 366

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/89 (13%), Positives = 33/89 (37%), Gaps = 8/89 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP---LGIKPRLGDILEEHID-----DKST 52
           + A D+G+PQ R+R++ +   +   +F+FP P           + + +         +  
Sbjct: 155 LYAPDYGIPQMRKRVFFVGLRDGKTKFEFPEPVVDKEHYVTCEEAIGDLPSLQTEKGEII 214

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFF 81
              ++ +   K   + +   +     +  
Sbjct: 215 YGEEIQDYTMKPANSYQRKMRSNSGKVLN 243


>gi|17225517|gb|AAL37447.1|AF328915_1 cytosine-specific DNA methyltransferase [Helicobacter pylori]
          Length = 361

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|15894505|ref|NP_347854.1| DNA-methyltransferase (cytosine-specific) [Clostridium
           acetobutylicum ATCC 824]
 gi|15024146|gb|AAK79194.1|AE007635_8 DNA-methyltransferase (cytosine-specific) [Clostridium
           acetobutylicum ATCC 824]
 gi|325508636|gb|ADZ20272.1| DNA-methyltransferase (cytosine-specific) [Clostridium
           acetobutylicum EA 2018]
          Length = 314

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 36/94 (38%), Gaps = 12/94 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-IKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQRRER++ I  L+   +F F          L   L+ ++D+  T++     
Sbjct: 154 LNAMDFGLPQRRERVFTISCLDGK-KFDFDKLEHRKLRPLSSFLQTNVDEYYTVTQPSI- 211

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                      A    G            T++ R
Sbjct: 212 ---------LRAIGKKGVSRATIIKDYCYTITTR 236


>gi|308061350|gb|ADO03238.1| cytosine specific DNA methyltransferase [Helicobacter pylori Cuz20]
          Length = 355

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|308235652|ref|ZP_07666389.1| DcmB [Gardnerella vaginalis ATCC 14018]
 gi|311115197|ref|YP_003986418.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis ATCC
           14019]
 gi|310946691|gb|ADP39395.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis ATCC
           14019]
          Length = 333

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 31/83 (37%), Gaps = 12/83 (14%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+GV Q R+R++ I F    +++F FP              E  + K T+ + +W+ 
Sbjct: 149 NAKDYGVAQDRKRVFYIGFRKDLNIKFSFPKGS----------TEDDEKKLTLKDVIWD- 197

Query: 61  HQKRKENNKIAGKGFGYGLFFEN 83
            Q      +         +    
Sbjct: 198 LQDTAIPARERNHHNPVAINNNE 220


>gi|228469860|ref|ZP_04054799.1| modification methylase HaeIII [Porphyromonas uenonis 60-3]
 gi|228308495|gb|EEK17283.1| modification methylase HaeIII [Porphyromonas uenonis 60-3]
          Length = 359

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A D+ VP+ R+R++ I F       EF+FP P+  +  L D + +  D   +  +
Sbjct: 146 LNAYDYEVPEDRKRVFYIGFRKDLDIKEFEFPVPIPKRLTLRDAIWDLRDTAISARD 202


>gi|294155584|ref|YP_003559968.1| CpG cytosine-specific DNA modification methyltransferase
           [Mycoplasma crocodyli MP145]
 gi|291600126|gb|ADE19622.1| CpG cytosine-specific DNA modification methyltransferase
           [Mycoplasma crocodyli MP145]
          Length = 176

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 39/102 (38%), Gaps = 11/102 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           M + D+   Q RER++ + FL  +  F+FP        + +++++ I+D +   + +   
Sbjct: 1   MNSKDYNSAQNRERVFAVSFLGEN-NFEFPKINSKPKTIKEVIKQSINDNNVDLSHMLNK 59

Query: 61  HQK----------RKENNKIAGKGFGYGLFFENSATTNTLSA 92
           ++            K               ++      TL+A
Sbjct: 60  YKTSSFTKSNNNIIKSKLLDYTSFNSEAYIYDLDGLGPTLTA 101


>gi|153933427|ref|YP_001385281.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. ATCC 19397]
 gi|153933974|ref|YP_001384769.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. ATCC 19397]
 gi|153935154|ref|YP_001386762.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
 gi|153935271|ref|YP_001386815.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
 gi|153937696|ref|YP_001388073.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
 gi|152929471|gb|ABS34971.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. ATCC 19397]
 gi|152930018|gb|ABS35518.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. ATCC 19397]
 gi|152931068|gb|ABS36567.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
 gi|152931185|gb|ABS36684.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
 gi|152933610|gb|ABS39109.1| DNA-cytosine methyltransferase family protein [Clostridium
           botulinum A str. Hall]
          Length = 315

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 39/92 (42%), Gaps = 9/92 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++ I  L+     F         P + + LE+  ++K  ++     
Sbjct: 149 LNALDFGLPQKRERVFTISCLDGTLFNFNALE-RKKAPHIREFLEDTQEEKYIVTQP--- 204

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K+ +   G   G       +   +T++
Sbjct: 205 --SMLKKMHDKNGNFGGR--VEVINDCCSTIT 232


>gi|17225496|gb|AAL37432.1|AF328909_1 putative cytosine-specific DNA methyltransferase [Helicobacter
           pylori]
 gi|17225522|gb|AAL37451.1|AF328916_1 cytosine-specific DNA methyltransferase [Helicobacter pylori]
          Length = 361

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|308183851|ref|YP_003927984.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           SJM180]
 gi|308059771|gb|ADO01667.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           SJM180]
          Length = 355

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|323152708|gb|EFZ38980.1| DNA-cytosine methyltransferase [Escherichia coli EPECa14]
          Length = 374

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 35/97 (36%), Gaps = 14/97 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP----RLGDILEEHIDDKSTI 53
           +    F +PQ RER+ ++ F        +F         P     L  +L+  ++ K  +
Sbjct: 266 IDGKHF-LPQHRERIVLVGFRRDLNLKADFTLRDISKCFPAQRVTLAQLLDPMVEAKYIL 324

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
           +  LW+   +  +N + A        F        T+
Sbjct: 325 TPVLWKYLYRYAKNIRRAVTASVMEWF------IRTI 355


>gi|167854495|ref|ZP_02477276.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           parasuis 29755]
 gi|219872138|ref|YP_002476513.1| DNA-cytosine methyltransferase/C-5 cytosine-specific DNA methylase
           [Haemophilus parasuis SH0165]
 gi|167854250|gb|EDS25483.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           parasuis 29755]
 gi|219692342|gb|ACL33565.1| DNA-cytosine methyltransferase/C-5 cytosine-specific DNA methylase
           [Haemophilus parasuis SH0165]
          Length = 320

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 31/88 (35%), Gaps = 16/88 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +   ++GVPQ RER+ I+   N    EF FP                  +    S + W 
Sbjct: 158 LNTANYGVPQTRERVIIVGVRNDLTSEFFFPRETHSD-----------SEDLFQSTEKWV 206

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATT 87
             ++   + +   K F       NS  +
Sbjct: 207 DLKRAIGDLENDEKHFSL----PNSGYS 230


>gi|265751237|ref|ZP_06087300.1| DNA-cytosine methyltransferase [Bacteroides sp. 3_1_33FAA]
 gi|270294602|ref|ZP_06200804.1| DNA-cytosine methyltransferase [Bacteroides sp. D20]
 gi|263238133|gb|EEZ23583.1| DNA-cytosine methyltransferase [Bacteroides sp. 3_1_33FAA]
 gi|270276069|gb|EFA21929.1| DNA-cytosine methyltransferase [Bacteroides sp. D20]
          Length = 335

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 33/88 (37%), Gaps = 17/88 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+ VP+ R+R++ I F       +F++PTPL  KP L + + +             
Sbjct: 144 LNANDYDVPEDRDRVFYIGFRKDLDIHDFEYPTPLKHKPTLRESIWD------------- 190

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSAT 86
              Q          K  G      N+  
Sbjct: 191 --LQDSAIPALEKNKTNGNACKVPNNEY 216


>gi|317176866|dbj|BAJ54655.1| cytosine specific DNA methyltransferase [Helicobacter pylori F16]
          Length = 215

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
          + A D+GVPQ RER +I+     S +F    P   
Sbjct: 13 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 47


>gi|297379273|gb|ADI34160.1| Modification methylase [Helicobacter pylori v225d]
          Length = 222

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
          + A D+GVPQ RER +I+     S +F    P   
Sbjct: 20 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 54


>gi|317012300|gb|ADU82908.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Lithuania75]
          Length = 348

 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F  P P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGTLKSFKQKFHSPKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|294673126|ref|YP_003573742.1| C-5 cytosine-specific family DNA methylase [Prevotella ruminicola
           23]
 gi|294473536|gb|ADE82925.1| DNA methylase, C-5 cytosine-specific family [Prevotella ruminicola
           23]
          Length = 342

 Score = 57.7 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 10/35 (28%), Positives = 16/35 (45%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
            A ++GVPQ R+R   +       +F FP     +
Sbjct: 156 NAANYGVPQIRQRFICVGVRKDMPDFIFPEETHSE 190


>gi|462651|sp|P34906|MTF1_FUSNU RecName: Full=Modification methylase FnuDI; Short=M.FnuDI; AltName:
           Full=Cytosine-specific methyltransferase FnuDI
 gi|2961231|gb|AAC05695.1| FnuDI DNA modification methyltransferase [Fusobacterium nucleatum]
          Length = 344

 Score = 57.7 bits (138), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 35/96 (36%), Gaps = 18/96 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GV Q RER++ + F        F+FP P+               ++  + + +W
Sbjct: 142 LNAFDYGVAQDRERVFYVGFRKDLNISNFEFPYPISE------------KERKYLKDSIW 189

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARY 94
           +  +      K   K        EN      L+  Y
Sbjct: 190 D-LKDNALPGKDKNKTNADDCIVENHEY---LTGSY 221


>gi|296393765|ref|YP_003658649.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985]
 gi|296180912|gb|ADG97818.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985]
          Length = 393

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 36/98 (36%), Gaps = 15/98 (15%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+GVPQRR R++I+ F +     + FP+P                +   ++    + 
Sbjct: 182 DAADYGVPQRRHRVFIVGFRSDVRAGWAFPSPTHSG------------EALRLAQVRGDY 229

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
            ++ +   K        G    +     T+  R   DG
Sbjct: 230 FERHRVRAKDRVVIRQPGQGDPDLLPWRTV--RDALDG 265


>gi|535137|emb|CAA56493.1| type II DNA-methyltransferase [Bacillus phage phi3T]
          Length = 326

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG 34
            A D+GV Q+RER++I+   N    +F FP PL 
Sbjct: 156 NAWDYGVAQKRERVFIVGVRNDLGFKFDFPNPLE 189


>gi|325979448|ref|YP_004289164.1| DNA (cytosine-5-)-methyltransferase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|325179376|emb|CBZ49420.1| DNA (cytosine-5-)-methyltransferase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 333

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDD 49
           + A DFGV Q+RER+ ++   N       F++P     KP L D+L +    
Sbjct: 151 LNAWDFGVAQKRERMIMVGIRNDLANKTSFEYPEAHAYKPVLRDVLMDCPPS 202


>gi|206975132|ref|ZP_03236046.1| modification methylase HaeIII [Bacillus cereus H3081.97]
 gi|206746553|gb|EDZ57946.1| modification methylase HaeIII [Bacillus cereus H3081.97]
          Length = 352

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 36/91 (39%), Gaps = 5/91 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ R+R  II     +   +FP P   K  + D + +    +S   N++ + 
Sbjct: 150 LNAADFGVPQNRKRAVIIGKRGLAPA-EFPKPKNEKNTIWDAISDLAFLESGEGNEVQDY 208

Query: 61  HQ----KRKENNKIAGKGFGYGLFFENSATT 87
            +      ++  +         +   +S   
Sbjct: 209 RKAAESFYQQVMRKKSTQLYNHVATNHSKVA 239


>gi|186683211|ref|YP_001866407.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102]
 gi|14594714|gb|AAK68647.1| cytosine-specific DNA methyltransferase [Nostoc punctiforme PCC
           73102]
 gi|186465663|gb|ACC81464.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102]
          Length = 421

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 40/93 (43%), Gaps = 4/93 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A ++GVPQ RERL++I         K+P P+   P L + L         +S  +W+ 
Sbjct: 161 LNAANYGVPQSRERLFLIGAREDVELPKYPQPITK-PALPNNLTSKKISNIPLSPTVWDA 219

Query: 61  HQKRKE---NNKIAGKGFGYGLFFENSATTNTL 90
            +   E     ++  + +  G + + S     L
Sbjct: 220 IKDLPEIENYPELVARDWVVGEYEKPSNYARVL 252


>gi|29028380|gb|AAO64731.1| EcoT38I methyltransferase [Escherichia coli]
          Length = 363

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 19/103 (18%), Positives = 41/103 (39%), Gaps = 10/103 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS----VEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + + DFGVPQ RER++ I F + +    VE        + P +G+I+       +  +++
Sbjct: 147 LNSKDFGVPQNRERMFFIGFRSENDVKRVEAAIKKYQYLSPTVGEIIRPLGRAGNPNNSR 206

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE------NSATTNTLSAR 93
           +            +    +   +F         +   +T++A 
Sbjct: 207 VCNARITNAAKPVLRKSPYAGMMFNGQGRPINPNGYASTIAAS 249


>gi|227874774|ref|ZP_03992927.1| DNA methyltransferase Cfr42I [Mobiluncus mulieris ATCC 35243]
 gi|227844549|gb|EEJ54705.1| DNA methyltransferase Cfr42I [Mobiluncus mulieris ATCC 35243]
          Length = 420

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 22/59 (37%), Gaps = 5/59 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+GVPQRR R++++ F +     + FP P          L    +           
Sbjct: 199 DAADYGVPQRRHRVFMVGFRSDVDAGWNFPAPTHS----ASALRAAQESGEYWERHRIA 253


>gi|169832810|ref|YP_001694558.1| methyl transferase [Streptococcus pneumoniae Hungary19A-6]
 gi|168995312|gb|ACA35924.1| methyl transferase [Streptococcus pneumoniae Hungary19A-6]
          Length = 452

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGD---ILEEHIDDKSTISNK 56
           + + DFGVPQ RER++II           FP     +    +   IL      KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKILGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRSKGEGFKVAI 230


>gi|308182232|ref|YP_003926359.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           PeCan4]
 gi|308064417|gb|ADO06309.1| cytosine specific DNA methyltransferase [Helicobacter pylori
           PeCan4]
          Length = 281

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|302383143|ref|YP_003818966.1| DNA-cytosine methyltransferase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193771|gb|ADL01343.1| DNA-cytosine methyltransferase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 377

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 24/57 (42%), Gaps = 4/57 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A + GVPQ+RER++I+ F +  S E+ FP           +      +       
Sbjct: 170 LNAANHGVPQKRERVFIVGFRSDLSTEWNFPAETH---SARALAWAQGPEGDYWDQH 223


>gi|315644199|ref|ZP_07897369.1| DNA-cytosine methyltransferase [Paenibacillus vortex V453]
 gi|315280574|gb|EFU43863.1| DNA-cytosine methyltransferase [Paenibacillus vortex V453]
          Length = 485

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 8/57 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG-------IKPRLGDILEEHIDD 49
           + + D+GVPQ RER+ ++   N    ++++P P             L D + + ++D
Sbjct: 225 LNSRDYGVPQLRERVILVGVRNDIDFDYEYPEPSHGEGLGLNPYVTLRDAIGDLVED 281


>gi|110799020|ref|YP_694603.1| DNA-cytosine methyltransferase [Clostridium perfringens ATCC 13124]
 gi|110673667|gb|ABG82654.1| DNA-cytosine methyltransferase [Clostridium perfringens ATCC 13124]
          Length = 361

 Score = 57.7 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 32/80 (40%), Gaps = 10/80 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG------IKPRLGDILEEHIDDKS-- 51
           + + ++GV Q+RER+  +       + ++FP P            + D+++E  D K   
Sbjct: 173 LNSAEYGVAQKRERVIFVGIRKDLNKVYEFPNPTHGVGRKYPFVTVNDVIQELGDIKHNY 232

Query: 52  -TISNKLWEGHQKRKENNKI 70
              S +  +  +   +    
Sbjct: 233 VKYSEERLKYMKLIPKGGGN 252


>gi|319757724|gb|ADV69666.1| DNA-cytosine methyltransferase [Streptococcus suis JS14]
          Length = 451

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP      P   + L      K  ++ ++  
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFLFPLKRENSPAHLERLGNINPSKRGLNGEV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 206 YLTTGLAPTLTRGKGEGAKIAIP 228


>gi|317181351|dbj|BAJ59135.1| cytosine specific DNA methyltransferase [Helicobacter pylori F57]
          Length = 281

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|17225547|gb|AAL37468.1|AF328924_1 cytosine-specific DNA methyltransferase [Helicobacter pylori]
          Length = 234

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
          + A D+GVPQ RER +I+     S +F    P   
Sbjct: 32 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 66


>gi|332672853|gb|AEE69670.1| possible DNA (cytosine-5-)-methyltransferase [Helicobacter pylori
           83]
          Length = 281

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|218133430|ref|ZP_03462234.1| hypothetical protein BACPEC_01295 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990805|gb|EEC56811.1| hypothetical protein BACPEC_01295 [Bacteroides pectinophilus ATCC
           43243]
          Length = 320

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 35/98 (35%), Gaps = 4/98 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + +FGVPQ RER++II  L      +  P        L  ++      +   ++ +  
Sbjct: 151 LNSKNFGVPQNRERVFIIANLRSRGRREILPLTGENAAALNQLIGGMQGYRVYGTDGISA 210

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT---LSARY 94
                          +       +   T+T   L+ARY
Sbjct: 211 TLVGNAGGVGAKTGLYFIDQSNHDPKITDTARCLTARY 248


>gi|154504826|ref|ZP_02041564.1| hypothetical protein RUMGNA_02336 [Ruminococcus gnavus ATCC 29149]
 gi|153794709|gb|EDN77129.1| hypothetical protein RUMGNA_02336 [Ruminococcus gnavus ATCC 29149]
          Length = 422

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 35/98 (35%), Gaps = 4/98 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + +FGVPQ RER++II  L      +  P        L  ++      +   ++ +  
Sbjct: 151 LNSKNFGVPQNRERVFIIANLRSRGRREILPLTGENAAALNQLIGGMQGYRVYGTDGISA 210

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT---LSARY 94
                          +       +   T+T   L+ARY
Sbjct: 211 TLVGNAGGVGAKTGLYFIDQSNHDPKITDTARCLTARY 248


>gi|153814253|ref|ZP_01966921.1| hypothetical protein RUMTOR_00462 [Ruminococcus torques ATCC 27756]
 gi|145848649|gb|EDK25567.1| hypothetical protein RUMTOR_00462 [Ruminococcus torques ATCC 27756]
          Length = 422

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 35/98 (35%), Gaps = 4/98 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + +FGVPQ RER++II  L      +  P        L  ++      +   ++ +  
Sbjct: 151 LNSKNFGVPQNRERVFIIANLRSRGRREILPLTGENAAALNQLIGGMQGYRVYGTDGISA 210

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT---LSARY 94
                          +       +   T+T   L+ARY
Sbjct: 211 TLVGNAGGVGAKTGLYFIDQSNHDPKITDTARCLTARY 248


>gi|119511191|ref|ZP_01630308.1| C-5 cytosine-specific DNA methylase [Nodularia spumigena CCY9414]
 gi|119464179|gb|EAW45099.1| C-5 cytosine-specific DNA methylase [Nodularia spumigena CCY9414]
          Length = 432

 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 3/69 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  FGVPQ RERL+I+   N      +P  +  + +     +  +  +  +S  +WE 
Sbjct: 157 LNAAHFGVPQNRERLFILGCRNDLELPNYPEAITQRAKPK---KSGLPHELNLSPTVWEA 213

Query: 61  HQKRKENNK 69
            Q   E  K
Sbjct: 214 LQDLPEIEK 222


>gi|217034606|ref|ZP_03440014.1| hypothetical protein HP9810_903g31 [Helicobacter pylori 98-10]
 gi|216942961|gb|EEC22446.1| hypothetical protein HP9810_903g31 [Helicobacter pylori 98-10]
          Length = 281

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|315586055|gb|ADU40436.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 35A]
          Length = 281

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|254413051|ref|ZP_05026823.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196180215|gb|EDX75207.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 353

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 40/99 (40%), Gaps = 14/99 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRL-----GDILEEHIDDKSTIS 54
           + A D+GVPQRRERL+ +        +K+ P      P       G++      +   ++
Sbjct: 162 LNAADYGVPQRRERLFCVAHRGG---WKWHPKTHHNLPYTVGEALGELALIVPLNAKFLT 218

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
             + E  +K ++ +K               A + T++ R
Sbjct: 219 PSMDEYIKKYEKASKC-----VRPRDLHLDAPSRTVTCR 252


>gi|90592696|ref|YP_529611.1| hypothetical protein CDBPCV119_gp60 [Clostridium phage phi CD119]
 gi|71482543|gb|AAX53484.1| hypothetical protein [Clostridium phage phi CD119]
          Length = 260

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 34/94 (36%), Gaps = 3/94 (3%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + +FGVPQ RER++I+  F   S    FP        L  +                 
Sbjct: 157 LNSKNFGVPQNRERIFIVGHFRGRSTRKVFPIERKSGKNLEQLNNPTHSTNRIYDAVGIA 216

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
              + +     A  G  +    +NS    T++AR
Sbjct: 217 RCIRSQAGGGGAKTGLYFIDLNKNSKV--TINAR 248


>gi|317179856|dbj|BAJ57642.1| cytosine specific DNA methyltransferase [Helicobacter pylori F32]
          Length = 281

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 79  LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 113


>gi|254465219|ref|ZP_05078630.1| modification methylase XorII [Rhodobacterales bacterium Y4I]
 gi|206686127|gb|EDZ46609.1| modification methylase XorII [Rhodobacterales bacterium Y4I]
          Length = 437

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DF VPQ R RL ++     +   ++P  +  +P   D L +  D ++   ++LW  
Sbjct: 155 LNAADFCVPQDRHRLILMGTKKGAKLPEYPKVISKRPTCEDALGDLPDAETF--DELWSS 212


>gi|269114810|ref|YP_003302573.1| Cytosine-specific DNA methyltransferase/Type II site-specific
           deoxyribonuclease [Mycoplasma hominis]
 gi|268322435|emb|CAX37170.1| Cytosine-specific DNA methyltransferase/Type II site-specific
           deoxyribonuclease [Mycoplasma hominis ATCC 23114]
          Length = 553

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 32/80 (40%), Gaps = 8/80 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFGVPQ+RERL  I         + F+FP     KP + D+  +    K       
Sbjct: 151 LNAWDFGVPQKRERLITIGVRQDLLSKISFEFPMEHSYKPTMRDVKLDINPSKDEC---- 206

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            + +   KE         GY
Sbjct: 207 -QRYSDYKEKIFSLVPPGGY 225


>gi|321312120|ref|YP_004204407.1| cytosine-specific methyltransferase [Bacillus subtilis BSn5]
 gi|320018394|gb|ADV93380.1| cytosine-specific methyltransferase [Bacillus subtilis BSn5]
          Length = 380

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 43/126 (34%), Gaps = 27/126 (21%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---F-----KFPTPLGIKPRLGDILEEHIDDKST 52
           + +  FGVPQ+RER++ + FL  +V+   F     K              L     DK+ 
Sbjct: 149 LNSSHFGVPQKRERIFFVGFLEKNVDSNLFISRLEKKRKKPKSVREAISHLGPAGTDKNP 208

Query: 53  ISNKLWEGHQKR---KENNKIAGKGFGYGLFFENSATTNTLSAR--------------YY 95
           ++             +++        G G        +NTL A               Y+
Sbjct: 209 LTCTAKITLAANPVLRKSPYAGMIFNGMGRPLNLEEASNTLPASMGGNKTPIIDEDLLYH 268

Query: 96  KDGSEI 101
             GSEI
Sbjct: 269 --GSEI 272


>gi|313675860|ref|YP_004053856.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
 gi|312942558|gb|ADR21748.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
          Length = 412

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +KA  + VPQ+RERL ++       +EF +P P      L D L++     S +   L  
Sbjct: 218 LKAIQYRVPQKRERLILVGIRKDIDIEFLYPKPHKKIYNLKDALKKGPLFNSDVPKSLGA 277

Query: 60  GHQKRKENNKIAGKGFGY 77
            + + K+         GY
Sbjct: 278 KYPEYKKTILDLIPPKGY 295


>gi|261838450|gb|ACX98216.1| type II m5C methylase [Helicobacter pylori 51]
          Length = 318

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDA---DNECYLDTNNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 202 TFQRYLRNQYNHNRVFLENILTLENAVLDT 231


>gi|315029938|gb|EFT41870.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX4000]
          Length = 317

 Score = 57.3 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 38/94 (40%), Gaps = 6/94 (6%)

Query: 1   MKACDFGVPQRRERLY-IIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+R+R++ I         F       +KP LG+ LE   D K  ++     
Sbjct: 149 LNAMDFGIPQKRKRVFAISKLDGEPFNFDLLKHRPLKP-LGNFLEVTTDQKYLVTQPSM- 206

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                K  +K +      G     +    T++ R
Sbjct: 207 ---LSKIRSKSSLANGFSGRLEVVNDFVYTITTR 237


>gi|322376648|ref|ZP_08051141.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           sp. M334]
 gi|321282455|gb|EFX59462.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           sp. M334]
          Length = 452

 Score = 57.3 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 27/109 (24%), Positives = 42/109 (38%), Gaps = 11/109 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNK 56
           + + DFGVPQ RER++II           FP     +    +IL+        KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSEILKTLGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL----FFENSATTNTLSARYYKDGSEI 101
           ++          +  G+GF   +            N    R +KD  E+
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKVAIPCMTPDRLDKRQN---GRRFKDNQEV 253


>gi|194337838|ref|YP_002019632.1| DNA-cytosine methyltransferase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194310315|gb|ACF45015.1| DNA-cytosine methyltransferase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 409

 Score = 57.3 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ I+      S+ + FP     + R   +L +       ++ + WE
Sbjct: 170 INAADYGVPQTRERVVIVGTRADISLPWSFPIETHSEDR---LLWD-----MYVTGEYWE 221

Query: 60  GHQKRK 65
            H+  K
Sbjct: 222 RHKVHK 227


>gi|293371777|ref|ZP_06618187.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f]
 gi|292633229|gb|EFF51800.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f]
          Length = 459

 Score = 57.3 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 39/99 (39%), Gaps = 7/99 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIK-PRLGDILEEHIDDKSTISNKLW 58
           + A D+ +PQ R R++I+ F+   +  FKFP P       L   + +  ++     N+  
Sbjct: 143 LNAADYCIPQDRFRVFIVGFIKELNGAFKFPEPSQKPLVTLQKAIGDITEEPHLYDNERV 202

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN-----SATTNTLSA 92
               ++  N+ +    F       N        + T+ A
Sbjct: 203 NQEYEKWTNHDVFTGPFDTKFMARNRVRSWDEVSFTIQA 241


>gi|321156918|emb|CBW38908.1| putative DNA methylase [Streptococcus pneumoniae]
          Length = 452

 Score = 57.3 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNK 56
           + + DFGVPQ RER++II      S    FP     +    +IL+        KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKSTRLLFPFRREGQATNSEILKTLGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKIAI 230


>gi|311221492|gb|ADP76553.1| DNA methyltransferase [Helicobacter pylori]
          Length = 587

 Score = 57.3 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A D+GVPQ RER +I+     S +F    P   
Sbjct: 153 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 187


>gi|109946722|ref|YP_663950.1| cytosine specific DNA methyltransferase fragment 2 [Helicobacter
          acinonychis str. Sheeba]
 gi|109713943|emb|CAJ98951.1| cytosine specific DNA methyltransferase fragment 2 [Helicobacter
          acinonychis str. Sheeba]
          Length = 101

 Score = 57.3 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
          + A D+GVPQ RER +I+   + S +F    P   
Sbjct: 45 LNAKDYGVPQSRERAFIVGATHFSFDFNLLEPSQS 79


>gi|269122950|ref|YP_003305527.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM
           12112]
 gi|268314276|gb|ACZ00650.1| DNA-cytosine methyltransferase [Streptobacillus moniliformis DSM
           12112]
          Length = 328

 Score = 57.3 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 28/79 (35%), Gaps = 1/79 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ R+R++ I F       KF  P           +   D K T    L + 
Sbjct: 142 LNASDYGVPQDRKRVFYIGFRKDL-NIKFDKPPKQYGYKVTFKDAIYDLKDTAIPALEKN 200

Query: 61  HQKRKENNKIAGKGFGYGL 79
                +   +  + F    
Sbjct: 201 KTNGDKCKVLNHEYFIGAY 219


>gi|146318633|ref|YP_001198345.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 05ZYH33]
 gi|146320840|ref|YP_001200551.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 98HAH33]
 gi|253751755|ref|YP_003024896.1| C-5 cytosine-specific DNA methylase [Streptococcus suis SC84]
 gi|253755540|ref|YP_003028680.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407]
 gi|145689439|gb|ABP89945.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 05ZYH33]
 gi|145691646|gb|ABP92151.1| C-5 cytosine-specific DNA methylase [Streptococcus suis 98HAH33]
 gi|251816044|emb|CAZ51664.1| C-5 cytosine-specific DNA methylase [Streptococcus suis SC84]
 gi|251818004|emb|CAZ55786.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407]
          Length = 451

 Score = 57.3 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP      P   + L      K  ++ ++  
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRPRFLFPLRRENSPAHLERLGNINPSKRGLNGEV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 206 YLTNGLAPTLTRGKGEGAKIAIP 228


>gi|319412045|emb|CBY91978.1| C-5-cytosine-specific DNA methylase [Streptococcus pneumoniae]
          Length = 452

 Score = 57.3 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNK 56
           + + DFGVPQ RER++II  F        FP     +    + L+        KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHFRKKGTRLLFPFTREGQATHSETLKTLGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKVAI 230


>gi|294651999|ref|ZP_06729281.1| DNA (cytosine-5-)-methyltransferase [Acinetobacter haemolyticus
           ATCC 19194]
 gi|292822115|gb|EFF81036.1| DNA (cytosine-5-)-methyltransferase [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 336

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 6/99 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+G+ Q R+R+  + F    +V + FP P+  K  L DI+++  D      NK   
Sbjct: 145 LNATDYGIAQDRKRVIFLGFRKDLNVHYTFPEPIVKKLVLKDIIKDLEDKAVPAINKSKP 204

Query: 60  GHQKRKENNKIAGKGFGYGLFFEN-----SATTNTLSAR 93
                  N++    GF       N        + T+ A 
Sbjct: 205 NPLAIVPNHEYMTGGFSSMYMSRNRVRSWDEPSFTIQAG 243


>gi|158335733|ref|YP_001516905.1| DNA-cytosine methyltransferase [Acaryochloris marina MBIC11017]
 gi|158305974|gb|ABW27591.1| DNA-cytosine methyltransferase [Acaryochloris marina MBIC11017]
          Length = 397

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 34/90 (37%), Gaps = 6/90 (6%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A ++GVPQRRER++I+      ++E+ FP           +L       +         
Sbjct: 175 DAANYGVPQRRERVFIVGIREDLNIEWSFPEESHSLDS---LLWSQFITGAYWIRNAVNP 231

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +   E+     +     L  + S  + +L
Sbjct: 232 LEI--EHLDQRTQQRAKQLMQQPSLFSPSL 259


>gi|119512301|ref|ZP_01631388.1| DNA modification methylase [Nodularia spumigena CCY9414]
 gi|119463081|gb|EAW44031.1| DNA modification methylase [Nodularia spumigena CCY9414]
          Length = 502

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDK 50
           + + D+GVPQ R R+YII F       +F  P     K +LGDIL    + K
Sbjct: 147 INSFDYGVPQNRIRVYIIGFHKQEYLEKFALPKQTDKKRKLGDILGITSEQK 198


>gi|327474139|gb|EGF19549.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           sanguinis SK408]
          Length = 480

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNK 56
           + + DFGVPQ RER++II      S    FP     +    +IL+        KS +S K
Sbjct: 176 LNSKDFGVPQNRERVFIIGHSRKKSTRLLFPFRREGQATNSEILKTLGNLNPSKSGMSGK 235

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 236 VYYSEGLAPTLVRGKGEGFKIAI 258


>gi|223932228|ref|ZP_03624232.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591]
 gi|223899209|gb|EEF65566.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591]
          Length = 451

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 29/83 (34%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP      P   + L      K  ++ ++  
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRRENSPAHLERLGNINPSKRGLNGEV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       G G G  +   
Sbjct: 206 YLTSGLAPTLTRGNGEGAKIAIP 228


>gi|332704951|ref|ZP_08425037.1| DNA-methyltransferase (dcm) [Lyngbya majuscula 3L]
 gi|332356303|gb|EGJ35757.1| DNA-methyltransferase (dcm) [Lyngbya majuscula 3L]
          Length = 360

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 36/98 (36%), Gaps = 7/98 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG------IKPRLGDILEEHIDDKSTIS 54
           ++A  +G+PQ RERL+ +     + +F FP               G  L +  D +   +
Sbjct: 150 LEAASYGIPQYRERLFFVGLATKN-DFTFPRKTHGLGTSNPYISSGSALTDVPDYEPNTT 208

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
              +      +     A    G G      A + T++A
Sbjct: 209 KVSYANKPVIRPTPWTATLVKGGGKPINFDAPSPTITA 246


>gi|302347057|ref|YP_003815355.1| putative modification methylase HhaI [Prevotella melaninogenica
           ATCC 25845]
 gi|302150379|gb|ADK96640.1| putative modification methylase HhaI [Prevotella melaninogenica
           ATCC 25845]
          Length = 453

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 30/80 (37%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   +FG+PQ R+R+YI+           F FP        + DI+E +  D + I  + 
Sbjct: 150 LSPHEFGIPQHRKRIYIVCIRKDLGLLDNFTFPKGNKPVCDVNDIIEANAKDITPIKEET 209

Query: 58  WEGHQKRKENNKIAGKGFGY 77
                  +E         G 
Sbjct: 210 HYQLNIWQEFIDKTIANGGT 229


>gi|127429|sp|P06530|MTBR_BACSU RecName: Full=Modification methylase BsuRI; Short=M.BsuRI; AltName:
           Full=Cytosine-specific methyltransferase BsuRI
 gi|40247|emb|CAA26731.1| unnamed protein product [Bacillus subtilis]
          Length = 436

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 33/85 (38%), Gaps = 4/85 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG---IKPRLGDILEEHIDDKSTISNK 56
           + A D+GVPQ RER+ I       S  +K+P+P        +    L + I D  T    
Sbjct: 227 LNARDYGVPQLRERVIIEGVRKDISFNYKYPSPTHGEETGLKPFKTLRDSIGDLVTDPGP 286

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFF 81
            + G       ++   K +    F 
Sbjct: 287 YFTGSYSSIYMSRNRKKSWDEQSFT 311


>gi|291528318|emb|CBK93904.1| DNA-methyltransferase (dcm) [Eubacterium rectale M104/1]
          Length = 344

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHID 48
           + A ++GVPQ+RERL  I   N  V   E++FP     KP L D+L +  D
Sbjct: 152 LNAWNYGVPQKRERLITIGIRNDLVGKTEYRFPKAHSYKPVLRDVLLDCPD 202


>gi|326559503|gb|EGE09926.1| DNA-cytosine methyltransferase [Moraxella catarrhalis 7169]
          Length = 354

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 36/105 (34%), Gaps = 13/105 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A  +GV Q R R+ I+        + K+P PL  +       ++ +       + LWE
Sbjct: 179 LNASHYGVAQNRVRVIIVGIRKDIDKKMKYPKPLFGELSDS---QKPVITSKQAIDDLWE 235

Query: 60  GH----QKRKENNKIAGKGFGYGLFFEN-----SATTNTLSARYY 95
                     +N+    K +       N          T+ A ++
Sbjct: 236 LLDDNINSHSKNHYSKAKFYPNKKLQGNCQINADKPAPTIRAEHH 280


>gi|306821027|ref|ZP_07454646.1| possible DNA (cytosine-5-)-methyltransferase [Eubacterium yurii
           subsp. margaretiae ATCC 43715]
 gi|304550968|gb|EFM38940.1| possible DNA (cytosine-5-)-methyltransferase [Eubacterium yurii
           subsp. margaretiae ATCC 43715]
          Length = 317

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 37/92 (40%), Gaps = 7/92 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F     I  +   + LE+ + +   +  K   
Sbjct: 156 LNAMDFGIPQKRERIFVVSILGKN-NFDFEKLEKIPTKHISEFLEKEVSEIYEVRQKSI- 213

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                + N K         +         T+S
Sbjct: 214 -LSNIQGNIKNINYKGRLKII---DKYVYTIS 241


>gi|207093118|ref|ZP_03240905.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter
          pylori HPKX_438_AG0C1]
          Length = 199

 Score = 56.9 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
          + A D+GVPQ RER +I+     S +F    P   
Sbjct: 32 LNAKDYGVPQNRERAFIVGASRFSFDFNLLEPSQS 66


>gi|182437151|ref|YP_001824870.1| putative SacI methylase [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|178465667|dbj|BAG20187.1| putative SacI methylase [Streptomyces griseus subsp. griseus NBRC
           13350]
          Length = 363

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 29/81 (35%), Gaps = 1/81 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ R RL++I         + P P                   T S  L EG
Sbjct: 174 LNAADFGVPQARPRLFLIGVPKGKKVPQHPDPTHGGKWERRATGTTEQPHVTTSQAL-EG 232

Query: 61  HQKRKENNKIAGKGFGYGLFF 81
                E  ++    +G+ L  
Sbjct: 233 LMAEPEPGEVVAGKYGHLLPD 253


>gi|208289|gb|AAA72678.1| Mtase protein (ttg start codon) [synthetic construct]
          Length = 474

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 34/91 (37%), Gaps = 30/91 (32%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RER+YII                                   S  FK+P
Sbjct: 182 LNSKFFNVPQNRERVYIIGIREDLVENEQWVVGQKRNDVLSKGKKRLQEINIKSFNFKWP 241

Query: 31  TPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
               +  RL +ILE+ +D+K  ++ +  +  
Sbjct: 242 LQDTVTKRLREILEDFVDEKYYLNEEKTKKL 272


>gi|218135211|ref|ZP_03464015.1| hypothetical protein BACPEC_03116 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990596|gb|EEC56607.1| hypothetical protein BACPEC_03116 [Bacteroides pectinophilus ATCC
           43243]
          Length = 344

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHID 48
           + A ++GVPQ+RERL  I   N  V   E++FP     KP L D+L +  D
Sbjct: 152 LNAWNYGVPQKRERLITIGIRNDLVGKTEYRFPKAHSYKPVLRDVLLDCPD 202


>gi|15612115|ref|NP_223767.1| type II DNA modification (methyltransferase [Helicobacter pylori
           J99]
 gi|4155654|gb|AAD06642.1| TYPE II DNA MODIFICATION ENZYME (METHYLTRANSFERASE) [Helicobacter
           pylori J99]
          Length = 321

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKRPFNFPLGLANDYCFKDFLDA---DNECYLDVSNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 202 TFQRYLRNPYNHNRVFLEDILTLENAVLDT 231


>gi|326567273|gb|EGE17393.1| DNA-cytosine methyltransferase [Moraxella catarrhalis 12P80B1]
 gi|326568220|gb|EGE18302.1| DNA-cytosine methyltransferase [Moraxella catarrhalis BC8]
          Length = 354

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 36/105 (34%), Gaps = 13/105 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A  +GV Q R R+ I+        + K+P PL  +       ++ +       + LWE
Sbjct: 179 LNASHYGVAQNRVRVIIVGIRKDIDKKMKYPKPLFGELSDS---QKPVITSKQAIDDLWE 235

Query: 60  GH----QKRKENNKIAGKGFGYGLFFEN-----SATTNTLSARYY 95
                     +N+    K +       N          T+ A ++
Sbjct: 236 LLDDNINSHSKNHYSKAKFYPNKKLQGNCQINADKPAPTIRAEHH 280


>gi|332162719|ref|YP_004299296.1| Cytosine-specific methyltransferase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666949|gb|ADZ43593.1| Cytosine-specific methyltransferase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330859459|emb|CBX69803.1| hypothetical protein YEW_FM23370 [Yersinia enterocolitica W22703]
          Length = 365

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 34/91 (37%), Gaps = 5/91 (5%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
            + +FGVPQ RER++I+  L+ +  FK   P+ I  +         +D      KL E  
Sbjct: 213 NSANFGVPQTRERVFIVGTLHGNPLFK--EPVDILHKNE---WLTCNDAIHDLEKLDEDR 267

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                 +K                 + T+ A
Sbjct: 268 TFNHIWSKAKKSPDQGSRRLTKDKPSQTIRA 298


>gi|328471744|gb|EGF42621.1| putative C-5 cytosine-specific DNA methylase [Vibrio
           parahaemolyticus 10329]
          Length = 392

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 33/97 (34%), Gaps = 10/97 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R+R +I+   +     +  FP P                   T ++ ++
Sbjct: 160 LNAKDYGVPQNRKRAFILGIRDDVKIDKLVFP-PKKTHFSPSSQEVAGGASSWTPASSVF 218

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
           E          +      Y    ++        ARYY
Sbjct: 219 EPITSDIIERFVTDHFRPYTKLSDDD-------ARYY 248


>gi|22537444|ref|NP_688295.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae
           2603V/R]
 gi|76797962|ref|ZP_00780222.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae
           18RS21]
 gi|77406085|ref|ZP_00783160.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae H36B]
 gi|313890485|ref|ZP_07824113.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|22534321|gb|AAN00168.1|AE014251_12 C-5 cytosine-specific DNA methylase [Streptococcus agalactiae
           2603V/R]
 gi|76586686|gb|EAO63184.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae
           18RS21]
 gi|77175318|gb|EAO78112.1| C-5 cytosine-specific DNA methylase [Streptococcus agalactiae H36B]
 gi|313121002|gb|EFR44113.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|323127117|gb|ADX24414.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
          Length = 451

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP      P   + L      K  ++ ++  
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRREDSPAHLERLGNINPSKHGLNGEV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 206 YLTSGLAPTLTRGKGEGAKIAIP 228


>gi|212639806|ref|YP_002316326.1| Site-specific DNA methylase [Anoxybacillus flavithermus WK1]
 gi|212561286|gb|ACJ34341.1| Site-specific DNA methylase [Anoxybacillus flavithermus WK1]
          Length = 469

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 7/55 (12%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLG------IKPRLGDILEEHID 48
           +KA D+GVPQ RER+++I    +    F++P P            +GD L +  +
Sbjct: 212 LKASDYGVPQHRERIFLIGINRDYDATFRYPLPTHGPDRTFPYVTVGDALFDLPE 266


>gi|169834211|ref|YP_001693507.1| hypothetical protein SPH_0083 [Streptococcus pneumoniae
           Hungary19A-6]
 gi|168996713|gb|ACA37325.1| hypothetical protein SPH_0083 [Streptococcus pneumoniae
           Hungary19A-6]
          Length = 255

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 36/97 (37%), Gaps = 17/97 (17%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DFGVPQ RER++II           FP  +G   R  D        K   + K   
Sbjct: 147 LNSKDFGVPQNRERVFIIGHSRKRGTRRVFP--IGRANREFDF---EPKIKIVGNTKNPN 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           G                  + ++++    TL AR YK
Sbjct: 202 G-----------TSQGTGSVVYDSNGLVGTLCARDYK 227


>gi|9630267|ref|NP_046694.1| modification methylase [Bacillus phage SPBc2]
 gi|16079084|ref|NP_389907.1| SP-beta prophage DNA (cytosine-5-)-methyltransferase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221309931|ref|ZP_03591778.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221314254|ref|ZP_03596059.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221319176|ref|ZP_03600470.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221323451|ref|ZP_03604745.1| modification methylase Bsu [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|56405062|sp|P68585|MTBP_BACSU RecName: Full=Phi-3T prophage-derived modification methylase
           Phi3TI; Short=M.Phi3TI; AltName: Full=Cytosine-specific
           methyltransferase Phi3TI
 gi|56405063|sp|P68586|MTBP_BPPHT RecName: Full=Modification methylase Phi3TI; Short=M.Phi3TI;
           AltName: Full=Cytosine-specific methyltransferase Phi3TI
 gi|7433506|pir||T12906 modification methylase - Bacillus subtilis phage SPBc2
 gi|215471|gb|AAA32352.1| methyltransferase (ttg start codon) [Bacillus phage phi3T]
 gi|2634418|emb|CAB13917.1| putative SP-beta prophage DNA (cytosine-5-)-methyltransferase
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|3025620|gb|AAC13115.1| modification methylase [Bacillus phage SPbeta]
          Length = 443

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 34/91 (37%), Gaps = 30/91 (32%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RER+YII                                   S  FK+P
Sbjct: 182 LNSKFFNVPQNRERVYIIGIREDLVENEQWVVGQKRNDVLSKGKKRLQEINIKSFNFKWP 241

Query: 31  TPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
               +  RL +ILE+ +D+K  ++ +  +  
Sbjct: 242 LQDTVTKRLREILEDFVDEKYYLNEEKTKKL 272


>gi|220903552|ref|YP_002478864.1| DNA-cytosine methyltransferase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219867851|gb|ACL48186.1| DNA-cytosine methyltransferase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 310

 Score = 56.9 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 32/100 (32%), Gaps = 9/100 (9%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIK-PRLGDILEEHIDDKSTISNKL 57
              DFGVPQ R R+ I           ++++P     + P  G +    I +      + 
Sbjct: 143 NVADFGVPQSRFRVIIAGTRKDIPKRLDYEYPAATHAQAPSQGKLPWVTIGEALKEIPEP 202

Query: 58  WEGHQ----KRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +G         +         G+         + T+ AR
Sbjct: 203 GDGVALLNHDYSKYKITNRNFTGHRKTDPG-KPSPTILAR 241


>gi|319639604|ref|ZP_07994351.1| cytosine-specific methyltransferase [Neisseria mucosa C102]
 gi|317399175|gb|EFV79849.1| cytosine-specific methyltransferase [Neisseria mucosa C102]
          Length = 348

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 35/89 (39%), Gaps = 4/89 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL-GIKPRLGDILEEHIDDKSTISNKL-W 58
           + A D+GVPQ R+R + + F N ++ F+FP         +   + +  D           
Sbjct: 155 LMASDYGVPQNRKRAFFVGFKNGTI-FEFPKQTVNQYVTVKQAISDLPDYSVDDGAAYPL 213

Query: 59  EGHQKRKENNKIAGKG-FGYGLFFENSAT 86
            G  + +   +    G F + +   N  T
Sbjct: 214 LGSSEYQHMMRQNSTGLFNHQITQHNDKT 242


>gi|288559285|ref|YP_003422771.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1]
 gi|288541995|gb|ADC45879.1| DNA-cytosine methyltransferase [Methanobrevibacter ruminantium M1]
          Length = 342

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 29/75 (38%), Gaps = 2/75 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A + GVPQ+R+R+  I      VEF  P P   K  + + L    D      ++    
Sbjct: 152 LDASEHGVPQKRKRVIFIGSRIGDVEF--PKPKDKKVSVMEALGNIPDTNFEYYDEPTNS 209

Query: 61  HQKRKENNKIAGKGF 75
            Q+   + +      
Sbjct: 210 FQELMADGEKKIYNH 224


>gi|238793797|ref|ZP_04637418.1| Cytosine-specific methyltransferase [Yersinia intermedia ATCC
           29909]
 gi|238726861|gb|EEQ18394.1| Cytosine-specific methyltransferase [Yersinia intermedia ATCC
           29909]
          Length = 365

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 34/91 (37%), Gaps = 5/91 (5%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
            + +FGVPQ RER++I+  L+ +  FK   P+ I  +         +D      KL E  
Sbjct: 213 NSANFGVPQTRERVFIVGTLHGNPLFK--EPVDILHKNE---WLTCNDAIHDLEKLDEDR 267

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                 +K                 + T+ A
Sbjct: 268 TFNHIWSKAKKSPDQGSRRLTKDKPSQTIRA 298


>gi|319744643|gb|EFV96990.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           agalactiae ATCC 13813]
          Length = 451

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP      P   + L      K  ++ ++  
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRRENSPAHLERLGNINPSKRGLNGEV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 206 YLTSGLAPTLTRGKGEGAKIAIP 228


>gi|210621902|ref|ZP_03292899.1| hypothetical protein CLOHIR_00844 [Clostridium hiranonis DSM 13275]
 gi|210154533|gb|EEA85539.1| hypothetical protein CLOHIR_00844 [Clostridium hiranonis DSM 13275]
          Length = 438

 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL 33
           + A D+GVPQRR R+  I +     + ++P P 
Sbjct: 181 LNAADYGVPQRRNRIIFIGYKKGLKQPQYPEPT 213


>gi|113474395|ref|YP_720456.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101]
 gi|110165443|gb|ABG49983.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101]
          Length = 421

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/93 (16%), Positives = 36/93 (38%), Gaps = 6/93 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFP-----TPLGIKPRLGDILEEHIDDKSTISN 55
           + A ++GVPQ RERL+I+          +P             + D + +  + ++    
Sbjct: 155 LNAANYGVPQHRERLFILGCKKGLKLPNYPQIQIHKKSEAYINVWDAIGDLPEVENYPEL 214

Query: 56  KLWEGHQKRKENNKIAGKGFG-YGLFFENSATT 87
              +  +   + +K +       G+ + N+  +
Sbjct: 215 LEIDWVKAENDYDKPSEYAKKLRGIEYFNNDYS 247


>gi|331085742|ref|ZP_08334825.1| hypothetical protein HMPREF0987_01128 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406665|gb|EGG86170.1| hypothetical protein HMPREF0987_01128 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 425

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/98 (19%), Positives = 33/98 (33%), Gaps = 4/98 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD-ILEEHIDDKSTISNKLWE 59
           + + D+GVPQ RER++II  L      +  +  G      + I+      +   S  +  
Sbjct: 151 LNSKDYGVPQNRERVFIIANLRSRGRREILSLRGKNKAALNQIIGGMQGYRVYDSQGVST 210

Query: 60  GHQKRKENNKIAGKGFG--YGLFFEN-SATTNTLSARY 94
                          +           + T   L+ARY
Sbjct: 211 TLIGNAGGMGAKTGLYFIDQSKVAPKITDTARCLTARY 248


>gi|269978372|gb|ACZ55920.1| putative type I restriction-modification system specificity subunit
           S [Helicobacter pylori]
          Length = 263

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 33/98 (33%), Gaps = 13/98 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG------------IKPRLGDILEEHID 48
           +KA D+GVPQ RER+ II          FP                    + D++    +
Sbjct: 152 LKASDYGVPQHRERVIIIGNRLGLKN-PFPKKTHGLCNDLFNEKLKPYVCVKDVVGHLAN 210

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSAT 86
            ++  ++ + +G        +       +G     +  
Sbjct: 211 IRTRDASFMLDGVMIHNHVARTNVYDTFWGRKHPINQH 248


>gi|252957|gb|AAA09969.1| methyltransferase [Herpetosiphon aurantiacus]
          Length = 437

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + + D+GV Q R+R++II         +F FP     + RL DIL+          +
Sbjct: 146 LNSFDYGVAQNRDRVFIIGIQQKLGVPDFSFPEYSESEQRLYDILDNLQTPSIIPES 202


>gi|323178455|gb|EFZ64033.1| modification methylase NgoMIV [Escherichia coli 1180]
          Length = 377

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 39/98 (39%), Gaps = 22/98 (22%)

Query: 2   KACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+GVPQ R R+ ++      S  F++P+   I P +GD L +       +S   WEG
Sbjct: 154 NASDYGVPQLRPRVLLVALRGKYSAHFRWPSETLIPPTVGDALFDL------MSQGGWEG 207

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
            +  ++                 +    TL    +K G
Sbjct: 208 AEAWRKAA---------------NNIAPTLVGGSHKHG 230


>gi|260866454|ref|YP_003232856.1| putative DNA modification methylase [Escherichia coli O111:H- str.
           11128]
 gi|257762810|dbj|BAI34305.1| predicted DNA modification methylase [Escherichia coli O111:H- str.
           11128]
          Length = 356

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 39/98 (39%), Gaps = 22/98 (22%)

Query: 2   KACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+GVPQ R R+ ++      S  F++P+   I P +GD L +       +S   WEG
Sbjct: 154 NASDYGVPQLRPRVLLVALRGKYSAHFRWPSETLIPPTVGDALFDL------MSQGGWEG 207

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
            +  ++                 +    TL    +K G
Sbjct: 208 AEAWRKAA---------------NNIAPTLVGGSHKHG 230


>gi|149373126|ref|ZP_01892014.1| DcmB [unidentified eubacterium SCB49]
 gi|149354274|gb|EDM42843.1| DcmB [unidentified eubacterium SCB49]
          Length = 349

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHID 48
           + A D+ VPQ R+R++ I      + +++FPT    K  L D++ +  +
Sbjct: 145 LNASDYNVPQDRKRVFFIGIRKDLNFKYQFPTETFPKIPLEDVISDLQE 193


>gi|52788777|gb|AAU87368.1| MnlI m5C-methyltransferase [Moraxella nonliquefaciens]
          Length = 351

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK 28
           + A D+GVPQ RER++II   N   +F 
Sbjct: 150 LNAKDYGVPQSRERIFIIATKNQPFDFD 177


>gi|23428398|gb|AAL15430.1| DNA methyltransferase A [Moraxella nonliquefaciens]
          Length = 351

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK 28
           + A D+GVPQ RER++II   N   +F 
Sbjct: 150 LNAKDYGVPQSRERIFIIATKNQPFDFD 177


>gi|152994008|ref|YP_001359729.1| cytosine-specific methyltransferase [Sulfurovum sp. NBC37-1]
 gi|151425869|dbj|BAF73372.1| cytosine-specific methyltransferase [Sulfurovum sp. NBC37-1]
          Length = 362

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 34/87 (39%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKP-RLGDILEEHIDDKSTISNKL 57
           + A DFGVPQ R R +II        ++F F +        +G+ L++    K+    K 
Sbjct: 150 LNAADFGVPQYRNRFFIIGHRKEKGGIKFDFDSLEKKPKVTVGEALKDLPSLKNGDKIKE 209

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
               + ++ +  +           +N 
Sbjct: 210 AAYKRVKQVHPYVKLIRRTSKKALQNH 236


>gi|317506927|ref|ZP_07964699.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC
           BAA-974]
 gi|316254855|gb|EFV14153.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC
           BAA-974]
          Length = 399

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 5/56 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
            A D+GVPQRR R++I+ F +     + FP P       G+ L     +       
Sbjct: 182 DAADYGVPQRRHRVFIVGFRSDVRAGWAFPAPTHS----GEALRRAQAEGDYFDRH 233


>gi|257464589|ref|ZP_05628960.1| putative 5-methylcytosine methyltransferase [Actinobacillus minor
           202]
 gi|257450249|gb|EEV24292.1| putative 5-methylcytosine methyltransferase [Actinobacillus minor
           202]
          Length = 331

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 29/87 (33%), Gaps = 2/87 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-IKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFGVPQ R R+  I       +  FP P       +G+ +       S  ++ +  
Sbjct: 153 LNAADFGVPQLRSRIVFIG-RKDKGKILFPEPSHREYKTVGEAIGHFPPLNSGENSLIVN 211

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSAT 86
               R  +  +    F       N   
Sbjct: 212 HEAMRHSDQMLEKMSFVKNGGNRNDIP 238


>gi|312874669|ref|ZP_07734692.1| modification methylase HaeIII [Lactobacillus iners LEAF 2053A-b]
 gi|311089796|gb|EFQ48217.1| modification methylase HaeIII [Lactobacillus iners LEAF 2053A-b]
          Length = 331

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+GVPQ R+R++ + F    ++ F   P P   K    D + +  D+      K
Sbjct: 142 LNASDYGVPQDRKRVFYVGFRKDLNINFDIPPKPYDYKLIFRDAIYDLKDNAIPALEK 199


>gi|308182632|ref|YP_003926759.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori PeCan4]
 gi|308064817|gb|ADO06709.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori PeCan4]
          Length = 351

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 1/64 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ RER+ ++  L     +F F  P+     L D L +    +S  +     
Sbjct: 145 LNALDYGVPQIRERVILVGALKSFKQKFHFHKPIKTHFSLKDALGDLPPIQSGENGDALG 204

Query: 60  GHQK 63
             + 
Sbjct: 205 YLKN 208


>gi|127435|sp|P25264|MTC2_HERAU RecName: Full=Modification methylase HgiCII; Short=M.HgiCII;
           AltName: Full=Cytosine-specific methyltransferase HgiCII
 gi|43464|emb|CAA38935.1| methyltransferase [Herpetosiphon aurantiacus]
          Length = 437

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + + D+GV Q R+R++II         +F FP     + RL DIL+          +
Sbjct: 146 LNSFDYGVAQNRDRVFIIGIQQKLGVPDFSFPEYSESEQRLYDILDNLQTPSIIPES 202


>gi|328553026|gb|AEB23518.1| SP-beta prophage DNA (cytosine-5-)-methyltransferase [Bacillus
           amyloliquefaciens TA208]
          Length = 503

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 40/109 (36%), Gaps = 30/109 (27%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RER+YII                                   S  FK+ 
Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWIVEKGRNDVLSKGKKRLKELNIKSFNFKWS 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGL 79
               +  RL +ILEE++D+K  +S +      ++ E  K     F  G+
Sbjct: 209 AQDIVGKRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEKDVVFVGGI 257


>gi|326566077|gb|EGE16234.1| DNA-cytosine methyltransferase [Moraxella catarrhalis BC1]
          Length = 354

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/105 (17%), Positives = 36/105 (34%), Gaps = 13/105 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW- 58
           + A  +GV Q R R+ I+        + K+P PL  +       ++ +       + LW 
Sbjct: 179 LNASHYGVAQNRVRVIIVGIRKDIDKKMKYPKPLFGELSDS---KKPVITSKQAIDDLWG 235

Query: 59  ---EGHQKRKENNKIAGKGFGYGLFFEN-----SATTNTLSARYY 95
              +      +N+    K +       N          T+ A ++
Sbjct: 236 LLDDNINSHSKNHYSKAKFYPNKKLQGNCQINADKPAPTIRAEHH 280


>gi|325294602|ref|YP_004281116.1| DNA-cytosine methyltransferase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065050|gb|ADY73057.1| DNA-cytosine methyltransferase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 342

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/100 (20%), Positives = 40/100 (40%), Gaps = 8/100 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHID------DKSTI 53
           +   D+ VPQ R+R++II F     + + FP P   K  L D + +  D      +K+  
Sbjct: 143 IDTYDYLVPQNRKRVFIIGFRKDLQISYSFPKPFDRKKTLRDAIYDLKDNVVEPLEKNRH 202

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           + K+   + +    +  +            +  + T+ A 
Sbjct: 203 NPKVIVPNHEYYIGSFSSIY-MSRNRVRSWNEPSFTIQAS 241


>gi|157961098|ref|YP_001501132.1| DNA-cytosine methyltransferase [Shewanella pealeana ATCC 700345]
 gi|157846098|gb|ABV86597.1| DNA-cytosine methyltransferase [Shewanella pealeana ATCC 700345]
          Length = 406

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42
            A  +GVPQ RER++I+   +    FK P+P     +   +
Sbjct: 162 NASSYGVPQHRERVFIVANRDG-GTFKMPSPTHSDSKDPTL 201


>gi|1399076|gb|AAB03209.1| NgoII cytosine methylase M.NgoII [Neisseria gonorrhoeae]
          Length = 341

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 34/86 (39%), Gaps = 11/86 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPT----PLGIKPRLGDILEEHIDDKSTISNK 56
            A D+GV Q R+R++ I F     ++F FP         K  L D++ +  D     +  
Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVEDKDKITLKDVIWDLQDTAVPSAP- 214

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE 82
                Q + + + +    +  G F  
Sbjct: 215 -----QNKTKPDAVNNNEYFTGSFSP 235


>gi|121582558|ref|YP_974087.1| DNA-cytosine methyltransferase [Acidovorax sp. JS42]
 gi|120608614|gb|ABM44352.1| DNA-cytosine methyltransferase [Acidovorax sp. JS42]
          Length = 318

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 23/59 (38%), Gaps = 2/59 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV-EFKFPTP-LGIKPRLGDILEEHIDDKSTISNKLW 58
            A D+GV Q R R+  +         F +P P     P +G++L + +          W
Sbjct: 146 NASDYGVSQLRPRVVFVGIRKDLASGFSWPEPLPNNPPTVGELLHDLMAANGWRGADRW 204


>gi|254450593|ref|ZP_05064030.1| modification methylase FnuDI [Octadecabacter antarcticus 238]
 gi|198264999|gb|EDY89269.1| modification methylase FnuDI [Octadecabacter antarcticus 238]
          Length = 365

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 37/101 (36%), Gaps = 10/101 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG---IKPRLGDILEEHIDDKSTISNK 56
           + + D+GVPQRR+RL++I         F FPT         +   +L      +      
Sbjct: 144 INSQDYGVPQRRKRLFVIGVRRDLGGYFHFPTETHCKLEDVKKTGLLPHTSHGEVIKHLP 203

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFEN-----SATTNTLSA 92
            W   +  +  +   G  F +     N     +  + T+ A
Sbjct: 204 KWPSGEFYERPHDPEG-HFSWYYMSRNRKAEWNRPSYTVVA 243


>gi|332366902|gb|EGJ44643.1| modification methylase BepI [Streptococcus sanguinis SK1059]
          Length = 197

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 40/102 (39%), Gaps = 9/102 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLG--IKPRLGDILEEHID--DKSTI 53
           + A D+GVPQ R R+ I+   N    + +  +P P          D LE+  +  + + I
Sbjct: 16  LDAADYGVPQSRRRVIIVGIRNDIGDNEKIYYPEPTHVGNPRTAFDALEDIWELFNTNQI 75

Query: 54  SNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
           +N         K       +     +    +A  +T+ A ++
Sbjct: 76  ANHNRNSVSHAKFYGDDIKRQGNNQI--PKNAPASTIRAEHH 115


>gi|188533112|ref|YP_001906909.1| C-5 cytosine-specific DNA methylase family protein [Erwinia
           tasmaniensis Et1/99]
 gi|188028154|emb|CAO96012.1| C-5 cytosine-specific DNA methylase family protein [Erwinia
           tasmaniensis Et1/99]
          Length = 395

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 27/90 (30%), Gaps = 2/90 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R R++I+   +     E  +P                 +     +  + 
Sbjct: 167 LNAKDYGVPQNRNRVFILGLRDDISISEGDWPPLPTHFKDKKPYWVNASEVFEKPTPSII 226

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTN 88
           E        +      F   L    S   N
Sbjct: 227 EKITAILGQDVAQKLKFKNTLKENKSDQNN 256


>gi|328912201|gb|AEB63797.1| Modification methylase Rho11sI [Bacillus amyloliquefaciens LL3]
          Length = 503

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 40/109 (36%), Gaps = 30/109 (27%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RER+YII                                   S  FK+ 
Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWVLEKGRNDVLSKGKKRLKELNIKSFNFKWS 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGL 79
               +  RL +ILEE++D+K  +S +      ++ E  K     F  G+
Sbjct: 209 AQDIVGQRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEKDVVFVGGI 257


>gi|310815203|ref|YP_003963167.1| modification methylase XorII [Ketogulonicigenium vulgare Y25]
 gi|308753938|gb|ADO41867.1| modification methylase XorII [Ketogulonicigenium vulgare Y25]
          Length = 437

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 27/65 (41%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ R+RL ++          +P  +  +P   D L +  + +     +  + 
Sbjct: 155 LNAADYGVPQDRQRLILMGAKKGRSLPDYPKAIAERPTCQDALADLPNAEEFERLRNSDS 214

Query: 61  HQKRK 65
            +   
Sbjct: 215 IKTAA 219


>gi|154508844|ref|ZP_02044486.1| hypothetical protein ACTODO_01354 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798478|gb|EDN80898.1| hypothetical protein ACTODO_01354 [Actinomyces odontolyticus ATCC
           17982]
          Length = 355

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 35/101 (34%), Gaps = 8/101 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEF--KFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R R++ +  +     +  +    + I    GD L +        +N   
Sbjct: 157 LNAADYGVPQLRRRMFFVGMIGMHASYAERLKEMVMIPIACGDALRKMPKFGQVGNNDCG 216

Query: 59  EGHQKRKENNKIAGKGF------GYGLFFENSATTNTLSAR 93
                  +N  +    +      G+G     S    T+ A 
Sbjct: 217 NAQIVPAKNPVLRKSPYSGMLFNGHGRVINLSEPAPTIVAS 257


>gi|118577457|ref|YP_899696.1| DNA-cytosine methyltransferase [Pelobacter propionicus DSM 2379]
 gi|118504962|gb|ABL01443.1| DNA-cytosine methyltransferase [Pelobacter propionicus DSM 2379]
          Length = 313

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32
           A D+GVPQ RER++I+       +F  P P
Sbjct: 162 AADYGVPQTRERVFIVGTRPDVQKFIPPKP 191


>gi|319897026|ref|YP_004135221.1| modification methylase haeiii [Haemophilus influenzae F3031]
 gi|317432530|emb|CBY80890.1| Modification methylase HaeIII [Haemophilus influenzae F3031]
          Length = 330

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 31/87 (35%), Gaps = 16/87 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GV Q R+R++ I F    ++ +  P P  IKP   D++ +              
Sbjct: 142 LNANDYGVAQDRKRVFYIGFRKELNINYLPPIPHLIKPTFKDVIWD-------------- 187

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSAT 86
             +          K  G    + N   
Sbjct: 188 -LKDNPIPALDKNKTNGNKCIYPNHEY 213


>gi|319776343|ref|YP_004138831.1| Modification methylase HaeIII [Haemophilus influenzae F3047]
 gi|127460|sp|P20589|MTH3_HAEAE RecName: Full=Modification methylase HaeIII; Short=M.HaeIII;
           AltName: Full=Cytosine-specific methyltransferase HaeIII
 gi|148915|gb|AAA24970.1| methyltransferase [Haemophilus aegyptius]
 gi|2961233|gb|AAC05696.1| HaeIII DNA modification methyltransferase [Haemophilus influenzae
           biotype aegyptius]
 gi|317450934|emb|CBY87160.1| Modification methylase HaeIII [Haemophilus influenzae F3047]
          Length = 330

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 31/87 (35%), Gaps = 16/87 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GV Q R+R++ I F    ++ +  P P  IKP   D++ +              
Sbjct: 142 LNANDYGVAQDRKRVFYIGFRKELNINYLPPIPHLIKPTFKDVIWD-------------- 187

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSAT 86
             +          K  G    + N   
Sbjct: 188 -LKDNPIPALDKNKTNGNKCIYPNHEY 213


>gi|901818|gb|AAA69959.1| 5C-DNA methyltransferase [Bacillus phage H2]
          Length = 503

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 39/109 (35%), Gaps = 30/109 (27%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS------------------------------VEFKFP 30
           + +  F VPQ RER+YII                                      FK+ 
Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWIVEKGRYDVLSKGKKRLKELNIKSFNFKWS 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGL 79
               +  RL +ILEE++D+K  +S +      ++ E  K     F  G+
Sbjct: 209 AQDIVGKRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEKDVVFVGGI 257


>gi|239625877|ref|ZP_04668908.1| methyltransferase [Clostridiales bacterium 1_7_47_FAA]
 gi|239520107|gb|EEQ59973.1| methyltransferase [Clostridiales bacterium 1_7_47FAA]
          Length = 338

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 34/106 (32%), Gaps = 15/106 (14%)

Query: 2   KACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIK-PRLGDILEEHIDDKSTISNKLWE 59
            +  + VPQ R+R  ++      ++ F FP       P+L D LE+ + +K  + ++  +
Sbjct: 182 NSKYWNVPQNRDRYAVVGTRNKKNLTFTFPKEQHEFVPKLSDYLEKDVPEKYYLPDEKAQ 241

Query: 60  GHQ-------------KRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                                     K               TL+A
Sbjct: 242 TIIAQALEKLEGLGKCHACITPDRINKRQNGPRAKAEDEPMFTLTA 287


>gi|223933016|ref|ZP_03625010.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591]
 gi|223898333|gb|EEF64700.1| DNA-cytosine methyltransferase [Streptococcus suis 89/1591]
          Length = 451

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP      P   + L      K  ++ ++  
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRPRFLFPLRGENSPAHLERLGNINPSKRGLNGEV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 206 YLTSGLAPTLTRGKGEGAKIAIP 228


>gi|225858823|ref|YP_002740333.1| methyl transferase [Streptococcus pneumoniae 70585]
 gi|225720620|gb|ACO16474.1| methyl transferase [Streptococcus pneumoniae 70585]
          Length = 451

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP      P   + L      K  ++ ++  
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFLFPLRRENSPAHLERLGNINPSKRGLNGEV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 206 YLTTGLAPTLTRGKGEGAKIAIP 228


>gi|183217290|gb|ACC59209.1| methyltransferase [Streptococcus pneumoniae]
 gi|321156848|emb|CBW38835.1| putative DNA methylase [Streptococcus pneumoniae]
          Length = 452

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 33/83 (39%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP---TPLGIKPRLGDILEEHIDDKSTISNK 56
           + + DFGVPQ RER++II           FP         P    IL      KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQATNPETLKILGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKIAI 230


>gi|291525029|emb|CBK90616.1| DNA-methyltransferase (dcm) [Eubacterium rectale DSM 17629]
          Length = 337

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 34/106 (32%), Gaps = 15/106 (14%)

Query: 2   KACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIK-PRLGDILEEHIDDKSTISNKLWE 59
            +  + VPQ R+R  ++      ++ F FP       P+L D LE+ + +K  + ++  +
Sbjct: 182 NSKYWNVPQNRDRYAVVGTRNKKNLTFTFPKEQHEFVPKLSDYLEKDVPEKYYLPDEKAQ 241

Query: 60  GHQ-------------KRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                                     K               TL+A
Sbjct: 242 TIIAQALEKLEGLGKCHACITPDRINKRQNGPRAKAEDEPMFTLTA 287


>gi|1127162|pdb|1DCT|A Chain A, Dna (Cytosine-5) Methylase From Haeiii Covalently Bound To
           Dna
 gi|1127163|pdb|1DCT|B Chain B, Dna (Cytosine-5) Methylase From Haeiii Covalently Bound To
           Dna
          Length = 324

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 31/87 (35%), Gaps = 16/87 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GV Q R+R++ I F    ++ +  P P  IKP   D++ +              
Sbjct: 142 LNANDYGVAQDRKRVFYIGFRKELNINYLPPIPHLIKPTFKDVIWD-------------- 187

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSAT 86
             +          K  G    + N   
Sbjct: 188 -LKDNPIPALDKNKTNGNKCIYPNHEY 213


>gi|1171045|sp|P09915|MTBR_BPRH1 RecName: Full=Modification methylase Rho11sI; Short=M.Rho11sI;
           AltName: Full=Bsu P11s; AltName: Full=Cytosine-specific
           methyltransferase Rho11sI
 gi|579194|emb|CAA28869.1| unnamed protein product [Bacillus phage rho11s]
          Length = 503

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 40/109 (36%), Gaps = 30/109 (27%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RER+YII                                   S  FK+ 
Sbjct: 149 LNSKFFNVPQNRERIYIIGVREDLIENDEWVVEKGRNDVLSKGKKRLKELNIKSFNFKWS 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGL 79
               +  RL +ILEE++D+K  +S +      ++ E  K     F  G+
Sbjct: 209 AQDIVGRRLREILEEYVDEKYYLSEEKTSKLIEQIEKPKEKDVVFVGGI 257


>gi|317011319|gb|ADU85066.1| type II DNA modification enzyme [Helicobacter pylori SouthAfrica7]
          Length = 321

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHSFHFPLGLANDYCFKDFLDA---DNECYLDVSNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 202 TFQRYLHNPYNHNRVFLEDILTLENAVLDT 231


>gi|312386601|emb|CBY05924.1| putative DNA methylase [Streptococcus pneumoniae]
          Length = 452

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGD---ILEEHIDDKSTISNK 56
           + + DFGVPQ RER++II           FP     +    +   IL      KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQATNSETLKILGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKVAI 230


>gi|238923038|ref|YP_002936551.1| DcmB [Eubacterium rectale ATCC 33656]
 gi|238874710|gb|ACR74417.1| DcmB [Eubacterium rectale ATCC 33656]
          Length = 672

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 31/83 (37%), Gaps = 12/83 (14%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+GV + R+R++ I F    +++F FP     +           D K T+ + +W+ 
Sbjct: 149 NAKDYGVAEERKRVFYIGFRKDLNIDFGFPKGSTKE----------DDKKITLRDIIWD- 197

Query: 61  HQKRKENNKIAGKGFGYGLFFEN 83
            Q     +          +    
Sbjct: 198 LQDTAVPSGEKNHHNPEAINNNE 220


>gi|120537007|ref|YP_957065.1| C-5 cytosine-specific DNA methylase [Marinobacter aquaeolei VT8]
 gi|120326841|gb|ABM21150.1| C-5 cytosine-specific DNA methylase [Marinobacter aquaeolei VT8]
          Length = 467

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/102 (18%), Positives = 39/102 (38%), Gaps = 8/102 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRL---GDILEEHIDDKSTIS 54
           +  CDFG  + R+R  +I       +   F       ++ +     D+LE   +D    +
Sbjct: 276 LNGCDFGALENRDRAVVIAMSRDLAKAGMFNLADIKPLRVKEEKLADVLEPISEDDDRWT 335

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
                  +++   +   G GF   L+    +  NT++  Y +
Sbjct: 336 IHT--YLEEKALRDAKKGSGFQRQLYTGEESYINTVTRGYAR 375


>gi|167751358|ref|ZP_02423485.1| hypothetical protein EUBSIR_02344 [Eubacterium siraeum DSM 15702]
 gi|167655604|gb|EDR99733.1| hypothetical protein EUBSIR_02344 [Eubacterium siraeum DSM 15702]
          Length = 316

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 39/97 (40%), Gaps = 6/97 (6%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            ACD+G+PQ R R YI+ F +      F+FP    ++  L D++++ +  K         
Sbjct: 144 DACDYGIPQHRTRTYIVAFKSQKACDSFRFPEKCELQKHLFDVIDKTVKGKDRYYVSEGS 203

Query: 60  GHQKR---KENNKIAGKGFG-YGLFFENSATTNTLSA 92
               R      +      F  YG+       + TL A
Sbjct: 204 YEHNRLSAAITDDKQIYRFSDYGIQASKDGISFTLKA 240


>gi|330891417|gb|EGH24078.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 201

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPL-GIKPRLGDILEEHID 48
           + A DFGV Q R R+  +       E F +P P   I P +G++L + + 
Sbjct: 152 LNASDFGVTQLRPRVVFVGIRKDLAEGFSWPEPKLIIPPTVGELLHDLMK 201


>gi|67458529|ref|YP_246153.1| site-specific DNA methylase [Rickettsia felis URRWXCal2]
 gi|67004062|gb|AAY60988.1| Site-specific DNA methylase [Rickettsia felis URRWXCal2]
          Length = 171

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 41/103 (39%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-----SVEFKFPTPLGIKPRLGDILEEHIDDKSTIS- 54
           + A  FGVPQ RER+Y +           +++  P     +  LGDILE+ +D    I+ 
Sbjct: 2   LNASLFGVPQARERVYFVCLRKDFSSEYILKYVKPKESYERIFLGDILEKEVDKSLYINR 61

Query: 55  -----NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                +K     Q +        KG      +     + TLSA
Sbjct: 62  DDIVLDKTPVEKQLKPIRIGQVNKGGQGERIYSPFGHSITLSA 104


>gi|4063721|gb|AAC98421.1| methyl transferase [Streptococcus pneumoniae]
          Length = 452

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 33/83 (39%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP---TPLGIKPRLGDILEEHIDDKSTISNK 56
           + + DFGVPQ RER++II           FP         P    IL      KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLGFPFRREGQATNPETLKILGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKIAI 230


>gi|188527903|ref|YP_001910590.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Shi470]
 gi|188144143|gb|ACD48560.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori Shi470]
 gi|308063905|gb|ADO05792.1| type II DNA modification enzyme [Helicobacter pylori Sat464]
          Length = 320

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 147 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANNYCFKDFLDA---DNECYLDINNA 203

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 204 AFQRYLRNPYNHNRVFLENILTLENAVLDT 233


>gi|228478395|ref|ZP_04063003.1| modification methylase HaeIII [Streptococcus salivarius SK126]
 gi|228250074|gb|EEK09344.1| modification methylase HaeIII [Streptococcus salivarius SK126]
          Length = 387

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 29/101 (28%), Gaps = 11/101 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIK--------PRLGDILEEHIDD 49
           + A DFGVPQ RER+++I          E+ FP    +              IL  +   
Sbjct: 169 INAKDFGVPQNRERVFLIGVRKDLKIKSEWIFPEETSLNNEITLRDAISDLPILGNNEQK 228

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            + I     E     + N                      L
Sbjct: 229 YNYICEPKTEYQALLRGNQTDLLNHVSRNHGERLQKIMRAL 269


>gi|319639602|ref|ZP_07994349.1| cytosine-specific methyltransferase [Neisseria mucosa C102]
 gi|317399173|gb|EFV79847.1| cytosine-specific methyltransferase [Neisseria mucosa C102]
          Length = 327

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 38/101 (37%), Gaps = 5/101 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW- 58
           + A +FG+PQ+RER++++       + + FP     +            +K   +  +  
Sbjct: 157 LLAANFGIPQKRERVFMVGVRKDIQKHYTFPMETHAEQPNLYQKPFVKLEKIITTLAIDN 216

Query: 59  -EGHQKRKENNKIAG--KGFGYGLFFENSATTNTLSARYYK 96
            + +   K    +         GL+ +      T++A   K
Sbjct: 217 PKYYFSEKAVLGMKNAKNNMKRGLYQDLQGQCLTITAHLAK 257


>gi|209809294|ref|YP_002264832.1| putative C-5 cytosine-specific DNA methylase [Aliivibrio
           salmonicida LFI1238]
 gi|208010856|emb|CAQ81257.1| putative C-5 cytosine-specific DNA methylase [Aliivibrio
           salmonicida LFI1238]
          Length = 387

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 38/102 (37%), Gaps = 15/102 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLG--------DILEEHIDD 49
           + A DFGVPQ R+R++I         +V F  P      P  G          + E + +
Sbjct: 160 LNAKDFGVPQNRKRVFIHGVRKDIKSTVSFP-PEATHFSPTSGLAPCWKTASTVFEPVPE 218

Query: 50  KS---TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTN 88
           K     +     +  +  +E    + +   +G+  + +   N
Sbjct: 219 KYLNRFVKEYFLKKTKLTEEQALDSLRKLEFGIDVDKNDPCN 260


>gi|127417|sp|P25262|MTB1_HERAU RecName: Full=Modification methylase HgiBI; Short=M.HgiBI; AltName:
           Full=Cytosine-specific methyltransferase HgiBI
 gi|43478|emb|CAA38927.1| methyltransferase [Herpetosiphon aurantiacus]
          Length = 437

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEE 45
           + + DFGV Q R+R++I+          F FP     + RL  IL+ 
Sbjct: 146 LNSFDFGVAQNRDRVFIVGIQQKLDLNGFSFPEYTESEQRLYHILDN 192


>gi|289167633|ref|YP_003445902.1| methyl transferase [Streptococcus mitis B6]
 gi|288907200|emb|CBJ22035.1| methyl transferase [Streptococcus mitis B6]
          Length = 452

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGD---ILEEHIDDKSTISNK 56
           + + DFGVPQ RER++II           FP     +    +   IL      KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQATNSETLKILGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKVAI 230


>gi|308062397|gb|ADO04285.1| type II DNA modification enzyme [Helicobacter pylori Cuz20]
          Length = 318

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDA---DNECYLDTNNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 202 AFQRYLHNPYNHNRVFLENILTLENAVLDT 231


>gi|293371778|ref|ZP_06618188.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f]
 gi|292633230|gb|EFF51801.1| DNA (cytosine-5-)-methyltransferase [Bacteroides ovatus SD CMC 3f]
          Length = 337

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 31/88 (35%), Gaps = 17/88 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+ VP+ R+R++ I F        F++PTP   KP L + + +             
Sbjct: 144 LNANDYDVPEDRDRVFYIGFRKDLNIHNFEYPTPQKHKPTLRESIWD------------- 190

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSAT 86
              Q          K  G      N+  
Sbjct: 191 --LQFTAIPALEKNKTNGKACKIPNNEY 216


>gi|329123495|ref|ZP_08252059.1| modification methylase HaeIII [Haemophilus aegyptius ATCC 11116]
 gi|327471077|gb|EGF16532.1| modification methylase HaeIII [Haemophilus aegyptius ATCC 11116]
          Length = 217

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 31/87 (35%), Gaps = 16/87 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GV Q R+R++ I F    ++ +  P P  IKP   D++ +              
Sbjct: 29  LNANDYGVAQDRKRVFYIGFRKELNINYLPPIPHLIKPTFKDVIWD-------------- 74

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSAT 86
             +          K  G    + N   
Sbjct: 75  -LKDNPIPALDKNKTNGNKCIYPNHEY 100


>gi|317177871|dbj|BAJ55660.1| Type II DNA modification enzyme [Helicobacter pylori F16]
          Length = 319

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHSFNFPLGLANDYCFKDFLDA---DNECYLDTNNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 202 AFQRYLHNPYNHNRVFLENILTLENAVLDT 231


>gi|254825117|ref|ZP_05230118.1| DNA-cytosine methyltransferase [Listeria monocytogenes FSL J1-194]
 gi|293594360|gb|EFG02121.1| DNA-cytosine methyltransferase [Listeria monocytogenes FSL J1-194]
          Length = 326

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 37/94 (39%), Gaps = 4/94 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           +   DFG+PQ+RER+Y +  L+   +F F        R   + LE  +DD    + K+  
Sbjct: 149 LNPMDFGIPQKRERIYTVSVLSGP-QFDFSKLKKEPMRPINEFLETDVDD--IYTIKIPS 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
              K ++ N                    T+S R
Sbjct: 206 MLTKIEDLNMQRKNAKYNRFLDVIETHCWTISTR 239


>gi|30523050|gb|AAP31838.1| AsiSI methylase [Arthrobacter sp. S]
          Length = 390

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 7/60 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ R+RL +I       EF F P P       G +         T S+ LW+
Sbjct: 154 LNAADWGVPQARKRLILIAVR-DVAEFSFPPKPTHSGDPSGSL-----RPYRTASDALWD 207


>gi|157419765|gb|ABV55454.1| DNA methylase [Streptococcus dysgalactiae subsp. equisimilis]
          Length = 451

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 21/52 (40%), Gaps = 1/52 (1%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + + DF VPQ RER++II         F FP      P   + L      K 
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRREDSPAHLERLGNINPSKH 199


>gi|257466254|ref|ZP_05630565.1| DNA (cytosine-5-)-methyltransferase [Fusobacterium gonidiaformans
           ATCC 25563]
          Length = 353

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 33/84 (39%), Gaps = 3/84 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---GIKPRLGDILEEHIDDKSTISNKL 57
           + A ++GVPQ R+R + +  LN    F FP P+          D + +    +    +++
Sbjct: 154 LYAPEYGVPQIRKRAFFVGLLNSKEGFTFPEPILSSENFVTCEDAIGDLPSLEGIYGDEI 213

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF 81
            E     +   +   +     L+ 
Sbjct: 214 QEYECSPQTKYQAEMRKNSTKLYN 237


>gi|253755079|ref|YP_003028219.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407]
 gi|251817543|emb|CAZ55290.1| C-5 cytosine-specific DNA methylase [Streptococcus suis BM407]
          Length = 451

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP      P   + L      K  ++ ++  
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRYRSRFIFPLRGENSPAHLERLGNINPSKRGLNGEV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 206 YLTSGLAPTLTRGKGEGAKIAIP 228


>gi|317182374|dbj|BAJ60158.1| Type II DNA modification enzyme [Helicobacter pylori F57]
          Length = 318

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDA---DNECYLDTNNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 202 AFQRYLHNPYNHNRVFLENILTLENAVLDT 231


>gi|1709158|sp|P50192|MTHA_HAEPH RecName: Full=Modification methylase HphIA; Short=M.HphIA; AltName:
           Full=Cytosine-specific methyltransferase HphIA; AltName:
           Full=M.Hphi(C)
 gi|732729|emb|CAA59690.1| site-specific DNA-methyltransferase (cytosine-specific)
           [Haemophilus parahaemolyticus]
          Length = 372

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP-RLGDILEEHID 48
           + A DFGVPQ R R+  I       E  FP P   +   +GD +     
Sbjct: 195 LNAADFGVPQLRSRIVFIG-RKDGGEITFPEPSHTEYNTVGDAIGHFPK 242


>gi|313683546|ref|YP_004061284.1| DNA-cytosine methyltransferase [Sulfuricurvum kujiense DSM 16994]
 gi|313156406|gb|ADR35084.1| DNA-cytosine methyltransferase [Sulfuricurvum kujiense DSM 16994]
          Length = 332

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 1/59 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A DFGVPQ R R+ ++         F +P      P +G+ L + I     +  + W
Sbjct: 154 INAKDFGVPQLRPRVILVGLRKNIFPYFSWPDSYLEAPTVGEALYDLIASDGWVHAEQW 212


>gi|284803522|emb|CBJ23522.1| putative methyltransferase [Streptococcus pneumoniae]
          Length = 372

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 33/83 (39%), Gaps = 4/83 (4%)

Query: 1  MKACDFGVPQRRERLYIIDF-LNPSVEFKFP---TPLGIKPRLGDILEEHIDDKSTISNK 56
          + + DFGVPQ RER++II           FP         P    IL      KS +S K
Sbjct: 2  LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQATNPETLKILGNLNPSKSGMSGK 61

Query: 57 LWEGHQKRKENNKIAGKGFGYGL 79
          ++          +  G+GF   +
Sbjct: 62 VYYSEGLAPTLVRGKGEGFKIAI 84


>gi|310830454|ref|YP_003965555.1| Cytosine-specific methyltransferase [Paenibacillus polymyxa SC2]
 gi|309249921|gb|ADO59487.1| Cytosine-specific methyltransferase [Paenibacillus polymyxa SC2]
          Length = 267

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 37/101 (36%), Gaps = 4/101 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGI--KPRLGDILEEHIDDKSTISNKL 57
           +   D+GVPQ R+R+ ++       + F+FP P+ +  +  + D + +        +N  
Sbjct: 23  LNCWDYGVPQLRKRVIVVGIRKDLDKHFEFPPPVPLEERTTIRDAIGDLPCPDGK-NNHQ 81

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
             G +K +          G             L   Y+  G
Sbjct: 82  GYGIRKDEIPYVDKIPPGGNWRDLPCEDQIQFLGKAYHSGG 122


>gi|315917412|ref|ZP_07913652.1| cytosine specific DNA methyltransferase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|313691287|gb|EFS28122.1| cytosine specific DNA methyltransferase [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 358

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 33/84 (39%), Gaps = 3/84 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---GIKPRLGDILEEHIDDKSTISNKL 57
           + A ++GVPQ R+R + +  LN    F FP P+          D + +    +    +++
Sbjct: 159 LYAPEYGVPQIRKRAFFVGLLNSKEGFTFPEPILSSENFVTCEDAIGDLPSLEGIYGDEI 218

Query: 58  WEGHQKRKENNKIAGKGFGYGLFF 81
            E     +   +   +     L+ 
Sbjct: 219 QEYECSPQTKYQAEMRKNSTKLYN 242


>gi|331002102|ref|ZP_08325621.1| hypothetical protein HMPREF0491_00483 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330411196|gb|EGG90612.1| hypothetical protein HMPREF0491_00483 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 309

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 5/91 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ+RER++++  L  +  F F      KP+  DI E    D S++     E 
Sbjct: 145 LNAMDFGIPQKRERIFVVSILGKN-NFDFNKLNKTKPK--DISEFLEKDVSSVYEVRQES 201

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
             +   N+       G  +         T+S
Sbjct: 202 MLRFLRNDPKNKNFKGRLMII--DKFAYTIS 230


>gi|315587009|gb|ADU41390.1| C-5 cytosine-specific DNA methylase [Helicobacter pylori 35A]
          Length = 313

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 33/90 (36%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   +      +    
Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDAGNE---CYLDTNNA 195

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +   +T
Sbjct: 196 AFQRYLRNQYNHNRVFLENILTLENTVLDT 225


>gi|225856779|ref|YP_002738290.1| methyl transferase [Streptococcus pneumoniae P1031]
 gi|225724445|gb|ACO20297.1| methyl transferase [Streptococcus pneumoniae P1031]
          Length = 452

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 34/83 (40%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNK 56
           + + DFGVPQ RER++II           FP     +    + L+        KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQTTNSETLKTLGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKVAI 230


>gi|59801103|ref|YP_207815.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA 1090]
 gi|121634967|ref|YP_975212.1| DNA modification methylase [Neisseria meningitidis FAM18]
 gi|194098793|ref|YP_002001855.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           NCCP11945]
 gi|239999085|ref|ZP_04719009.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           35/02]
 gi|240014008|ref|ZP_04720921.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           DGI18]
 gi|240016449|ref|ZP_04722989.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA6140]
 gi|240080568|ref|ZP_04725111.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA19]
 gi|240113063|ref|ZP_04727553.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           MS11]
 gi|240115818|ref|ZP_04729880.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID18]
 gi|240118116|ref|ZP_04732178.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID1]
 gi|240121574|ref|ZP_04734536.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID24-1]
 gi|240123666|ref|ZP_04736622.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           PID332]
 gi|240125856|ref|ZP_04738742.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           SK-92-679]
 gi|254493863|ref|ZP_05107034.1| DNA modification methylase [Neisseria gonorrhoeae 1291]
 gi|260440365|ref|ZP_05794181.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           DGI2]
 gi|268594923|ref|ZP_06129090.1| DNA modification methylase [Neisseria gonorrhoeae 35/02]
 gi|268596698|ref|ZP_06130865.1| DNA modification methylase [Neisseria gonorrhoeae FA19]
 gi|268599147|ref|ZP_06133314.1| DNA modification methylase [Neisseria gonorrhoeae MS11]
 gi|268601493|ref|ZP_06135660.1| DNA modification methylase [Neisseria gonorrhoeae PID18]
 gi|268603831|ref|ZP_06137998.1| DNA modification methylase [Neisseria gonorrhoeae PID1]
 gi|268682295|ref|ZP_06149157.1| DNA modification methylase [Neisseria gonorrhoeae PID332]
 gi|268684453|ref|ZP_06151315.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679]
 gi|291043662|ref|ZP_06569378.1| DNA modification methylase [Neisseria gonorrhoeae DGI2]
 gi|293398965|ref|ZP_06643130.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|59717998|gb|AAW89403.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           FA 1090]
 gi|120866673|emb|CAM10425.1| DNA modification methylase [Neisseria meningitidis FAM18]
 gi|193934083|gb|ACF29907.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           NCCP11945]
 gi|226512903|gb|EEH62248.1| DNA modification methylase [Neisseria gonorrhoeae 1291]
 gi|268548312|gb|EEZ43730.1| DNA modification methylase [Neisseria gonorrhoeae 35/02]
 gi|268550486|gb|EEZ45505.1| DNA modification methylase [Neisseria gonorrhoeae FA19]
 gi|268583278|gb|EEZ47954.1| DNA modification methylase [Neisseria gonorrhoeae MS11]
 gi|268585624|gb|EEZ50300.1| DNA modification methylase [Neisseria gonorrhoeae PID18]
 gi|268587962|gb|EEZ52638.1| DNA modification methylase [Neisseria gonorrhoeae PID1]
 gi|268622579|gb|EEZ54979.1| DNA modification methylase [Neisseria gonorrhoeae PID332]
 gi|268624737|gb|EEZ57137.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679]
 gi|291012125|gb|EFE04114.1| DNA modification methylase [Neisseria gonorrhoeae DGI2]
 gi|291610379|gb|EFF39489.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|317164377|gb|ADV07918.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 423

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F       P+L +ILE     + S    KL +
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETSPSPKLKNILESGLPTESSPFIKKLLK 215

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 216 KFPPSELYGKSVKDKRGGK 234


>gi|330936955|gb|EGH41063.1| HsdRM [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 313

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/102 (13%), Positives = 30/102 (29%), Gaps = 24/102 (23%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPL------GIKPRLGDILEEHID---DK 50
           + A +FGV Q R+R++I+       +++ FP              + D + +  +    +
Sbjct: 141 LNAAEFGVAQERKRIFIVGIRKDFGIKYVFPEATHGDEKAHAGVTIHDAIGDMPEWPAGE 200

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                  W                            + T+ A
Sbjct: 201 FYDLPFHWYYLS--------------RDRRNAWDQQSRTIVA 228


>gi|240118874|ref|ZP_04732936.1| DcmB [Neisseria gonorrhoeae PID1]
          Length = 325

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 33/86 (38%), Gaps = 11/86 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPT----PLGIKPRLGDILEEHIDDKSTISNK 56
            A D+GV Q R+R++ I F     ++F FP         K  L D++ +  D     +  
Sbjct: 140 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVENKDKITLKDVIWDLQDTAVPSAP- 198

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE 82
                Q +   + +    +  G F  
Sbjct: 199 -----QNKTNPDAVNNNEYFTGSFSP 219


>gi|240128365|ref|ZP_04741026.1| putative DNA modification methylase (N.MgoV) [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268686763|ref|ZP_06153625.1| DNA modification methylase [Neisseria gonorrhoeae SK-93-1035]
 gi|268627047|gb|EEZ59447.1| DNA modification methylase [Neisseria gonorrhoeae SK-93-1035]
          Length = 423

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F       P+L +ILE     + S    KL +
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETSPSPKLKNILESGLPTESSPFIKKLLK 215

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 216 KFPPSELYGKSVKDKRGGK 234


>gi|218768275|ref|YP_002342787.1| DNA modification methylase [Neisseria meningitidis Z2491]
 gi|121052283|emb|CAM08611.1| DNA modification methylase [Neisseria meningitidis Z2491]
          Length = 423

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F       P+L +ILE     + S    KL +
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETSPSPKLKNILESGLPTESSPFIKKLLK 215

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 216 KFPPSELYGKSVKDKRGGK 234


>gi|293975|gb|AAB59071.1| cytosine methylase [Neisseria gonorrhoeae]
          Length = 341

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 33/86 (38%), Gaps = 11/86 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPT----PLGIKPRLGDILEEHIDDKSTISNK 56
            A D+GV Q R+R++ I F     ++F FP         K  L D++ +  D     +  
Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVEDKDKITLKDVIWDLQDTAVPSAP- 214

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE 82
                Q +   + +    +  G F  
Sbjct: 215 -----QNKTNPDAVNNNEYFTGSFSP 235


>gi|182684309|ref|YP_001836056.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           pneumoniae CGSP14]
 gi|221232093|ref|YP_002511246.1| DNA methylase [Streptococcus pneumoniae ATCC 700669]
 gi|182629643|gb|ACB90591.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           pneumoniae CGSP14]
 gi|220674554|emb|CAR69117.1| putative DNA methylase [Streptococcus pneumoniae ATCC 700669]
          Length = 452

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 35/83 (42%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNK 56
           + + DFGVPQ RER++II       +   FP     +    + L+        KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGIRLLFPFRREGQATNSETLKTLGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKIAI 230


>gi|268604583|ref|ZP_06138750.1| cytosine methylase [Neisseria gonorrhoeae PID1]
 gi|268588714|gb|EEZ53390.1| cytosine methylase [Neisseria gonorrhoeae PID1]
          Length = 341

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 33/86 (38%), Gaps = 11/86 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPT----PLGIKPRLGDILEEHIDDKSTISNK 56
            A D+GV Q R+R++ I F     ++F FP         K  L D++ +  D     +  
Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVENKDKITLKDVIWDLQDTAVPSAP- 214

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE 82
                Q +   + +    +  G F  
Sbjct: 215 -----QNKTNPDAVNNNEYFTGSFSP 235


>gi|240081638|ref|ZP_04726181.1| DcmB [Neisseria gonorrhoeae FA19]
 gi|240113919|ref|ZP_04728409.1| DcmB [Neisseria gonorrhoeae MS11]
 gi|240116652|ref|ZP_04730714.1| DcmB [Neisseria gonorrhoeae PID18]
 gi|240129088|ref|ZP_04741749.1| DcmB [Neisseria gonorrhoeae SK-93-1035]
          Length = 325

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 33/86 (38%), Gaps = 11/86 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPT----PLGIKPRLGDILEEHIDDKSTISNK 56
            A D+GV Q R+R++ I F     ++F FP         K  L D++ +  D     +  
Sbjct: 140 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVEDKDKITLKDVIWDLQDTAVPSAP- 198

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE 82
                Q +   + +    +  G F  
Sbjct: 199 -----QNKTNPDAVNNNEYFTGSFSP 219


>gi|167009507|ref|ZP_02274438.1| modification methylase HaeIII [Francisella tularensis subsp.
          holarctica FSC200]
          Length = 111

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDD 49
          + + DF VPQ R+R++ +         F F T    K  L D + +  + 
Sbjct: 29 LNSSDFKVPQDRQRVFFVGIRKDLGFNFNFSTNTYPKITLKDAIWDLRES 78


>gi|160873497|ref|YP_001552813.1| DNA-cytosine methyltransferase [Shewanella baltica OS195]
 gi|160859019|gb|ABX47553.1| DNA-cytosine methyltransferase [Shewanella baltica OS195]
 gi|315265725|gb|ADT92578.1| DNA-cytosine methyltransferase [Shewanella baltica OS678]
          Length = 385

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 5/45 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP----SVEFKFPTPLGIKPRLGD 41
           + A D+GVPQ R+R++I    N     +  F  P      P   +
Sbjct: 158 LNAKDYGVPQNRKRVFIFGTRNDLKINNPAFP-PDATHFAPTSKN 201


>gi|194099965|ref|YP_002003104.1| Modification methylase NgoPII [Neisseria gonorrhoeae NCCP11945]
 gi|239997973|ref|ZP_04717897.1| Modification methylase NgoPII [Neisseria gonorrhoeae 35/02]
 gi|240015049|ref|ZP_04721962.1| Modification methylase NgoPII [Neisseria gonorrhoeae DGI18]
 gi|240017498|ref|ZP_04724038.1| Modification methylase NgoPII [Neisseria gonorrhoeae FA6140]
 gi|240122118|ref|ZP_04735080.1| Modification methylase NgoPII [Neisseria gonorrhoeae PID24-1]
 gi|240124411|ref|ZP_04737367.1| Modification methylase NgoPII [Neisseria gonorrhoeae PID332]
 gi|240124717|ref|ZP_04737603.1| Modification methylase NgoPII [Neisseria gonorrhoeae SK-92-679]
 gi|254494673|ref|ZP_05107844.1| modification methylase HaeIII [Neisseria gonorrhoeae 1291]
 gi|260439589|ref|ZP_05793405.1| Modification methylase NgoPII [Neisseria gonorrhoeae DGI2]
 gi|268599983|ref|ZP_06134150.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           MS11]
 gi|268602320|ref|ZP_06136487.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           PID18]
 gi|268683040|ref|ZP_06149902.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           PID332]
 gi|268683292|ref|ZP_06150154.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           SK-92-679]
 gi|268687469|ref|ZP_06154331.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|462655|sp|P08455|MTP2_NEIGO RecName: Full=Modification methylase NgoPII; Short=M.NgoPII;
           AltName: Full=Cytosine-specific methyltransferase NgoPII
 gi|193935255|gb|ACF31079.1| Modification methylase NgoPII [Neisseria gonorrhoeae NCCP11945]
 gi|226513713|gb|EEH63058.1| modification methylase HaeIII [Neisseria gonorrhoeae 1291]
 gi|268584114|gb|EEZ48790.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           MS11]
 gi|268586451|gb|EEZ51127.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           PID18]
 gi|268623324|gb|EEZ55724.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           PID332]
 gi|268623576|gb|EEZ55976.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           SK-92-679]
 gi|268627753|gb|EEZ60153.1| HaeIII DNA modification methyltransferase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|317165417|gb|ADV08958.1| DcmB [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 330

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 33/86 (38%), Gaps = 11/86 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPT----PLGIKPRLGDILEEHIDDKSTISNK 56
            A D+GV Q R+R++ I F     ++F FP         K  L D++ +  D     +  
Sbjct: 145 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVEDKDKITLKDVIWDLQDTAVPSAP- 203

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE 82
                Q +   + +    +  G F  
Sbjct: 204 -----QNKTNPDAVNNNEYFTGSFSP 224


>gi|161870123|ref|YP_001599293.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
 gi|225075874|ref|ZP_03719073.1| hypothetical protein NEIFLAOT_00897 [Neisseria flavescens
           NRL30031/H210]
 gi|296313674|ref|ZP_06863615.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC
           43768]
 gi|161595676|gb|ABX73336.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis 053442]
 gi|224952820|gb|EEG34029.1| hypothetical protein NEIFLAOT_00897 [Neisseria flavescens
           NRL30031/H210]
 gi|296839734|gb|EFH23672.1| DNA (cytosine-5-)-methyltransferase [Neisseria polysaccharea ATCC
           43768]
          Length = 423

 Score = 55.4 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F     + P+L +ILE     + S    KL +
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETTLSPKLKNILESGLPTESSPFIKKLLK 215

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 216 KFPPSELYGKSVKDKRGGK 234


>gi|59802113|ref|YP_208825.1| DcmB [Neisseria gonorrhoeae FA 1090]
 gi|268593822|ref|ZP_06127989.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria
           gonorrhoeae 35/02]
 gi|268597735|ref|ZP_06131902.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria
           gonorrhoeae FA19]
 gi|291042825|ref|ZP_06568566.1| site-specific DNA-methyltransferase M.NgoPII [Neisseria gonorrhoeae
           DGI2]
 gi|293398154|ref|ZP_06642359.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|44873|emb|CAA30038.1| unnamed protein product [Neisseria gonorrhoeae]
 gi|44888|emb|CAA36888.1| NgoPII restriction and modification [Neisseria gonorrhoeae]
 gi|293960|gb|AAA17019.1| cytosine methylase [Neisseria gonorrhoeae]
 gi|59719008|gb|AAW90413.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria
           gonorrhoeae FA 1090]
 gi|268547211|gb|EEZ42629.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria
           gonorrhoeae 35/02]
 gi|268551523|gb|EEZ46542.1| site-specific DNA-methyltransferase M. NgoPII [Neisseria
           gonorrhoeae FA19]
 gi|291013259|gb|EFE05225.1| site-specific DNA-methyltransferase M.NgoPII [Neisseria gonorrhoeae
           DGI2]
 gi|291611417|gb|EFF40487.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|227054|prf||1613419B NgoPII methylase
          Length = 341

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 33/86 (38%), Gaps = 11/86 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPT----PLGIKPRLGDILEEHIDDKSTISNK 56
            A D+GV Q R+R++ I F     ++F FP         K  L D++ +  D     +  
Sbjct: 156 NAKDYGVAQERKRVFYIGFRKDLEIKFSFPKGSTVEDKDKITLKDVIWDLQDTAVPSAP- 214

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE 82
                Q +   + +    +  G F  
Sbjct: 215 -----QNKTNPDAVNNNEYFTGSFSP 235


>gi|15676920|ref|NP_274067.1| modification methylase NlaIV [Neisseria meningitidis MC58]
 gi|7226272|gb|AAF41432.1| modification methylase NlaIV [Neisseria meningitidis MC58]
 gi|325136241|gb|EGC58849.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579]
 gi|325202033|gb|ADY97487.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149]
 gi|325208214|gb|ADZ03666.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis
           NZ-05/33]
          Length = 423

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F     + P+L +ILE     + S    KL +
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETTLSPKLKNILESGLPTESSPFIKKLLK 215

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 216 KFPPSELYGKSVKDKRGGK 234


>gi|126667824|ref|ZP_01738791.1| C-5 cytosine-specific DNA methylase [Marinobacter sp. ELB17]
 gi|126627772|gb|EAZ98402.1| C-5 cytosine-specific DNA methylase [Marinobacter sp. ELB17]
          Length = 327

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 45/102 (44%), Gaps = 8/102 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKP---RLGDILEEHIDDKSTIS 54
           +   D+G  + R+RL +I           F     + ++     L DIL+   +D S   
Sbjct: 209 LNGNDYGCIENRDRLVVIAISKSLQALGGFDMSDIIPVRTKEATLNDILDPISEDDSAW- 267

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
            K+ E  +K++ ++  AGKGF   L+     + N L+  Y K
Sbjct: 268 -KIHEYLEKKEVSDIAAGKGFRRQLYTGAEESINVLTRGYAK 308


>gi|194396841|ref|YP_002037999.1| Tn5253 C-5 cytosine-specific DNA methylase [Streptococcus
           pneumoniae G54]
 gi|194356508|gb|ACF54956.1| Tn5253 C-5 cytosine-specific DNA methylase [Streptococcus
           pneumoniae G54]
          Length = 452

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 34/83 (40%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNK 56
           + + DFGVPQ RER++II           FP     +    + L+        KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKTLGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKVAI 230


>gi|241666957|ref|YP_002985041.1| DNA-cytosine methyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862414|gb|ACS60079.1| DNA-cytosine methyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 393

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A + GVPQRRER+  + F +   +++ FP        L  +L + +          W+
Sbjct: 181 LNAANHGVPQRRERVVFVGFRSDLDIKWAFPAETH---SLDALLWDQVHGD------YWD 231

Query: 60  GHQKRKEN 67
            H+ RK +
Sbjct: 232 RHRVRKAD 239


>gi|323650438|gb|ADX97294.1| M.Cac8I [Clostridium acetobutylicum]
          Length = 398

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 28/91 (30%), Gaps = 5/91 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE----FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A +FGVPQ RER+ I+   N   +     + P     +  L          K     K
Sbjct: 181 LNAYNFGVPQNRERVIIVGIRNDLRDRYIIPQKPAVKNKRKTLFVKPTHSKTSKLGEELK 240

Query: 57  LWEGH-QKRKENNKIAGKGFGYGLFFENSAT 86
            W+                    L  EN  T
Sbjct: 241 PWQKINYLYNLWTNGKLDSNKNYLVNENDET 271


>gi|306833678|ref|ZP_07466805.1| DNA (cytosine-5-)-methyltransferase [Streptococcus bovis ATCC
           700338]
 gi|304424448|gb|EFM27587.1| DNA (cytosine-5-)-methyltransferase [Streptococcus bovis ATCC
           700338]
          Length = 451

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP      P   + L      K  ++ ++  
Sbjct: 148 LNSKDFQVPQNRERVFIIGHSRRNRSRFLFPLRGEDSPAHLERLGNINPSKRGLNGEV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 206 YLTSGLAPTLTRGKGEGAKIAIP 228


>gi|304387455|ref|ZP_07369646.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|304338548|gb|EFM04667.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
          Length = 273

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F       P+L +ILE     + S    KL +
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETSPSPKLKNILESGLPTESSPFIKKLLK 215

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 216 KFPPSELYGKSVKDKRGGK 234


>gi|254673505|emb|CBA08927.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha275]
          Length = 273

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F       P+L +ILE     + S    KL +
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETSPSPKLKNILESGLPTESSPFIKKLLK 215

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 216 KFPPSELYGKSVKDKRGGK 234


>gi|325130383|gb|EGC53149.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304]
          Length = 425

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 33/79 (41%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F     + P+L +ILE     + S    KL +
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETTLSPKLKNILESGLPTESSPFIKKLLK 215

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 216 KFPPSELYGKSVKDKRGGK 234


>gi|308184574|ref|YP_003928707.1| site-specific DNA methylase [Helicobacter pylori SJM180]
 gi|308060494|gb|ADO02390.1| site-specific DNA methylase [Helicobacter pylori SJM180]
          Length = 405

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 33/98 (33%), Gaps = 13/98 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG------------IKPRLGDILEEHID 48
           +KA D+GVPQ RER+ II          FP                    + D++    +
Sbjct: 148 LKASDYGVPQHRERVIIIGNRLGLKN-PFPKKTHGLCNDLFNEKLKPYVCVKDVVGHLAN 206

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSAT 86
            ++  ++ + +G        +       +G     +  
Sbjct: 207 VRTRDASFMLDGVMIHNHVARTNVYDTFWGRKHPINQH 244


>gi|307153788|ref|YP_003889172.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
 gi|306984016|gb|ADN15897.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
          Length = 424

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---------GIKPRLGDILEEHIDDKS 51
           + A  +GVPQ RERL+++      V  ++P P+            P + + L++  +   
Sbjct: 160 LNAAHYGVPQNRERLFLLGSQKGLVLPQYPEPITAPNPFQNLSKTPTVWEALQDLPEVNH 219

Query: 52  TIS 54
              
Sbjct: 220 YPE 222


>gi|75906326|ref|YP_320622.1| C-5 cytosine-specific DNA methylase [Anabaena variabilis ATCC
           29413]
 gi|75700051|gb|ABA19727.1| C-5 cytosine-specific DNA methylase [Anabaena variabilis ATCC
           29413]
          Length = 431

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41
           + A  +GVPQ RERL++I         K+P P+    +  +
Sbjct: 168 LNAAHYGVPQARERLFLIGAREDVKLPKYPKPITKPAKSNN 208


>gi|307637790|gb|ADN80240.1| DNA-cytosine methyl transferase [Helicobacter pylori 908]
 gi|325996388|gb|ADZ51793.1| DNA-cytosine methyltransferase [Helicobacter pylori 2018]
 gi|325997976|gb|ADZ50184.1| Type II DNA modification enzyme/ methyltransferase [Helicobacter
           pylori 2017]
          Length = 318

 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKRPFSFPLGLANDYCFNDFLDA---DNECYLDVSNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 202 IFQRYLCNPYNHNRVFLENILTLENAVLDT 231


>gi|210135280|ref|YP_002301719.1| type II R-M system methyltransferase [Helicobacter pylori P12]
 gi|210133248|gb|ACJ08239.1| type II R-M system methyltransferase [Helicobacter pylori P12]
          Length = 315

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q RER+YI+ F       F FP  L       D L+   +    I+N  ++
Sbjct: 139 LNSADFQLAQNRERIYIVGFRKDLKHPFNFPLGLANDYYFKDFLDADNECYLDINNATFQ 198

Query: 60  GHQKRKENN 68
            +   K N+
Sbjct: 199 KYLHNKYNH 207


>gi|261400634|ref|ZP_05986759.1| DNA (cytosine-5-)-methyltransferase [Neisseria lactamica ATCC
           23970]
 gi|313668389|ref|YP_004048673.1| DNA modification methylase [Neisseria lactamica ST-640]
 gi|1709164|sp|P50182|MTN4_NEILA RecName: Full=Modification methylase NlaIV; Short=M.NlaIV; AltName:
           Full=Cytosine-specific methyltransferase NlaIV
 gi|476227|gb|AAA53237.1| M.NlaIV [Neisseria lactamica]
 gi|269209540|gb|EEZ75995.1| DNA (cytosine-5-)-methyltransferase [Neisseria lactamica ATCC
           23970]
 gi|313005851|emb|CBN87307.1| DNA modification methylase [Neisseria lactamica 020-06]
          Length = 423

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F       P+L +ILE     + S    KL +
Sbjct: 158 LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETTPSPKLKNILESGLPTESSPFIKKLLK 215

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 216 KFPPSELYGKSVKDKRGGK 234


>gi|323487872|ref|ZP_08093130.1| cytosine-specific methyltransferase [Planococcus donghaensis
           MPA1U2]
 gi|323398606|gb|EGA91394.1| cytosine-specific methyltransferase [Planococcus donghaensis
           MPA1U2]
          Length = 367

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/104 (20%), Positives = 39/104 (37%), Gaps = 11/104 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + + DFGVPQ+RER++ I FLN  ++      +  +    K  + + +       +  + 
Sbjct: 149 LNSADFGVPQKRERVFFIGFLNKDIDSNQMMARIMSKKKNKVTVRESISHLPPAGNEENP 208

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFEN------SATTNTLSAR 93
                     +N  +    +   LF            +NTL A 
Sbjct: 209 ITCTAKITLAKNPIMRKSPYAGMLFNGMGRPINIDEASNTLPAS 252


>gi|119510471|ref|ZP_01629604.1| DNA cytosine methylase [Nodularia spumigena CCY9414]
 gi|119464893|gb|EAW45797.1| DNA cytosine methylase [Nodularia spumigena CCY9414]
          Length = 727

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/77 (19%), Positives = 24/77 (31%), Gaps = 2/77 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
            + DFG+PQ RER+  +   +    FK        P L + L      +     +     
Sbjct: 147 NSRDFGLPQNRERVVFVATKDKKFNFKTLQKSHPVPTLREFLCTSGKFEYLNPEEY--TM 204

Query: 62  QKRKENNKIAGKGFGYG 78
               +         GY 
Sbjct: 205 IDYPKQQASGLIFVGYR 221


>gi|108563484|ref|YP_627800.1| type II DNA modification enzyme [Helicobacter pylori HPAG1]
 gi|107837257|gb|ABF85126.1| type II DNA modification enzyme [Helicobacter pylori HPAG1]
          Length = 313

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFNDFLDA---DNECYLDTNNA 195

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 196 TFQRYLRNRYNHNRVFLEDILTLENAVLDT 225


>gi|269214273|ref|ZP_05986228.2| modification methylase NgoPII [Neisseria lactamica ATCC 23970]
 gi|269210330|gb|EEZ76785.1| modification methylase NgoPII [Neisseria lactamica ATCC 23970]
          Length = 330

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 33/86 (38%), Gaps = 11/86 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPT----PLGIKPRLGDILEEHIDDKSTISNK 56
            A D+GV Q R+R++ I F     ++F FP         K  L D++ +  D     +  
Sbjct: 145 NAKDYGVAQERKRVFYIGFRKDLEIQFSFPKGSTVEDKDKITLRDVIWDLQDTAVPSAP- 203

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFE 82
                Q +   + +    +  G F  
Sbjct: 204 -----QNKTNPDAVNNNEYFTGSFSP 224


>gi|17229768|ref|NP_486316.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120]
 gi|17131367|dbj|BAB73975.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120]
          Length = 431

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41
           + A  +GVPQ RERL++I         K+P P+    +  +
Sbjct: 168 LNAAHYGVPQARERLFLIGAREDVKLPKYPKPITKPAKSNN 208


>gi|240143270|ref|ZP_04741871.1| modification methylase BspRI [Roseburia intestinalis L1-82]
 gi|257204748|gb|EEV03033.1| modification methylase BspRI [Roseburia intestinalis L1-82]
          Length = 432

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF--PTPLG 34
           + + ++GVPQ RER+ ++   N  ++F++  P P  
Sbjct: 226 LNSAEYGVPQIRERVILVGVRND-IDFEYVHPEPTH 260


>gi|239982029|ref|ZP_04704553.1| DNA modification methylase [Streptomyces albus J1074]
 gi|291453880|ref|ZP_06593270.1| C-5 cytosine-specific DNA methylase [Streptomyces albus J1074]
 gi|291356829|gb|EFE83731.1| C-5 cytosine-specific DNA methylase [Streptomyces albus J1074]
          Length = 409

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHI 47
           + A D+GVPQ R R  ++         F +P P      + + LEE +
Sbjct: 183 LHAQDYGVPQLRPRAILVAIRKDQYRGFDWPAPRKKLRTVAEALEESM 230


>gi|303236368|ref|ZP_07322958.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN]
 gi|302483426|gb|EFL46431.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN]
          Length = 357

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/107 (16%), Positives = 37/107 (34%), Gaps = 12/107 (11%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTP---LGIKPRLGDILEEHIDDKSTISNKLWE 59
           A D+GVPQ R+RL  +   N   +F+FP P             + +       + +++  
Sbjct: 157 AADYGVPQIRKRLVFVGLKNNKEKFEFPEPLLKEEAYITCKQAISDLPPLVDELGSEVST 216

Query: 60  GHQKRKENNKIAGKG-----FGYGLFFENSATTNTLS----ARYYKD 97
             ++ +   +   +      + +            +S       YKD
Sbjct: 217 YCEEPETEYQRKMRKNCDVLYNHVAVNHKDFVKQVISQVPDGGNYKD 263


>gi|94968156|ref|YP_590204.1| DNA-cytosine methyltransferase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94550206|gb|ABF40130.1| DNA-cytosine methyltransferase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 359

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           M AC+FGVPQ R R+  +       E F +P        +GD+L + +  +     K W
Sbjct: 184 MNACEFGVPQLRPRVVFVAMRKEYSEHFAWPRATNEPQTVGDVLFDLMSARGWKGVKAW 242


>gi|261839852|gb|ACX99617.1| type II DNA modification enzyme (methyltransferase) [Helicobacter
           pylori 52]
          Length = 319

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q RERLYI+ F       F FP  L       D L+   +    +SN +++
Sbjct: 145 LNSADFQLAQNRERLYIVGFRKDLKHHFVFPLGLANDYCFKDFLDADNECYLDVSNAIFQ 204

Query: 60  -GHQKRKENNKIAGKG 74
                R  +N+++ + 
Sbjct: 205 RYLHNRYNHNQVSLEN 220


>gi|332075476|gb|EGI85945.1| modification methylase HpaII [Streptococcus pneumoniae GA41301]
          Length = 452

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 34/83 (40%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILE---EHIDDKSTISNK 56
           + + DFGVPQ RER++II           FP     +    + L+        KS +S K
Sbjct: 148 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKTLGNLNPSKSGMSGK 207

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 208 VYYSEGLAPTLVRGKGEGFKIAI 230


>gi|219871000|ref|YP_002475375.1| cytosine specific DNA methyltransferase (BSP6IM) [Haemophilus
           parasuis SH0165]
 gi|219691204|gb|ACL32427.1| cytosine specific DNA methyltransferase (BSP6IM) [Haemophilus
           parasuis SH0165]
          Length = 295

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 38/116 (32%), Gaps = 17/116 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDIL---EEHIDDKSTISN 55
           + +  +GVPQ RER+Y +          F+FPTP  IK     ++   +   D+ +    
Sbjct: 121 LDSQFYGVPQMRERIYFVGIRKDIKHKPFEFPTPEPIKDIAECLIEERDYIFDENNPTFQ 180

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFEN-------SATTNTLSAR-----YYKDGS 99
           K         +          Y +              + TL        Y KDG 
Sbjct: 181 KYLHNKYNNNKVELNNILQKDYQVIDWRQSDFRCYEKKSPTLRTGRHGILYTKDGK 236


>gi|332673919|gb|AEE70736.1| C-5 cytosine-specific DNA methylase [Helicobacter pylori 83]
          Length = 319

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+ + +      +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDANNE---CYLDTNNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +   +T
Sbjct: 202 AFQRYLHNQYNHNRVFLENILTLENVVLDT 231


>gi|317009733|gb|ADU80313.1| type II DNA modification enzyme [Helicobacter pylori India7]
          Length = 318

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   +      +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFNDFLDAGNE---CYLDVSNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             ++   N     + F   +    +A  +T
Sbjct: 202 AFKRYLHNPYNHNRVFLENILTLENAVLDT 231


>gi|227500535|ref|ZP_03930589.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus
           tetradius ATCC 35098]
 gi|227217363|gb|EEI82692.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus
           tetradius ATCC 35098]
          Length = 321

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F          L + LE+ + +  TI+     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFDKLERKETRTLSEFLEKDVSELYTITQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGINNSFRGRLKVIKD-FSYTIS 235


>gi|42560766|ref|NP_975217.1| cytosine-specific DNA-methyltransferase Sau96I [Mycoplasma mycoides
           subsp. mycoides SC str. PG1]
 gi|42492262|emb|CAE76859.1| Cytosine-specific DNA-methyltransferase Sau96I [Mycoplasma mycoides
           subsp. mycoides SC str. PG1]
 gi|301320716|gb|ADK69359.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma mycoides subsp.
           mycoides SC str. Gladysdale]
          Length = 341

 Score = 55.0 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDK 50
           + A D+ V Q+RERL +I   N       F+FP     K  L DIL+     +
Sbjct: 155 LNALDYMVAQKRERLIVIGIRNDLTNLIKFEFPKKHQKKLVLKDILKNVPKSE 207


>gi|169826094|ref|YP_001696252.1| modification methylase BsuRI [Lysinibacillus sphaericus C3-41]
 gi|168990582|gb|ACA38122.1| Modification methylase BsuRI [Lysinibacillus sphaericus C3-41]
          Length = 426

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 7/58 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
            + DFGVPQ RER+++I      +     FK+P P   +P  GD L+ ++  +  I +
Sbjct: 228 NSRDFGVPQLRERVFLIGVHKEKIAEKYGFKYPKP---QPTHGDGLKPYVTLRDAIGD 282


>gi|212632918|ref|YP_002309443.1| site-specific DNA-methyltransferase [Shewanella piezotolerans WP3]
 gi|212554402|gb|ACJ26856.1| Site-specific DNA-methyltransferase (cytosine-specific) [Shewanella
           piezotolerans WP3]
          Length = 412

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +KA  + VPQ+RERL ++        S +F +P+P      L D  E+     S +    
Sbjct: 221 LKAIFYKVPQKRERLILVGVRKDLATSAKFSWPSPYKRIMTLKDAFEKGELFDSKVEESP 280

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            + + +RK+         GY
Sbjct: 281 GQEYPQRKKEIMAQVPPGGY 300


>gi|217034658|ref|ZP_03440063.1| hypothetical protein HP9810_901g5 [Helicobacter pylori 98-10]
 gi|216942866|gb|EEC22357.1| hypothetical protein HP9810_901g5 [Helicobacter pylori 98-10]
          Length = 312

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLVNDYCFKDFLDA---DNECYLDTNNA 195

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 196 AFQRYLRNKYNHNRVFLENILTLENAVLDT 225


>gi|308184861|ref|YP_003928994.1| type II DNA modification enzyme [Helicobacter pylori SJM180]
 gi|308060781|gb|ADO02677.1| type II DNA modification enzyme [Helicobacter pylori SJM180]
          Length = 318

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHID 48
           + + DF + Q RERLYI+ F       F FP  L       D L+   +
Sbjct: 145 LNSADFQLAQNRERLYIVGFRKDLKYPFNFPLGLANDYCFNDFLDADNE 193


>gi|167042310|gb|ABZ07039.1| putative C-5 cytosine-specific DNA methylase [uncultured marine
           crenarchaeote HF4000_ANIW97J3]
          Length = 380

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 29/87 (33%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ R+R +I+   +         P       G      + D  +   K+ +G
Sbjct: 165 LNAADYGVPQIRKRAFIVGSRSRIP---IEKPRTTHGSNGQAPRVSVFDAISDLPKIPDG 221

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATT 87
               +   K     F   L       T
Sbjct: 222 SSSSRAAYKKPPNKFQRQLRNGQRKPT 248


>gi|212710423|ref|ZP_03318551.1| hypothetical protein PROVALCAL_01485 [Providencia alcalifaciens DSM
           30120]
 gi|212686843|gb|EEB46371.1| hypothetical protein PROVALCAL_01485 [Providencia alcalifaciens DSM
           30120]
          Length = 330

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPR 38
           + A D+GV Q R+R+  + F +  ++ + FP P+    R
Sbjct: 145 LNAVDYGVAQDRKRVIFVGFRSDLNIPYTFPEPIEKDKR 183


>gi|325298662|ref|YP_004258579.1| DNA-cytosine methyltransferase [Bacteroides salanitronis DSM 18170]
 gi|324318215|gb|ADY36106.1| DNA-cytosine methyltransferase [Bacteroides salanitronis DSM 18170]
          Length = 336

 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A D+ V + R+R++ I F       +FK+PTPL  KP L + + +  D      +K
Sbjct: 144 LNANDYDVAEDRDRVFYIGFRKDLNIHDFKYPTPLKHKPTLRECIWDLQDTAIPARDK 201


>gi|227874220|ref|ZP_03992420.1| DNA (cytosine-5-)-methyltransferase [Oribacterium sinus F0268]
 gi|227839928|gb|EEJ50358.1| DNA (cytosine-5-)-methyltransferase [Oribacterium sinus F0268]
          Length = 336

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEEHIDD 49
           + A D+GV Q+RERL  I         ++++FP     KP L DIL +    
Sbjct: 152 LNAWDYGVAQKRERLITIGIRKDLEDKIKYEFPKVYEYKPLLKDILLDVPPS 203


>gi|317014507|gb|ADU81943.1| type II DNA modification (methyltransferase) [Helicobacter pylori
           Gambia94/24]
          Length = 318

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 33/90 (36%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDA---DNEYYLDVSNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     +     +    +A  +T
Sbjct: 202 TFQRYLRNPYNHNRVSLENILTLENAVLDT 231


>gi|296313785|ref|ZP_06863726.1| modification methylase NgoPII [Neisseria polysaccharea ATCC 43768]
 gi|296839714|gb|EFH23652.1| modification methylase NgoPII [Neisseria polysaccharea ATCC 43768]
          Length = 330

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPT----PLGIKPRLGDILEEHID 48
            A D+GV Q R+R++ I F     ++F FPT        K  L DI+ +  D
Sbjct: 145 NAKDYGVAQERKRVFYIGFRKDLKIKFSFPTGSTVKDEDKITLKDIIWDLQD 196


>gi|313665138|ref|YP_004047009.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma leachii PG50]
 gi|312949950|gb|ADR24546.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma leachii PG50]
          Length = 342

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDK 50
           + A D+ V Q+RERL +I   N       F+FP     K  L DIL+     +
Sbjct: 155 LNALDYMVAQKRERLIVIGIRNDLTNLIKFEFPKKHQKKLVLKDILKNVPKSE 207


>gi|331703222|ref|YP_004399909.1| cytosine specific DNA methyltransferase Sau96I [Mycoplasma mycoides
           subsp. capri LC str. 95010]
 gi|328801777|emb|CBW53930.1| Cytosine specific DNA methyltransferase Sau96I [Mycoplasma mycoides
           subsp. capri LC str. 95010]
          Length = 342

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDK 50
           + A D+ V Q+RERL +I   N       F+FP     K  L DIL+     +
Sbjct: 155 LNALDYMVAQKRERLIVIGIRNDLTNLIKFEFPKKHQKKLVLKDILKNVPKSE 207


>gi|309378580|emb|CBX22758.1| DNA cytosine methyltransferase M.NlaIV [Neisseria lactamica
           Y92-1009]
          Length = 380

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F       P+L +ILE     + S    KL +
Sbjct: 115 LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETTPSPKLKNILESGLPTESSPFIKKLLK 172

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 173 KFPPSELYGKSVKDKRGGK 191


>gi|308183225|ref|YP_003927352.1| type II DNA modification enzyme [Helicobacter pylori PeCan4]
 gi|308065410|gb|ADO07302.1| type II DNA modification enzyme [Helicobacter pylori PeCan4]
          Length = 318

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 33/90 (36%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKRPFNFPLGLANDYCFKDFLDA---DNECYLDVSNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     +     +    +A  +T
Sbjct: 202 TFQRYLRNPYNHNRVSLENILTLENAVLDT 231


>gi|46019826|emb|CAE52348.1| putative cytosine-specific methyltransferase [Streptococcus
           thermophilus]
          Length = 365

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRL 39
           + A D+GVPQ R+R++ + +        FKFP P     + 
Sbjct: 155 LLAADYGVPQIRKRMFFVGYRKDLNYEYFKFPEPTLTPDKH 195


>gi|321310707|ref|YP_004193036.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
 gi|319802551|emb|CBY93197.1| C-5 cytosine-specific DNA methylase [Mycoplasma haemofelis str.
           Langford 1]
          Length = 340

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDD 49
           + + D+GV Q+RERL +I   +     + FK+P     KP L D+L +  + 
Sbjct: 156 LNSWDYGVAQKRERLILIGIRSDFREKISFKYPKKHRYKPVLSDVLNDVPES 207


>gi|281416239|ref|YP_003347588.1| DNA cytosine methyltransferase [Enterococcus phage phiFL3A]
 gi|270209504|gb|ACZ64045.1| DNA cytosine methyltransferase [Enterococcus phage phiFL3A]
 gi|270209572|gb|ACZ64112.1| DNA cytosine methyltransferase [Enterococcus phage phiFL3B]
          Length = 317

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 36/94 (38%), Gaps = 6/94 (6%)

Query: 1   MKACDFGVPQRRERLY-IIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+R+R++ I         F       +KP L + LE   D K  ++     
Sbjct: 149 LNAMDFGIPQKRKRVFAISKLDGEPFNFDLLKHRPLKP-LRNFLEVTTDQKYLVTQPSM- 206

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                K  +K +      G          T++ R
Sbjct: 207 ---LSKIRSKSSLATGFSGRLEVVKEFVYTITTR 237


>gi|226223282|ref|YP_002757389.1| type II DNA modification enzyme (methyltransferase) [Listeria
           monocytogenes Clip81459]
 gi|225875744|emb|CAS04447.1| Putative type II DNA modification enzyme (methyltransferase)
           [Listeria monocytogenes serotype 4b str. CLIP 80459]
          Length = 389

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 3/34 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPT 31
           + A  FGVPQ RER++++           ++FP 
Sbjct: 169 LNAKHFGVPQNRERVFLLGIRKDLEIKQNWEFPE 202


>gi|91201234|emb|CAJ74294.1| similar to site-specific DNA-methyltransferase (cytosine-specific)
           [Candidatus Kuenenia stuttgartiensis]
          Length = 313

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTP 32
           A D+GVPQ RER++I+        F  P P
Sbjct: 162 AEDYGVPQTRERVFIVGTRPDVSRFTPPEP 191


>gi|317506898|ref|ZP_07964670.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC
           BAA-974]
 gi|316254826|gb|EFV14124.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC
           BAA-974]
          Length = 331

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/61 (22%), Positives = 26/61 (42%), Gaps = 1/61 (1%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A +FGVPQ R R  ++        +F++P  +   P +G  L   +  +      +W 
Sbjct: 148 LNASEFGVPQLRPRFILVAMKRRDFRKFEWPRAISAPPTVGSALRPLMASRGWAGADIWA 207

Query: 60  G 60
            
Sbjct: 208 S 208


>gi|239627884|ref|ZP_04670915.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239518030|gb|EEQ57896.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 325

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 1/54 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTI 53
           +KA D+G    R+R+Y + F      +F FP        + D L + +D+   I
Sbjct: 144 LKASDYGCATIRKRIYFVCFRKDLKAKFSFPESFESNIAVEDFLNQEVDEHYYI 197


>gi|312863775|ref|ZP_07724013.1| DNA (cytosine-5-)-methyltransferase [Streptococcus vestibularis
           F0396]
 gi|311101311|gb|EFQ59516.1| DNA (cytosine-5-)-methyltransferase [Streptococcus vestibularis
           F0396]
          Length = 454

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 29/83 (34%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP      P   + L         ++ ++  
Sbjct: 151 LNSKDFQVPQNRERVFIIGHSRRYRPRFLFPIRGENSPVNLERLGNVNPSGKGMNREV-- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 209 YLSSGLSPTLTRGKGEGTKIAIP 231


>gi|322372404|ref|ZP_08046940.1| modification methylase DdeI [Streptococcus sp. C150]
 gi|321277446|gb|EFX54515.1| modification methylase DdeI [Streptococcus sp. C150]
          Length = 387

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 32/101 (31%), Gaps = 11/101 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---EFKFPT--PLGIKPRLGD------ILEEHIDD 49
           + A DFGVPQ RER+++I          E+ FP    L  +  L D      IL  +   
Sbjct: 169 INAKDFGVPQNRERVFLIGVRKDLKIKSEWIFPEAMTLNNEITLRDAISDLPILGNNEQK 228

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
            + I     E     + N                      L
Sbjct: 229 YNYICEPRTEYQALLRGNQTELLNHVSRNHGERLQKIMRAL 269


>gi|254671396|emb|CBA08870.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha153]
          Length = 157

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F       P+L +ILE     + S    KL +
Sbjct: 42  LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETSPSPKLKNILESGLPTESSPFIKKLLK 99

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 100 KFPPSELYGKSVKDKRGGK 118


>gi|15645735|ref|NP_207912.1| cytosine specific DNA methyltransferase (BSP6IM) [Helicobacter
           pylori 26695]
 gi|2314272|gb|AAD08164.1| cytosine specific DNA methyltransferase (BSP6IM) [Helicobacter
           pylori 26695]
          Length = 312

 Score = 54.6 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHID 48
           + + DF + Q RERLYI+ F       F FP  L       D L+   +
Sbjct: 139 LNSADFQLAQNRERLYIVGFRKDLKHPFNFPLGLANDYYFKDFLDADNE 187


>gi|294635767|ref|ZP_06714227.1| C-5 cytosine-specific DNA methylase family protein [Edwardsiella
           tarda ATCC 23685]
 gi|291090867|gb|EFE23428.1| C-5 cytosine-specific DNA methylase family protein [Edwardsiella
           tarda ATCC 23685]
          Length = 403

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/98 (18%), Positives = 35/98 (35%), Gaps = 12/98 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTIS---- 54
           + A D+GVPQ R+R +I+       +  F++P P     + G                  
Sbjct: 160 LNARDYGVPQSRKRAFILAVRKDICTDGFEWP-PKATHTKSGSRAWATSSTVFERPPQSV 218

Query: 55  -----NKLWEGHQKRKENNKIAGKGFGYGLFFENSATT 87
                ++L E      E+ +   K   +G   +++   
Sbjct: 219 LIELKDRLIEKFDFTMEDAETCIKSLNWGQPVDSNDPC 256


>gi|317180853|dbj|BAJ58639.1| Type II DNA modification enzyme [Helicobacter pylori F32]
          Length = 312

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDA---DNECYLDTNNA 195

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 196 AFQRYLHNKYNHNRVFLENILTLENAVLDT 225


>gi|281181375|dbj|BAI57705.1| cytosine specific DNA methyltransferase [Escherichia coli SE15]
 gi|315288374|gb|EFU47772.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli MS 110-3]
          Length = 398

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------SVEFKFPTPLGIKPRLGDI 42
           + A D+GVPQ R+R++I    N       ++EF  P      P   ++
Sbjct: 159 LNARDYGVPQNRKRVFIAGVRNDILKKRNNIEFP-PQATHFNPNSNEV 205


>gi|257466246|ref|ZP_05630557.1| Type II restriction-modification system methylation subunit
           [Fusobacterium gonidiaformans ATCC 25563]
          Length = 327

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 33/91 (36%), Gaps = 5/91 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ+RER++++  L  +  F F      + R  DI E    D S +     E 
Sbjct: 161 LNAMDFGIPQKRERIFVVSIL-GNNSFDFAKLEKTQTR--DISEFIEKDASNLYEVRQES 217

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                          G            T+S
Sbjct: 218 MLSHIRGEPKNNNFRGRLKVI--DKFAYTIS 246


>gi|208434021|ref|YP_002265687.1| cytosine specific DNA methyltransferase (putative type II)
           [Helicobacter pylori G27]
 gi|208431950|gb|ACI26821.1| cytosine specific DNA methyltransferase (putative type II)
           [Helicobacter pylori G27]
          Length = 281

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           +   D+GVPQ RER +I+     S +FK   P   
Sbjct: 79  LNVKDYGVPQNRERAFIVGASRFSFDFKLLEPSQS 113


>gi|109947180|ref|YP_664408.1| C-5 cytosine-specific DNA methylase [Helicobacter acinonychis str.
           Sheeba]
 gi|109714401|emb|CAJ99409.1| C-5 cytosine-specific DNA methylase [Helicobacter acinonychis str.
           Sheeba]
          Length = 315

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 36/90 (40%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F      +F FP  L       D L+    D     N    
Sbjct: 139 LNSADFQLAQKRERLYIVGFRKDLKHQFNFPLGLANDYCFKDFLDA---DNECYLNTNNA 195

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N+    + F   +    +A  +T
Sbjct: 196 AFQRYLHNSYNHNRVFLENILTLENAVLDT 225


>gi|332970700|gb|EGK09681.1| modification methylase DdeIM [Kingella kingae ATCC 23330]
          Length = 193

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 31/87 (35%), Gaps = 4/87 (4%)

Query: 3  ACDFGVPQRRERLYIIDFLNPSVEFKFPTPL-GIKPRLGDILEEHIDDKSTISNKL-WEG 60
          A DFGVPQ R R + + F N +  F+FP             + +  D            G
Sbjct: 2  ASDFGVPQNRRRAFFVGFKNGT-RFEFPQATVKQHITAEQAISDLPDYSVADGENYPLSG 60

Query: 61 HQKRKENNKIAGKG-FGYGLFFENSAT 86
              ++  +    G F + +   N  T
Sbjct: 61 SSNYQQQMRQNSTGLFNHQITVHNDKT 87


>gi|227484740|ref|ZP_03915056.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus
           lactolyticus ATCC 51172]
 gi|227237262|gb|EEI87277.1| possible DNA (cytosine-5-)-methyltransferase [Anaerococcus
           lactolyticus ATCC 51172]
          Length = 321

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSEFLEKDVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFRGRLKVIKD-YSYTIS 235


>gi|260890952|ref|ZP_05902215.1| modification methylase NgoFVII [Leptotrichia hofstadii F0254]
 gi|260859505|gb|EEX74005.1| modification methylase NgoFVII [Leptotrichia hofstadii F0254]
          Length = 452

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 36/127 (28%), Gaps = 28/127 (22%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK--------ST 52
           + A D+GVPQ+RER+ I+          +P         G+      D+K          
Sbjct: 154 LNAADYGVPQQRERVIIMGNRLGLKN-PYPKKTHADLFPGEENYLLFDEKLKGTNLKPYI 212

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA-------------------R 93
              +      +    N         G     +   NT                      R
Sbjct: 213 TVEQTIGFLSEIDVQNDKLNDFVKVGKRKIYNHIANTSVKDTFWGRKHEVNQADICDYLR 272

Query: 94  YYKDGSE 100
           YY+D SE
Sbjct: 273 YYRDKSE 279


>gi|94995093|ref|YP_603191.1| Type II restriction-modification system methylation subunit
           [Streptococcus pyogenes MGAS10750]
 gi|94548601|gb|ABF38647.1| Type II restriction-modification system methylation subunit
           [Streptococcus pyogenes MGAS10750]
          Length = 321

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+++ +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFDKLERKETRPLSEFLEKNVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGINNSFRGRLKVIKD-FSYTIS 235


>gi|326563801|gb|EGE14052.1| type II DNA modification enzyme [Moraxella catarrhalis 46P47B1]
 gi|326566814|gb|EGE16953.1| type II DNA modification enzyme [Moraxella catarrhalis 103P14B1]
 gi|326576727|gb|EGE26634.1| type II DNA modification enzyme [Moraxella catarrhalis 101P30B1]
          Length = 327

 Score = 54.6 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + +  +GVPQ R+R+Y +          FKFP P+ +   + D L +  D +  ++N  +
Sbjct: 144 LDSQYYGVPQMRQRVYFVGIRKDIKHMPFKFPQPI-LSKPIDDFLSDDRDYEFDVNNPTF 202

Query: 59  EGHQKRK 65
           + +   K
Sbjct: 203 QKYLASK 209


>gi|322385307|ref|ZP_08058952.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           cristatus ATCC 51100]
 gi|321270566|gb|EFX53481.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           cristatus ATCC 51100]
          Length = 480

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 34/83 (40%), Gaps = 4/83 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGD---ILEEHIDDKSTISNK 56
           + + +FGVPQ RER++II           FP     +    +   IL      KS +S K
Sbjct: 176 LNSKNFGVPQNRERVFIIGHSRKRGTRLLFPFRREGQATNSETLKILGNLNPSKSGMSGK 235

Query: 57  LWEGHQKRKENNKIAGKGFGYGL 79
           ++          +  G+GF   +
Sbjct: 236 VYYSEGLAPTLVRGKGEGFKVAI 258


>gi|54297036|ref|YP_123405.1| hypothetical protein lpp1078 [Legionella pneumophila str. Paris]
 gi|53750821|emb|CAH12229.1| hypothetical protein lpp1078 [Legionella pneumophila str. Paris]
          Length = 320

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL--EEHIDDKSTISNKLW 58
           + + DFGVPQ+RER YI+ F+  +V F+FP   G+   L  IL  E+ I +K   S+   
Sbjct: 146 LNSLDFGVPQKRERTYIVGFI-DNVPFEFPKG-GVPFNLESILEKEQQIPNKYYASD--- 200

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTL 90
              ++++                  S   +TL
Sbjct: 201 -YIRQKRIAALKGVPPIPSIWHENKSGNISTL 231


>gi|326560963|gb|EGE11328.1| type II DNA modification enzyme [Moraxella catarrhalis 7169]
 gi|326575187|gb|EGE25115.1| type II DNA modification enzyme [Moraxella catarrhalis CO72]
          Length = 322

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + +  +GVPQ R+R+Y +          FKFP P+ +   + D L +  D +  ++N  +
Sbjct: 139 LDSQYYGVPQMRQRVYFVGIRKDIKHMPFKFPQPI-LSKPIDDFLSDDRDYEFDVNNPTF 197

Query: 59  EGHQKRK 65
           + +   K
Sbjct: 198 QKYLASK 204


>gi|322411818|gb|EFY02726.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 451

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 29/83 (34%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + +F VPQ RER++II         F FP          + L       + ++ K+  
Sbjct: 148 LNSKNFQVPQNRERIFIIGHSRRYRPRFLFPLGRESSSTGLERLGNVNPSGNGMNGKV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 206 YLSSGLAPTLTRGKGEGTKIAIP 228


>gi|320333452|ref|YP_004170163.1| DNA-cytosine methyltransferase [Deinococcus maricopensis DSM 21211]
 gi|319754741|gb|ADV66498.1| DNA-cytosine methyltransferase [Deinococcus maricopensis DSM 21211]
          Length = 326

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-LGIKPRLGDIL 43
           + A D+GVPQ R R+ ++        ++ +P P     P +G+ L
Sbjct: 149 LNARDYGVPQLRPRVILVALRPDVMAQYSWPEPHPEAAPTVGEAL 193


>gi|46580156|ref|YP_010964.1| C-5 cytosine-specific DNA methylase family protein [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46449573|gb|AAS96223.1| C-5 cytosine-specific DNA methylase family protein [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311233853|gb|ADP86707.1| DNA-cytosine methyltransferase [Desulfovibrio vulgaris RCH1]
          Length = 369

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKP 37
           + A D+GVPQ R+R++I+          +P  P    P
Sbjct: 168 LNARDYGVPQNRKRVFILGTAGGHTLPDWPPRPTHFAP 205


>gi|119511452|ref|ZP_01630563.1| modification methylase NlaIV [Nodularia spumigena CCY9414]
 gi|119463917|gb|EAW44843.1| modification methylase NlaIV [Nodularia spumigena CCY9414]
          Length = 433

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 34/93 (36%), Gaps = 19/93 (20%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-----PT--------------PLGIKPRLGD 41
           + + +FG+PQ R R+Y+I  LN + +F       P                      + D
Sbjct: 148 LNSANFGLPQNRVRIYLIGILNATPKFNLMSDVGPKDSHTYNPQQMSLFHKPKRPATVAD 207

Query: 42  ILEEHIDDKSTISNKLWEGHQKRKENNKIAGKG 74
           ILE++   K   S       ++   ++     G
Sbjct: 208 ILEDNPSSKYDCSPPFINALKRIFNDDLNRLHG 240


>gi|289167785|ref|YP_003446054.1| site-specific DNA methylase [Streptococcus mitis B6]
 gi|288907352|emb|CBJ22189.1| site-specific DNA methylase [Streptococcus mitis B6]
          Length = 351

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 35/95 (36%), Gaps = 7/95 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ R+R+  +   N   EF++P  LG        + +    ++ +       
Sbjct: 152 LLASDYGVPQNRKRVIFVGTRND--EFEYPEALGTIITTEMAISDLPTLENELGEIEMSY 209

Query: 61  HQKR-----KENNKIAGKGFGYGLFFENSATTNTL 90
             +      K   K +     +     +    +T+
Sbjct: 210 VSEPQNDYQKLMRKRSNVVLNHVAAKHSEKVISTI 244


>gi|260579295|ref|ZP_05847178.1| modification methylase NaeI (cytosine-specificmethyltransferase
           NaeI) (M.NaeI) [Corynebacterium jeikeium ATCC 43734]
 gi|258602594|gb|EEW15888.1| modification methylase NaeI (cytosine-specificmethyltransferase
           NaeI) (M.NaeI) [Corynebacterium jeikeium ATCC 43734]
          Length = 372

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           A DFGVPQ R R  ++    P  + F +P PL  +  +G+ L   + +        W 
Sbjct: 180 AADFGVPQLRPRFVLVALREPYADYFAWPEPLDTRVTVGEALHSLMAENGWPGADAWA 237


>gi|68536951|ref|YP_251655.1| putative DNA restriction-modification system, DNA methylase
           [Corynebacterium jeikeium K411]
 gi|68264550|emb|CAI38038.1| putative DNA restriction-modification system, DNA methylase
           [Corynebacterium jeikeium K411]
          Length = 341

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           A DFGVPQ R R  ++    P  + F +P PL  +  +G+ L   + +        W 
Sbjct: 149 AADFGVPQLRPRFVLVALREPYADYFAWPEPLDTRVTVGEALHSLMAENGWPGADAWA 206


>gi|294787738|ref|ZP_06752982.1| modification methylase NgoPII [Simonsiella muelleri ATCC 29453]
 gi|294484031|gb|EFG31714.1| modification methylase NgoPII [Simonsiella muelleri ATCC 29453]
          Length = 331

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 33/80 (41%), Gaps = 3/80 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A ++GV Q R+R++ I F    +++F+FP       +    L++ + D    +    E 
Sbjct: 145 NAKNYGVAQERKRVFYIGFRKDLNIKFQFPQGSTADDKHKLTLKDVMADLQKTAVPASE- 203

Query: 61  HQKRKENNKIAGKGFGYGLF 80
            +       I    +  G F
Sbjct: 204 -KNYANPQAINNNEYFTGSF 222


>gi|326567346|gb|EGE17461.1| type II DNA modification enzyme [Moraxella catarrhalis BC1]
          Length = 327

 Score = 54.2 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + +  +GVPQ R+R+Y +          FKFP P+ +   + D L +  D +  ++N  +
Sbjct: 144 LDSQYYGVPQMRQRVYFVGIRKDIKHMPFKFPQPI-LSKPIDDFLSDDRDYEFDVNNPTF 202

Query: 59  EGHQKRK 65
           + +   K
Sbjct: 203 QKYLASK 209


>gi|332361999|gb|EGJ39801.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           sanguinis SK49]
          Length = 480

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEE 45
           + + DFGVPQ RER++II           FP     +    + L+E
Sbjct: 176 LNSKDFGVPQNRERVFIIGHSRKKGTRLLFPFRREGQATNSETLKE 221


>gi|291320302|ref|YP_003515564.1| cytosine specific methyltransferase [Mycoplasma agalactiae]
 gi|290752635|emb|CBH40608.1| Cytosine specific methyltransferase [Mycoplasma agalactiae]
          Length = 339

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 39/100 (39%), Gaps = 15/100 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A D+ V Q+RERL +I   N  V    F FPT    K  L DIL +    +       
Sbjct: 153 LNALDYNVAQKRERLIVIGIRNDIVNKIKFSFPTKSKNKLVLKDILLDVPKSEGA----- 207

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97
            +  + +++  K+   G  +            +S  Y K 
Sbjct: 208 -KYSKAKEDIFKLVPPGGCWKDIDPK------ISKEYMKS 240


>gi|227485931|ref|ZP_03916247.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus lactolyticus ATCC
           51172]
 gi|227235976|gb|EEI85991.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus lactolyticus ATCC
           51172]
          Length = 318

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/77 (19%), Positives = 28/77 (36%), Gaps = 4/77 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK----FPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A ++G+PQ R R Y +       E      FP    ++  L D+++    +   IS  
Sbjct: 142 LNAKNYGIPQNRNRWYCVGVDKNHKELNLDDVFPGICELRYTLKDVIDCEYKEDYQISQI 201

Query: 57  LWEGHQKRKENNKIAGK 73
                +K         +
Sbjct: 202 ARNNIEKHIGLYLEKNQ 218


>gi|256544753|ref|ZP_05472125.1| type II restriction-modification system methylation subunit
           [Anaerococcus vaginalis ATCC 51170]
 gi|256399642|gb|EEU13247.1| type II restriction-modification system methylation subunit
           [Anaerococcus vaginalis ATCC 51170]
          Length = 320

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   D LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSDFLEKDVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFRGRLKVIKD-FSYTIS 235


>gi|119493084|ref|ZP_01624009.1| C-5 cytosine-specific DNA methylase [Lyngbya sp. PCC 8106]
 gi|119452829|gb|EAW34004.1| C-5 cytosine-specific DNA methylase [Lyngbya sp. PCC 8106]
          Length = 441

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37
           + A  +GVPQ+RERL+++          +P P    P
Sbjct: 165 LNAAYYGVPQKRERLFLLGCREDLALPNYPEPTFQPP 201


>gi|316984658|gb|EFV63622.1| modification methylase NlaIV [Neisseria meningitidis H44/76]
          Length = 171

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A DFG+PQ R+R+Y+   L    +  F       P+L +ILE     + S    KL +
Sbjct: 56  LNAKDFGIPQNRKRIYLTGSLKSKPDLSF--ETSPSPKLKNILESGLPTESSPFIKKLLK 113

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 114 KFPPSELYGKSVKDKRGGK 132


>gi|315917403|ref|ZP_07913643.1| type II restriction-modification system methylation subunit
           [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691278|gb|EFS28113.1| type II restriction-modification system methylation subunit
           [Fusobacterium gonidiaformans ATCC 25563]
          Length = 320

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 33/91 (36%), Gaps = 5/91 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG+PQ+RER++++  L  +  F F      + R  DI E    D S +     E 
Sbjct: 154 LNAMDFGIPQKRERIFVVSIL-GNNSFDFAKLEKTQTR--DISEFIEKDASNLYEVRQES 210

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                          G            T+S
Sbjct: 211 MLSHIRGEPKNNNFRGRLKVI--DKFAYTIS 239


>gi|319745928|gb|EFV98213.1| type II DNA modification methyltransferase [Streptococcus
           agalactiae ATCC 13813]
          Length = 454

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 29/83 (34%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + +F VPQ RER++II         F FP          + L       + ++ K+  
Sbjct: 151 LNSKNFQVPQNRERIFIIGHSRRYRPRFLFPLGRESSSTGLERLGNVNPSGNGMNGKV-- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 209 YLSSGLAPTLTRGKGEGTKIAIP 231


>gi|317012898|gb|ADU83506.1| type II DNA modification enzyme [Helicobacter pylori Lithuania75]
          Length = 318

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHHFVFPLGLANDYCFKDFLDA---DNECYLDVSNA 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 202 IFQRYLHNPYNHNRVFLENILTLENAVLDT 231


>gi|417325|sp|P15840|MTSI_SPISQ RecName: Full=CPG DNA methylase; AltName: Full=Cytosine-specific
           methyltransferase SssI; Short=M.SssI
 gi|66468|pir||CTYMCS site-specific DNA-methyltransferase (cytosine-specific) (EC
           2.1.1.73) SssI - Spiroplasma sp. (strain MQ1)
 gi|47553|emb|CAA35058.1| unnamed protein product [Spiroplasma sp.]
          Length = 386

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 45/115 (39%), Gaps = 16/115 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG  Q R R+++I  LN  V  + P        +  +L + + +K  ++N L   
Sbjct: 219 LNAADFGSSQARRRVFMISTLNEFV--ELPKGDKKPKSIKKVLNKIVSEKDILNNLLKYN 276

Query: 61  HQKRKENNKIAG--------KGFGYGLFFENSATTNTLSARYY------KDGSEI 101
             + K+              K    G  ++   T  TL+A         KDGS I
Sbjct: 277 LTEFKKTKSNINKASLIGYSKFNSEGYVYDPEFTGPTLTASGANSRIKIKDGSNI 331


>gi|317178577|dbj|BAJ56365.1| Type II DNA modification enzyme [Helicobacter pylori F30]
          Length = 318

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+   +      +    
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYYFEDFLDAGNE---CYLDTNNN 201

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 202 AFQRYLHNQYNHNRIFLENILTLENAVLDT 231


>gi|169823586|ref|YP_001691089.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328]
 gi|167832206|dbj|BAG09121.1| cytosine-specific methyltransferase [Finegoldia magna ATCC 29328]
          Length = 330

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 22/57 (38%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A D+GV Q R+R++ + F        F  P         + +   D K T    L
Sbjct: 142 LNASDYGVAQDRKRIFYVGFRKDL-NICFDNPPKKFNYKPTLKDAIYDLKDTAIPSL 197


>gi|169824652|ref|YP_001692263.1| cytosine-specific DNA-methyltransferase [Finegoldia magna ATCC
           29328]
 gi|297588631|ref|ZP_06947274.1| type II restriction-modification system methylation subunit
           [Finegoldia magna ATCC 53516]
 gi|304440076|ref|ZP_07399968.1| type II restriction-modification system methylation subunit
           [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|167831457|dbj|BAG08373.1| cytosine-specific DNA-methyltransferase [Finegoldia magna ATCC
           29328]
 gi|297574004|gb|EFH92725.1| type II restriction-modification system methylation subunit
           [Finegoldia magna ATCC 53516]
 gi|304371443|gb|EFM25057.1| type II restriction-modification system methylation subunit
           [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 320

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 39/92 (42%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSEFLEKDVSELYTMTQPYML 209

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
               +  +       F   L       + T+S
Sbjct: 210 KFLNKSID-----NSFRGRLKVIKD-FSYTIS 235


>gi|71274663|ref|ZP_00650951.1| C-5 cytosine-specific DNA methylase [Xylella fastidiosa Dixon]
 gi|71899625|ref|ZP_00681779.1| C-5 cytosine-specific DNA methylase [Xylella fastidiosa Ann-1]
 gi|71164395|gb|EAO14109.1| C-5 cytosine-specific DNA methylase [Xylella fastidiosa Dixon]
 gi|71730577|gb|EAO32654.1| C-5 cytosine-specific DNA methylase [Xylella fastidiosa Ann-1]
          Length = 329

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 23/59 (38%), Gaps = 2/59 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV-EFKFPTP-LGIKPRLGDILEEHIDDKSTISNKLW 58
            A D+GV Q R R+  +         F +P P     P +G++L + +          W
Sbjct: 157 NASDYGVSQLRPRVVFVGIRKDLASGFAWPEPLQNAPPTVGELLHDLMAANGWRGADRW 215


>gi|313890914|ref|ZP_07824537.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|313120711|gb|EFR43827.1| DNA (cytosine-5-)-methyltransferase [Streptococcus pseudoporcinus
           SPIN 20026]
          Length = 316

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   D LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSDFLEKDVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       T T+S
Sbjct: 209 ----LKFLNKGIDNSFRGRLKVIKD-FTYTIS 235


>gi|309789600|ref|ZP_07684181.1| BsaWI methylase [Oscillochloris trichoides DG6]
 gi|308228336|gb|EFO81983.1| BsaWI methylase [Oscillochloris trichoides DG6]
          Length = 436

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49
           + A ++GVPQ RERL+II   + S+   FPTP     +L  +    ++D
Sbjct: 173 LNAANYGVPQFRERLFIIATSDSSLPIIFPTPTHGYTKL--LPWNTVED 219


>gi|208435018|ref|YP_002266684.1| type II DNA modification enzyme [Helicobacter pylori G27]
 gi|208432947|gb|ACI27818.1| type II DNA modification enzyme [Helicobacter pylori G27]
          Length = 318

 Score = 54.2 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHID 48
           + + DF + Q+RERLYI+ F       F FP  L       D L+   +
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFKDFLDADNE 193


>gi|326779115|ref|ZP_08238380.1| DNA-cytosine methyltransferase [Streptomyces cf. griseus XylebKG-1]
 gi|326659448|gb|EGE44294.1| DNA-cytosine methyltransferase [Streptomyces cf. griseus XylebKG-1]
          Length = 433

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 41/103 (39%), Gaps = 5/103 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           ++A DFGVPQ R R  ++         ++F +PTP+G    + D LE+ ++ +      +
Sbjct: 197 LEASDFGVPQLRPRAVLVAIRADVLGDIKFVWPTPVGGVYSVFDALEKSMEARYEPYISM 256

Query: 58  WEGHQKRKENNKIA--GKGFGYGLFFENSATTNTLSARYYKDG 98
                K    +      +     L  ++     TL     K G
Sbjct: 257 GGKIGKIASESLSRWVREASRAALEKKDGGIAPTLVGGSKKHG 299


>gi|260886138|ref|ZP_05736578.2| modification methylase EcoRII [Prevotella tannerae ATCC 51259]
 gi|260850757|gb|EEX70626.1| modification methylase EcoRII [Prevotella tannerae ATCC 51259]
          Length = 427

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DFGVPQ RER+ II  L     F        KP L D L+E  D +    ++ 
Sbjct: 247 LNAADFGVPQNRERIIIIGSLKQPFVFSRLVKQPRKP-LVDFLDESGDFEYLDPSEY 302


>gi|254368946|ref|ZP_04984959.1| modification methylase FnuDI [Francisella tularensis subsp.
          holarctica FSC022]
 gi|157121867|gb|EDO66037.1| modification methylase FnuDI [Francisella tularensis subsp.
          holarctica FSC022]
          Length = 220

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDD 49
          + + DF VPQ R+R++ +         F F T    K  L D + +  + 
Sbjct: 29 LNSSDFKVPQDRQRVFFVGIRKDLGFNFNFSTNTYPKITLKDAIWDLRES 78


>gi|254779672|ref|YP_003057778.1| M.HpyAVIII, a type II cytosine specific DNA methyltransferase
           [Helicobacter pylori B38]
 gi|254001584|emb|CAX29633.1| M.HpyAVIII, a type II cytosine specific DNA methyltransferase
           [Helicobacter pylori B38]
          Length = 318

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHID 48
           + + DF + Q+RERLYI+ F       F FP  L       D L+   +
Sbjct: 145 LNSADFQLAQKRERLYIVGFRKDLKHPFNFPLGLANDYCFNDFLDADNE 193


>gi|169544173|ref|YP_001692948.1| methylase [Yersinia enterocolitica]
 gi|168218357|emb|CAP20100.1| methylase [Yersinia enterocolitica]
          Length = 481

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 40/106 (37%), Gaps = 15/106 (14%)

Query: 1   MKACDFGVPQRRERLYIID----------FLNPSVEFKFPTPLGIKPRLGDILEEHIDDK 50
           + + D+G  + R+R+ +I           + +  + F           L DI E   DD 
Sbjct: 298 IDSRDYGSIEERKRMLVIGVSVGLTNVVSYFDDEIAF---YKKECIQTLNDIFEPIADDH 354

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           +      +     ++  +  AGKGF   L   ++    T+   Y+K
Sbjct: 355 TAWKE--YSYLADKEIRDLKAGKGFKRQLLTGDNNKCGTIGRGYHK 398


>gi|254285523|ref|ZP_04960487.1| modification methylase Eco47II [Vibrio cholerae AM-19226]
 gi|150424385|gb|EDN16322.1| modification methylase Eco47II [Vibrio cholerae AM-19226]
          Length = 417

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 33/80 (41%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +KA  + VPQ+RERL ++         V+F +P+P      L D         + +    
Sbjct: 222 LKAIFYKVPQKRERLILVGIRKDLAQKVKFHWPSPYKRVMTLRDAFYAGELYTTDVPKSD 281

Query: 58  WEGHQKRKENNKIAGKGFGY 77
            + + +RK+         GY
Sbjct: 282 GQSYPQRKKEILSEVPQGGY 301


>gi|227503804|ref|ZP_03933853.1| DNA restriction-modification system, DNA methylase [Corynebacterium
           striatum ATCC 6940]
 gi|227199628|gb|EEI79676.1| DNA restriction-modification system, DNA methylase [Corynebacterium
           striatum ATCC 6940]
          Length = 455

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 1/60 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           ++A D+GVPQ R R  ++   N     F +P  +     +G  L   + +      + W 
Sbjct: 264 LQAADYGVPQLRPRFILVALKNEFANYFAWPKVVKSHTPVGTALLPLMAENGWPGAEAWA 323


>gi|60202518|gb|AAX14650.1| BbvCI methyltransferase 1 [Brevibacillus brevis]
          Length = 429

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLG 34
           + A +FGVPQ RERL I       +  F +P P  
Sbjct: 170 LNAANFGVPQFRERLIIAAVCKSEANNFFWPEPTH 204


>gi|67925212|ref|ZP_00518579.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
 gi|67852948|gb|EAM48340.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
          Length = 417

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 28/74 (37%), Gaps = 8/74 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A  FGVPQ+R+R++I+      V  +F  P P        +         +  S +L 
Sbjct: 225 LSAASFGVPQKRDRIFIVGLKKDQVSKQFIIPKPTH------NFAHLLPSKNNYNSKQLS 278

Query: 59  EGHQKRKENNKIAG 72
             H    EN     
Sbjct: 279 LFHSFSSENQDHNL 292


>gi|237703954|ref|ZP_04534435.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|226901866|gb|EEH88125.1| DNA-cytosine methyltransferase [Escherichia sp. 3_2_53FAA]
          Length = 367

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------SVEFKFPTPLGIKPRLGDI 42
           + A D+GVPQ R+R++I    N       ++EF  P      P   ++
Sbjct: 128 LNARDYGVPQNRKRVFIAGVRNDILKKRNNIEFP-PQATHFNPNSNEV 174


>gi|291566149|dbj|BAI88421.1| type II DNA modification methyltransferase [Arthrospira platensis
           NIES-39]
          Length = 379

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 4/57 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A ++G+PQRRER++I+        E+ FP        L  +L          +N 
Sbjct: 171 LDAENYGIPQRRERVFIVGVREDWQREWSFPQESH---SLESLLWSQYVSFDYWNNH 224


>gi|284052085|ref|ZP_06382295.1| DNA-cytosine methyltransferase [Arthrospira platensis str. Paraca]
          Length = 382

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 4/57 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A ++G+PQRRER++I+        E+ FP        L  +L          +N 
Sbjct: 174 LDAENYGIPQRRERVFIVGVREDWQREWSFPQESH---SLESLLWSQYVSFDYWNNH 227


>gi|127447|sp|P25266|MTE1_HERAU RecName: Full=Modification methylase HgiEI; Short=M.HgiEI; AltName:
           Full=Cytosine-specific methyltransferase HgiEI
 gi|43471|emb|CAA38944.1| methyltransferase [Herpetosiphon aurantiacus]
          Length = 437

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 1   MKACDFGVPQRRERLYIIDF--LNPSVEFKFPTPLGIKPRLGDILEE 45
           + + DFGV Q R+R++I+          F FP       RL  IL+ 
Sbjct: 146 LNSFDFGVAQNRDRVFIVGIQQKLDLNGFSFPEYAESDQRLYHILDN 192


>gi|300791025|ref|YP_003771316.1| DNA (cytosine-5-)-methyltransferase [Amycolatopsis mediterranei
           U32]
 gi|299800539|gb|ADJ50914.1| DNA (cytosine-5-)-methyltransferase [Amycolatopsis mediterranei
           U32]
          Length = 435

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 32/71 (45%), Gaps = 7/71 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + ACDFGVPQ R R  ++       + FK+P P+  +  +   + +       +    WE
Sbjct: 163 LNACDFGVPQLRPRFVLVAMQEDDAKYFKWPEPVAKQLTVSAAIHDL------MGANGWE 216

Query: 60  GHQKRKENNKI 70
           G ++  ++   
Sbjct: 217 GLEQWMKDADK 227


>gi|238786362|ref|ZP_04630295.1| Methylase [Yersinia bercovieri ATCC 43970]
 gi|238712733|gb|EEQ04812.1| Methylase [Yersinia bercovieri ATCC 43970]
          Length = 466

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/106 (19%), Positives = 40/106 (37%), Gaps = 15/106 (14%)

Query: 1   MKACDFGVPQRRERLYIID----------FLNPSVEFKFPTPLGIKPRLGDILEEHIDDK 50
           + + D+G  + R+R+ +I           + +  + F           L DI E   DD 
Sbjct: 283 IDSRDYGSIEERKRMLVIGVSVGLTNVVSYFDDEIAF---YKKECIQTLNDIFEPIADDH 339

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           +      +     ++  +  AGKGF   L   ++    T+   Y+K
Sbjct: 340 TAWKE--YSYLADKEIRDLKAGKGFKRQLLTGDNNKCGTIGRGYHK 383


>gi|307152624|ref|YP_003888008.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
 gi|306982852|gb|ADN14733.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
          Length = 708

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 39/99 (39%), Gaps = 14/99 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL------GDILEEHIDDKSTIS 54
           + A D+GVPQRR+RL+ +        +K+P    +          G++          ++
Sbjct: 169 LNASDYGVPQRRQRLFCVAH---QSVWKWPAQTHLHHPYTAGEALGELALIVPAKAKFLT 225

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
               +  Q+ +  +K       +      +A + T++ R
Sbjct: 226 LSQDQYIQRYEAASKCINPRDIH-----LNAPSRTVTCR 259


>gi|288801979|ref|ZP_06407420.1| modification methylase HaeIII (Cytosine-specific methyltransferase
           HaeIII) [Prevotella melaninogenica D18]
 gi|288335414|gb|EFC73848.1| modification methylase HaeIII (Cytosine-specific methyltransferase
           HaeIII) [Prevotella melaninogenica D18]
          Length = 336

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 31/88 (35%), Gaps = 17/88 (19%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A DF VP+ R R++ I F       ++++P P   KP L + + +             
Sbjct: 144 LNANDFDVPEDRNRVFYIGFRKDLHINDYEYPLPQKHKPTLREAIWD------------- 190

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSAT 86
              Q+     +      G      N+  
Sbjct: 191 --LQETAIPAREKNHTNGDACIVPNNEY 216


>gi|325285907|ref|YP_004261697.1| DNA-cytosine methyltransferase [Cellulophaga lytica DSM 7489]
 gi|324321361|gb|ADY28826.1| DNA-cytosine methyltransferase [Cellulophaga lytica DSM 7489]
          Length = 414

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDIL 43
           +KA ++ VPQ+RER+ ++       +++++P P      L D L
Sbjct: 219 LKAINYKVPQKRERVILVGVRKDIDIKYEYPKPHNKIYNLIDAL 262


>gi|268589649|ref|ZP_06123870.1| modification methylase Eco47II [Providencia rettgeri DSM 1131]
 gi|291314961|gb|EFE55414.1| modification methylase Eco47II [Providencia rettgeri DSM 1131]
          Length = 424

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 38/101 (37%), Gaps = 3/101 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +KA  + VPQ+RERL ++      V    + +P+P      + D L+      + +    
Sbjct: 219 LKAIFYQVPQKRERLILVAIRKDLVNSIKYDWPSPYHKVMTMRDALKAGELFDTDVPKSD 278

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
            + + KRK+         GY            +   YY  G
Sbjct: 279 GQKYPKRKQEILSLVPQGGYWRDLPEELQKEYMQKSYYLGG 319


>gi|297380299|gb|ADI35186.1| DNA-cytosine methyltransferase [Helicobacter pylori v225d]
          Length = 264

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHID 48
           + + DF + Q+RERLYI+ F       F FP  L       D L+   +
Sbjct: 91  LNSADFQLAQKRERLYIVGFRKDLKHPFDFPLGLANDYCFKDFLDADNE 139


>gi|168207191|ref|ZP_02633196.1| modification methylase ScrFIB [Clostridium perfringens E str.
           JGS1987]
 gi|170661387|gb|EDT14070.1| modification methylase ScrFIB [Clostridium perfringens E str.
           JGS1987]
          Length = 310

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 36/92 (39%), Gaps = 10/92 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-PRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ R R++ I  L  ++ F F      + P + + LEE +D+K  +      
Sbjct: 149 LNAMDFGLPQDRNRVFTISILGENL-FDFDKLEKKETPHIKEFLEEIVDEKYIVR----- 202

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
             Q            F   L         T++
Sbjct: 203 --QPSMLRRIGVSGNFKGRLEIIED-HCKTIT 231


>gi|148988375|ref|ZP_01819822.1| cytosine specific DNA methyltransferase [Streptococcus pneumoniae
           SP6-BS73]
 gi|147926056|gb|EDK77130.1| cytosine specific DNA methyltransferase [Streptococcus pneumoniae
           SP6-BS73]
          Length = 351

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 34/95 (35%), Gaps = 7/95 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ R+R+  +   N    F++P  LG        + +    ++ +       
Sbjct: 152 LLASDYGVPQNRKRVIFVGTRND--GFEYPEALGTIITTEMAISDLPTLENELGEIEMSY 209

Query: 61  HQKR-----KENNKIAGKGFGYGLFFENSATTNTL 90
             +      K   K +     +     +    +T+
Sbjct: 210 VSEPQNDYQKLMRKRSNVVLNHVAAKHSEKVISTI 244


>gi|23100791|ref|NP_694258.1| cytosine-specific methyltransferase [Oceanobacillus iheyensis
           HTE831]
 gi|50897489|sp|Q8EL95|MT36_OCEIH RecName: Full=Putative modification methylase OB3336; AltName:
           Full=Cytosine-specific methyltransferase; AltName:
           Full=M.OihORF3336P
 gi|22779025|dbj|BAC15292.1| cytosine-specific methyltransferase [Oceanobacillus iheyensis
           HTE831]
          Length = 460

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKP 37
           + A DFGVPQ R RL+++       + KF P P     
Sbjct: 177 LNAADFGVPQTRVRLFVMAIKKDIGKIKFIPEPTHKPH 214


>gi|327463101|gb|EGF09422.1| modification methylase DdeI [Streptococcus sanguinis SK1]
          Length = 351

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 38/95 (40%), Gaps = 7/95 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+GVPQ R+R+  +   N    F++PT LG        L +    ++ + +     
Sbjct: 152 LLASDYGVPQNRKRVIFVGTKND--GFEYPTSLGTTITTEMALSDLPTLENELGDAEMVY 209

Query: 61  HQKRKENNKIAGKG-----FGYGLFFENSATTNTL 90
             + K N +   +        +     +   T+T+
Sbjct: 210 VSEPKNNYQKLMRKQSSVVLNHIAAKHSEKVTSTI 244


>gi|227112465|ref|ZP_03826121.1| putative C-5 cytosine-specific DNA methylase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 390

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 3/43 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKF-PTPLGIKPRLG 40
           + A D+GVPQ R+R++I            KF P P    P  G
Sbjct: 164 INAVDYGVPQNRKRVFIFGIHEDLNNSTIKFPPKPTHHSPNSG 206


>gi|322412375|gb|EFY03283.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 401

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 23/111 (20%), Positives = 31/111 (27%), Gaps = 17/111 (15%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP----------------TPLGIKPRLGDIL 43
           + + DF VPQ RER++II         F FP                 P G        L
Sbjct: 98  LNSKDFQVPQNRERIFIIGHSRRYRPRFLFPLRGENSAASLERLGNVNPSGKGMNGEVYL 157

Query: 44  EEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARY 94
              +    T                    K      F  N     TL+++Y
Sbjct: 158 SRGLAPTLTRGKGEGTKIAIPVLTPDRLEKRQHGRRFKGNDNPMFTLTSQY 208


>gi|262192113|ref|ZP_06050275.1| DNA-cytosine methyltransferase [Vibrio cholerae CT 5369-93]
 gi|262032024|gb|EEY50600.1| DNA-cytosine methyltransferase [Vibrio cholerae CT 5369-93]
          Length = 393

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 31/102 (30%), Gaps = 15/102 (14%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV---EFKF-PTPLGIKPRLGDILEEHIDDKST----- 52
            A D+GVPQ R+R++I              F P P       G                 
Sbjct: 165 NAKDYGVPQNRKRVFIYGLRQDLDTDSNHVFPPEPTHFSATSGKHPHWVTASSVFEKIPK 224

Query: 53  -ISNKLWEGHQKRK-----ENNKIAGKGFGYGLFFENSATTN 88
            + ++ W+ + K K     E          YG   + +   N
Sbjct: 225 ELYDQYWDKYFKIKTKLTYEQTITLLSSLTYGEKLKENDPCN 266


>gi|12229863|sp|Q59605|MTB5_NEIGO RecName: Full=Modification methylase NgoBV; Short=M.NgoBV; AltName:
           Full=Cytosine-specific methyltransferase NgoBV;
           Short=M.NgoV
 gi|1165242|gb|AAA86268.1| M.NgoV DNA methylase [Neisseria gonorrhoeae]
          Length = 423

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH-IDDKSTISNKLWE 59
           + A +FG+PQ R+R+Y+   L    +  F       P+L +ILE     + S    KL +
Sbjct: 158 LNAKEFGIPQNRKRIYLTGSLKSKPDLSF--ETSPSPKLKNILESGLPTESSPFIKKLLK 215

Query: 60  GHQKRKENNKIAGKGFGYG 78
                +   K      G  
Sbjct: 216 KFPPSELYGKSVKDKRGGK 234


>gi|313884351|ref|ZP_07818113.1| putative modification methylase BanI [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312620429|gb|EFR31856.1| putative modification methylase BanI [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 335

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFL---NPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A  FGV Q+R+RL +I         ++F++P   G    L D+L++  D      ++
Sbjct: 146 LNAAYFGVGQKRQRLIVIGIRSDLKDKIDFEYPKEDGEMTILRDVLKDVPDSPYQPYSE 204


>gi|314055098|ref|YP_004063436.1| cytosine-specific methyltransferase [Ostreococcus tauri virus 2]
 gi|313574989|emb|CBI70002.1| cytosine-specific methyltransferase [Ostreococcus tauri virus 2]
          Length = 315

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 33/94 (35%), Gaps = 11/94 (11%)

Query: 8   VPQRRERLYIIDFLN----PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
           VPQ RER+YI+ F +     +  F F           D +E  + DK   S+K       
Sbjct: 153 VPQHRERIYIVGFRDKELHDNFNFDFVEGDKGNLC--DFMESCVPDKYYYSDKYKVFDMI 210

Query: 64  RKENNKIAGKGFGYG-----LFFENSATTNTLSA 92
                K   +   Y      +    S    TL+A
Sbjct: 211 NSNVVKNISENVIYQYRRYYVRENKSNLCPTLTA 244


>gi|302876802|ref|YP_003845435.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
 gi|307687485|ref|ZP_07629931.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
 gi|302579659|gb|ADL53671.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
          Length = 363

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31
           + A D+G+PQ R+R++ +   N   EF+FP 
Sbjct: 155 LYAPDYGIPQIRKRVFFVGLRNSDTEFEFPE 185


>gi|212694208|ref|ZP_03302336.1| hypothetical protein BACDOR_03734 [Bacteroides dorei DSM 17855]
 gi|212663274|gb|EEB23848.1| hypothetical protein BACDOR_03734 [Bacteroides dorei DSM 17855]
          Length = 370

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 16/104 (15%), Positives = 34/104 (32%), Gaps = 11/104 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL----GIKPRLGDILEEHIDDKSTISN 55
           + A D+ VPQ RER++++        +  +   +       P + + L       +  + 
Sbjct: 155 LNATDYNVPQARERIFVVGIRGDEHKKPNWEKMILKYRHKAPTVRETLSVLDKAGTGNNK 214

Query: 56  KLWEGHQKRKENNKIAGKGF------GYGLFFENSATTNTLSAR 93
            + +       N  +    +      G G        + TL A 
Sbjct: 215 GVCKAKITLCLNPVLRKSPYAGMLFNGLGRPTRIDGYSATLPAS 258


>gi|224543136|ref|ZP_03683675.1| hypothetical protein CATMIT_02336 [Catenibacterium mitsuokai DSM
           15897]
 gi|224523923|gb|EEF93028.1| hypothetical protein CATMIT_02336 [Catenibacterium mitsuokai DSM
           15897]
          Length = 430

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 33/84 (39%), Gaps = 2/84 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  FG+PQ R+R+YI+         +      +   L D+LE  I    +   +L   
Sbjct: 159 LNAKYFGIPQERKRIYIVGTKKEKPNLE--KFHRLDCSLADVLETGIPTMDSKFTRLLLK 216

Query: 61  HQKRKENNKIAGKGFGYGLFFENS 84
           H   +E    A K    G    +S
Sbjct: 217 HYSVEELFGKAIKDKRGGNNNIHS 240


>gi|218245850|ref|YP_002371221.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|257058898|ref|YP_003136786.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|218166328|gb|ACK65065.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|256589064|gb|ACU99950.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 418

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 16/96 (16%), Positives = 33/96 (34%), Gaps = 7/96 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A ++GVPQ RERL+++      +   +P  +             ++     +  +WE 
Sbjct: 157 LNAANYGVPQNRERLFLLGCQKGLILPNYPQAISYNFTNKSEPNNQLNLPKCPT--VWEA 214

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
            +   E            +  +    +N     Y K
Sbjct: 215 IKDLPEVENYPELEKQDWVIADYKKPSN-----YGK 245


>gi|121703830|ref|XP_001270179.1| C-5 cytosine methyltransferase DmtA [Aspergillus clavatus NRRL 1]
 gi|119398323|gb|EAW08753.1| C-5 cytosine methyltransferase DmtA [Aspergillus clavatus NRRL 1]
          Length = 617

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 37/103 (35%), Gaps = 7/103 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   D+GVPQ R+RL II      V   FP P    P  G +    I+   +        
Sbjct: 454 LNCMDYGVPQPRKRLVIIASGPGEVLPPFPRPTHGLPGSGLLPYATINSVISNIPP--NA 511

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSAR-----YYKDG 98
                E  +I G+  G    F  +    T++       Y+  G
Sbjct: 512 LDHDIEGARIRGRRNGLRAPFSPNQQAKTITCSGGENNYHPSG 554


>gi|302551692|ref|ZP_07304034.1| modification methylase NaeI [Streptomyces viridochromogenes DSM
           40736]
 gi|302469310|gb|EFL32403.1| modification methylase NaeI [Streptomyces viridochromogenes DSM
           40736]
          Length = 415

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A ++GVPQ R R  ++   +   + F +P        +G  L++ +  K  +  + W 
Sbjct: 144 LHANNYGVPQLRPRFVLVAMRHEDAQWFNWPEEKPTTQTVGTALQDMMAAKGWLGAEAWA 203


>gi|217964683|ref|YP_002350361.1| cytosine-specific methyltransferase [Listeria monocytogenes HCC23]
 gi|217333953|gb|ACK39747.1| cytosine-specific methyltransferase [Listeria monocytogenes HCC23]
          Length = 340

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 38/102 (37%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKP-RLGDILEEHIDDKSTISNKLW 58
           + + DFGVPQ RER++II  L  +   + FP     +      ++   +  +   S +  
Sbjct: 148 LNSKDFGVPQNRERVFIIGHLRGAGGREIFPLAEASRTADESRVIANTLTARYPYSQREG 207

Query: 59  EGHQKRKENNK--------IAGKGFGYGLFFENSATTNTLSA 92
              +  +++ +           K      F        TL+A
Sbjct: 208 TYIETTRKSEQVMPVLTPDRIIKRQNGRRFKTLGEPAFTLTA 249


>gi|192292294|ref|YP_001992899.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris TIE-1]
 gi|192286043|gb|ACF02424.1| DNA-cytosine methyltransferase [Rhodopseudomonas palustris TIE-1]
          Length = 500

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 34/96 (35%), Gaps = 5/96 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG-IKPRLGDILEEHIDDKSTISNKLW 58
           + A  +GVPQ RER+++I +     +  +FP P   +    G      +  K    +   
Sbjct: 185 LNAARYGVPQMRERMFLIAYRKELQQTVEFPKPTHWVDLPAGYEGSRAVALKLLSRDLFS 244

Query: 59  E-GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           E GH     +     K               T+ AR
Sbjct: 245 ESGHYVPAPDAGRNLKPAVTAKQAIGDLP--TIYAR 278


>gi|319744417|gb|EFV96775.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           agalactiae ATCC 13813]
          Length = 450

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 30/84 (35%), Gaps = 3/84 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP          + L         ++ ++  
Sbjct: 151 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFPLRGENSSAGLERLGNVNPSGKGMNGEV-- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFEN 83
              +        GKG G  +   +
Sbjct: 209 YLSRGIAPTLTRGKGEGTKILTPD 232


>gi|310657622|ref|YP_003935343.1| cytosine-specific methyltransferase [Clostridium sticklandii DSM
           519]
 gi|308824400|emb|CBH20438.1| Cytosine-specific methyltransferase [Clostridium sticklandii]
          Length = 344

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 31/73 (42%), Gaps = 2/73 (2%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62
           A D+GVPQ R+R+  +   +   EF+FP  +         L +    +  + N+    ++
Sbjct: 150 ASDYGVPQSRKRVIFVGHQDK--EFEFPEKMNTYVTCEMALSDLPPLEDCLGNEESPYYK 207

Query: 63  KRKENNKIAGKGF 75
             + + +   +  
Sbjct: 208 DPQNDYQQIMRQH 220


>gi|262171500|ref|ZP_06039178.1| modification methylase PspPI (Cytosine-specific methyltransferase
           PspPI) (M.PspPI) [Vibrio mimicus MB-451]
 gi|261892576|gb|EEY38562.1| modification methylase PspPI (Cytosine-specific methyltransferase
           PspPI) (M.PspPI) [Vibrio mimicus MB-451]
          Length = 416

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 32/87 (36%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +KA  F VPQ+RERL ++           F +P+P      L D         + +    
Sbjct: 222 LKAIFFKVPQKRERLILVGIRKDLANSVEFHWPSPYKKIMTLRDAFYAGELYATDVPQSP 281

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
            + + +RK          GY     +S
Sbjct: 282 GQVYPERKRQIMDYVPQGGYWRDLPDS 308


>gi|255280633|ref|ZP_05345188.1| modification methylase DdeI [Bryantella formatexigens DSM 14469]
 gi|255269098|gb|EET62303.1| modification methylase DdeI [Bryantella formatexigens DSM 14469]
          Length = 378

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 15/33 (45%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
            A D+GVPQ R R  +I       +  FP P  
Sbjct: 152 NAADYGVPQARPRFVLIGIRGFDKKITFPQPTH 184


>gi|163755904|ref|ZP_02163021.1| modification methylase (Eco47II, Sau96I) [Kordia algicida OT-1]
 gi|161324075|gb|EDP95407.1| modification methylase (Eco47II, Sau96I) [Kordia algicida OT-1]
          Length = 413

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 33/78 (42%), Gaps = 1/78 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +KA ++ VPQ+RERL ++       +++ +P P      L D L++     + +      
Sbjct: 219 LKAINYKVPQKRERLILVGIRKDIDIKYDYPKPHNKIYNLSDALKKGELYDNNVPKSEGS 278

Query: 60  GHQKRKENNKIAGKGFGY 77
            +   K+         GY
Sbjct: 279 KYPDHKKEVLDLVPPKGY 296


>gi|307570754|emb|CAR83933.1| C-5 cytosine-specific DNA methylase [Listeria monocytogenes L99]
 gi|307572166|emb|CAR85345.1| C-5 cytosine-specific DNA methylase [Listeria monocytogenes L99]
          Length = 426

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 38/102 (37%), Gaps = 10/102 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKP-RLGDILEEHIDDKSTISNKLW 58
           + + DFGVPQ RER++II  L  +   + FP     +      ++   +  +   S +  
Sbjct: 148 LNSKDFGVPQNRERVFIIGHLRGAGGREIFPLAEASRTADESRVIANTLTARYPYSQREG 207

Query: 59  EGHQKRKENNK--------IAGKGFGYGLFFENSATTNTLSA 92
              +  +++ +           K      F        TL+A
Sbjct: 208 TYIETTRKSEQVMPVLTPDRIIKRQNGRRFKTLGEPAFTLTA 249


>gi|296393591|ref|YP_003658475.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985]
 gi|296180738|gb|ADG97644.1| DNA-cytosine methyltransferase [Segniliparus rotundus DSM 44985]
          Length = 372

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 2/36 (5%)

Query: 3   ACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIK 36
           A D+GVPQ+R R+ +I          F FP P    
Sbjct: 155 AADYGVPQQRWRVLVIGIREDQNPEGFAFPEPTHSF 190


>gi|289423024|ref|ZP_06424844.1| putative site-specific DNA-methyltransferase [Peptostreptococcus
           anaerobius 653-L]
 gi|289156598|gb|EFD05243.1| putative site-specific DNA-methyltransferase [Peptostreptococcus
           anaerobius 653-L]
          Length = 706

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDILEEHIDDKSTISNKL 57
           + A +FGVPQ RER+ I+  LN    F F          +   L++  D +       
Sbjct: 147 LNARNFGVPQNRERIIIVGNLNGRA-FDFTKLKTNTIETMKPFLDKVADFEILPKESY 203


>gi|160939011|ref|ZP_02086362.1| hypothetical protein CLOBOL_03905 [Clostridium bolteae ATCC
          BAA-613]
 gi|158437974|gb|EDP15734.1| hypothetical protein CLOBOL_03905 [Clostridium bolteae ATCC
          BAA-613]
          Length = 226

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 30/72 (41%), Gaps = 2/72 (2%)

Query: 2  KACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIK-PRLGDILEEHIDDKSTISNKLWE 59
           +  + VPQ R+R  ++      ++ F FP       P+L D LE+ + +K  + ++  +
Sbjct: 3  NSKYWNVPQNRDRYAVVGTRNKKNLSFTFPKEQHEFVPKLSDYLEKDVPEKYYLPDEKAQ 62

Query: 60 GHQKRKENNKIA 71
              +       
Sbjct: 63 TIIAQAMEKLEK 74


>gi|311899150|dbj|BAJ31558.1| putative modification methylase [Kitasatospora setae KM-6054]
          Length = 430

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 33/102 (32%), Gaps = 4/102 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLG-IKPRLGDILEEHIDDKSTISNKLW 58
           ++A  FGVPQ R R  ++         F +P         + D L++ +  +  ++    
Sbjct: 173 LEAASFGVPQLRPRAILVAIRKDLYRGFTWPKRTEAEGRTVFDALDKSMRKRFGMNPGKA 232

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENS--ATTNTLSARYYKDG 98
            G    +       +   +      +      TL     K G
Sbjct: 233 PGLDSEELREAAKARYRVWRDTARPAVPGVAPTLVGGSKKHG 274


>gi|254416815|ref|ZP_05030564.1| DNA-cytosine methyltransferase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196176361|gb|EDX71376.1| DNA-cytosine methyltransferase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 391

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 30/79 (37%), Gaps = 12/79 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK--------PRLGDILEEHID---D 49
           ++A D+GVPQ RER+  I     S    FP     +          L D L   ++   +
Sbjct: 187 LQAADYGVPQNRERVVFIGSR-DSESVTFPLATHCQSGRDLPKWRTLRDALTNLVEQNPE 245

Query: 50  KSTISNKLWEGHQKRKENN 68
            +  S K  +  +  K   
Sbjct: 246 FTPYSEKRLKYLRLLKSGQ 264


>gi|1709163|sp|P50188|MTN1_NOCAE RecName: Full=Modification methylase NaeI; Short=M.NaeI; AltName:
           Full=Cytosine-specific methyltransferase NaeI
 gi|775103|gb|AAC43325.1| NaeI modification methyltransferase [Lechevalieria aerocolonigenes]
          Length = 413

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHI 47
           + A DFGVPQ R R  ++   N     F +P P G  P +G+ L++ +
Sbjct: 148 LHASDFGVPQLRPRFVLVALQNKFAPYFTWPEPTGAAPTVGETLKDLM 195


>gi|290891561|ref|ZP_06554618.1| hypothetical protein AWRIB429_2008 [Oenococcus oeni AWRIB429]
 gi|290478814|gb|EFD87481.1| hypothetical protein AWRIB429_2008 [Oenococcus oeni AWRIB429]
          Length = 382

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/105 (20%), Positives = 37/105 (35%), Gaps = 14/105 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISN---- 55
           + + +FGVPQ RER++II  L      + FP        +  I+        +  +    
Sbjct: 149 LNSKNFGVPQNRERVFIIGHLRGERGREVFPITRENSGAIKRIVNGRESHGHSTYDVFGT 208

Query: 56  -------KLWEG--HQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                  K  +G   Q +   N         G  +++     TL+
Sbjct: 209 DGISPTLKTMQGGNLQPKILVNVNPSGNGMNGNVYDSDGLAPTLT 253


>gi|291299135|ref|YP_003510413.1| DNA-cytosine methyltransferase [Stackebrandtia nassauensis DSM
           44728]
 gi|290568355|gb|ADD41320.1| DNA-cytosine methyltransferase [Stackebrandtia nassauensis DSM
           44728]
          Length = 437

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 32/89 (35%), Gaps = 5/89 (5%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
            A DFGVPQ R+R+ I+ F +      + +        G+ L   + D S          
Sbjct: 200 NAADFGVPQIRQRVIIVAFRSDL-RVDWDSFRPRPRYSGEALWASMRDGSYWDRHKVPSR 258

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTL 90
            +R+   ++        L  +      TL
Sbjct: 259 VRRRVMRELPDAP----LVEDGLKPWRTL 283


>gi|37693466|dbj|BAC99051.1| chloroplast-resident DNA methyltransferase [Chlamydomonas
            reinhardtii]
          Length = 1344

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
            + A ++GVPQ R+R++II  L   V   +P P+   
Sbjct: 1006 LNAGNYGVPQSRKRVFIIAALPEEVLPNWPRPMHSF 1041


>gi|20278869|dbj|BAB91073.1| chloroplast-resident DNA methyltransferase [Chlamydomonas
            reinhardtii]
          Length = 1344

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
            + A ++GVPQ R+R++II  L   V   +P P+   
Sbjct: 1006 LNAGNYGVPQSRKRVFIIAALPEEVLPNWPRPMHSF 1041


>gi|299820316|gb|ADJ54326.1| C5-cytosine specific methylase [archaeon enrichment culture clone
           1(2010)]
          Length = 396

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 37/107 (34%), Gaps = 15/107 (14%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHID----------- 48
           + + D+GVPQ+R RL+ I    +   +   PTP   +  +  I                 
Sbjct: 147 LNSADYGVPQKRFRLFTIGIHRSLGKKPSLPTPTHSEKPVVTIFGTMPTWLTLREAIQDI 206

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGL---FFENSATTNTLSA 92
                +  L +   +R +  +   KG  +G             T+S+
Sbjct: 207 MNIPPTTILRQEQVERIKRERENTKGIHWGKMEFPDNLDRPARTISS 253


>gi|309389435|gb|ADO77315.1| DNA-cytosine methyltransferase [Halanaerobium praevalens DSM 2228]
          Length = 328

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK 50
           ++  D+G+PQRR+R+ I+   +    F+FP        + D +++    K
Sbjct: 152 LQTSDYGIPQRRKRIIIVGTKD--YTFEFPKKNNSVITVKDAIDDLPTLK 199


>gi|307067513|ref|YP_003876479.1| site-specific DNA methylase [Streptococcus pneumoniae AP200]
 gi|306409050|gb|ADM84477.1| Site-specific DNA methylase [Streptococcus pneumoniae AP200]
          Length = 321

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++ +L  +  F F      + R   + LE  + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSYLGAN-NFSFNKLERKETRPLSEFLENDVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFRGRLKVIKD-FSYTIS 235


>gi|226330016|ref|ZP_03805534.1| hypothetical protein PROPEN_03929 [Proteus penneri ATCC 35198]
 gi|225200811|gb|EEG83165.1| hypothetical protein PROPEN_03929 [Proteus penneri ATCC 35198]
          Length = 325

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 40/101 (39%), Gaps = 3/101 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +KA  + VPQ+RERL +I        S+ + +P+P      + D L+     ++ +    
Sbjct: 120 LKAIFYQVPQKRERLILIAIRKDLVNSINYTWPSPYHKVMTMRDALKAGELFETDVPKSE 179

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
            + + KRK+         GY            +   YY  G
Sbjct: 180 GQKYPKRKQEILSLVPQGGYWRDLPEELQKEYMQKSYYLGG 220


>gi|303285300|ref|XP_003061940.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226456351|gb|EEH53652.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 341

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 39/120 (32%), Gaps = 25/120 (20%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV---EFKFPTPL-GIKPRLGDILEEHI---------- 47
            A  + VPQ R+R+Y++ F   +     F++P         + DILEE +          
Sbjct: 150 DAKGW-VPQSRKRVYLVGFRKDAALATPFRWPPRRDDCGGTVDDILEEEVEEESPDDGYD 208

Query: 48  ------DDKSTISNKLWEGHQKRKENNKIAGKG----FGYGLFFENSATTNTLSARYYKD 97
                 D     S ++ E    R                  LF E      TL A Y K 
Sbjct: 209 ADVEDDDANVFTSCEVSEYQMDRASAYFKRVHHREPDHPGFLFAETGGVARTLCASYRKS 268


>gi|295104578|emb|CBL02122.1| DNA-methyltransferase (dcm) [Faecalibacterium prausnitzii SL3/3]
          Length = 293

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 27/74 (36%), Gaps = 6/74 (8%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG----DILEEHIDDKSTISNKLW 58
           A D+GVPQ RER+  +       EF  P P    P         LE H  DK    + +W
Sbjct: 143 AEDYGVPQTRERVIFVGTRKTLPEFVPPKPSVFAPITAYEALHDLENHPQDKDF--SHIW 200

Query: 59  EGHQKRKENNKIAG 72
              +   E      
Sbjct: 201 SKAKVSGEQGNRKL 214


>gi|319939117|ref|ZP_08013481.1| modification methylase BsuRI [Streptococcus anginosus 1_2_62CV]
 gi|319812167|gb|EFW08433.1| modification methylase BsuRI [Streptococcus anginosus 1_2_62CV]
          Length = 434

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE------FKFPTPLGIKPRLGDIL 43
            A D+GVPQ RER++++      +E      ++ PTP        ++L
Sbjct: 232 NARDYGVPQSRERVFLVGVHKEKIEKKYGYRYELPTPTHGDGTEINLL 279


>gi|300868191|ref|ZP_07112823.1| Cytosine-specific methyltransferase [Oscillatoria sp. PCC 6506]
 gi|300333815|emb|CBN58007.1| Cytosine-specific methyltransferase [Oscillatoria sp. PCC 6506]
          Length = 395

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 29/78 (37%), Gaps = 13/78 (16%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK---------PRLGDILEEHIDDKS 51
           + A D+GVPQ RER+  I +   S     P P   +           L D L+  ID + 
Sbjct: 192 LNAADYGVPQVRERVIFIGY-KGSDSVTLPLPTHSQSGVSRLPKWITLKDGLKGLIDPQP 250

Query: 52  ---TISNKLWEGHQKRKE 66
                S    +  +  K 
Sbjct: 251 EYIPYSEARLKYLRLLKA 268


>gi|254804928|ref|YP_003083149.1| putative type II DNA modification methylase [Neisseria meningitidis
           alpha14]
 gi|254668470|emb|CBA05754.1| putative type II DNA modification methylase [Neisseria meningitidis
           alpha14]
          Length = 312

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKP-RLGDILEEHIDDKSTISNKLW 58
           + A D+GV Q R R+  +   N     FK+P P   +P  +G++L + + + +      W
Sbjct: 144 LYAADYGVSQLRPRVLFVALKNEYTNFFKWPEPNSEQPKTVGELLFDLMSENNWQGAHNW 203


>gi|194098495|ref|YP_002001557.1| DNA modification methylase [Neisseria gonorrhoeae NCCP11945]
 gi|239998889|ref|ZP_04718813.1| DNA modification methylase [Neisseria gonorrhoeae 35/02]
 gi|240115566|ref|ZP_04729628.1| DNA modification methylase [Neisseria gonorrhoeae PID18]
 gi|240125661|ref|ZP_04738547.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679]
 gi|254493672|ref|ZP_05106843.1| DNA modification methylase [Neisseria gonorrhoeae 1291]
 gi|260440624|ref|ZP_05794440.1| DNA modification methylase [Neisseria gonorrhoeae DGI2]
 gi|268594728|ref|ZP_06128895.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae 35/02]
 gi|268601236|ref|ZP_06135403.1| DNA modification methylase [Neisseria gonorrhoeae PID18]
 gi|268684247|ref|ZP_06151109.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679]
 gi|291043935|ref|ZP_06569651.1| DNA modification methylase [Neisseria gonorrhoeae DGI2]
 gi|193933785|gb|ACF29609.1| DNA modification methylase [Neisseria gonorrhoeae NCCP11945]
 gi|226512712|gb|EEH62057.1| DNA modification methylase [Neisseria gonorrhoeae 1291]
 gi|268548117|gb|EEZ43535.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae 35/02]
 gi|268585367|gb|EEZ50043.1| DNA modification methylase [Neisseria gonorrhoeae PID18]
 gi|268624531|gb|EEZ56931.1| DNA modification methylase [Neisseria gonorrhoeae SK-92-679]
 gi|291012398|gb|EFE04387.1| DNA modification methylase [Neisseria gonorrhoeae DGI2]
 gi|317164179|gb|ADV07720.1| DNA modification methylase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 312

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKP-RLGDILEEHIDDKSTISNKLW 58
           + A D+GV Q R R+  +   N     FK+P P   +P  +G++L + + + +      W
Sbjct: 144 LYAADYGVSQLRPRVLFVALKNEYTNFFKWPEPNSEQPKTVGELLFDLMSENNWQGAHNW 203


>gi|216171|gb|AAA32604.1| DNA methyltransferase [Bacillus phage SPR]
          Length = 439

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 37/113 (32%), Gaps = 30/113 (26%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RERLYII                                   S  F++ 
Sbjct: 149 LNSKFFNVPQNRERLYIIGIREDLIKNEEWSLDFKRKDILQKGKQRLVELDIKSFNFRWT 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFEN 83
                  RL D+LEE++D+K  ++        K    +++        +   N
Sbjct: 209 AQSAATKRLKDLLEEYVDEKYYLNEDKTNSLIKELSTSRLNENLTVEQVGNIN 261


>gi|400287|sp|P31033|MTM4_NEIGO RecName: Full=Modification methylase NgoMIV; Short=M.NgoMIV;
           AltName: Full=Cytosine-specific methyltransferase NgoMIV
          Length = 312

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKP-RLGDILEEHIDDKSTISNKLW 58
           + A D+GV Q R R+  +   N     FK+P P   +P  +G++L + + + +      W
Sbjct: 144 LYAADYGVSQLRPRVLFVALKNEYTNFFKWPEPNSEQPKTVGELLFDLMSENNWQGAHNW 203


>gi|59801274|ref|YP_207986.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA 1090]
 gi|240014199|ref|ZP_04721112.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae DGI18]
 gi|240016634|ref|ZP_04723174.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA6140]
 gi|240080823|ref|ZP_04725366.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA19]
 gi|240112810|ref|ZP_04727300.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae MS11]
 gi|240117858|ref|ZP_04731920.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae PID1]
 gi|240121762|ref|ZP_04734724.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae PID24-1]
 gi|240123416|ref|ZP_04736372.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae PID332]
 gi|240128118|ref|ZP_04740779.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268596944|ref|ZP_06131111.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA19]
 gi|268598881|ref|ZP_06133048.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae MS11]
 gi|268603557|ref|ZP_06137724.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae PID1]
 gi|268682037|ref|ZP_06148899.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae PID332]
 gi|268686505|ref|ZP_06153367.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae SK-93-1035]
 gi|293399137|ref|ZP_06643302.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|5051442|emb|CAB44950.1| DNA modification methylase [Neisseria gonorrhoeae]
 gi|5262959|emb|CAB45015.2| DNA modification methylase [Neisseria gonorrhoeae]
 gi|59718169|gb|AAW89574.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA 1090]
 gi|268550732|gb|EEZ45751.1| DNA modification methylase M.NGOI [Neisseria gonorrhoeae FA19]
 gi|268583012|gb|EEZ47688.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae MS11]
 gi|268587688|gb|EEZ52364.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae PID1]
 gi|268622321|gb|EEZ54721.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae PID332]
 gi|268626789|gb|EEZ59189.1| DNA-cytosine methyltransferase [Neisseria gonorrhoeae SK-93-1035]
 gi|291610551|gb|EFF39661.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
          Length = 312

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKP-RLGDILEEHIDDKSTISNKLW 58
           + A D+GV Q R R+  +   N     FK+P P   +P  +G++L + + + +      W
Sbjct: 144 LYAADYGVSQLRPRVLFVALKNEYTNFFKWPEPNSEQPKTVGELLFDLMSENNWQGAHNW 203


>gi|330882498|gb|EGH16647.1| DNA-cytosine methyltransferase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 335

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTP-LGIKPRLGDILEEHI 47
           + A D+GV Q R R+  +       + F +P P L   P +G +L + +
Sbjct: 162 LNASDYGVSQLRPRVVFVGIQKKYADKFHWPEPGLVQPPTVGQLLHDLM 210


>gi|145301342|ref|YP_001144182.1| C-5 cytosine-specific DNA methylase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142856119|gb|ABO92434.1| C-5 cytosine-specific DNA methylase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 541

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG---DILEEHIDDKSTISNKL 57
           +   +FGV + R+RL ++   +    F       ++ +     DILE    D      K 
Sbjct: 281 LDGNEFGVIEARKRLCVVAVSHGIDGFDLEQVQPVRTKESCINDILEPIPLDSQRW--KS 338

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYK 96
           ++   +++  +K AGKGF   L         T+   Y K
Sbjct: 339 FDYLAEKELRDKAAGKGFARQLLAGAETFCGTVGKGYSK 377


>gi|315222611|ref|ZP_07864500.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211]
 gi|315188297|gb|EFU22023.1| DNA (cytosine-5-)-methyltransferase [Streptococcus anginosus F0211]
          Length = 317

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 34/92 (36%), Gaps = 7/92 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +   F     +     +   LEE + +   +  +   
Sbjct: 153 LNAMDFGIPQKRERIFVVSILGENYFNFSSLEKIE-AKDISKFLEEDVSNLYEVKQESML 211

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
            H             F   L         T+S
Sbjct: 212 SH----IRGDPKNNHFKGRLKVI-DKFAYTIS 238


>gi|289423000|ref|ZP_06424820.1| modification methylase ScrFIB [Peptostreptococcus anaerobius 653-L]
 gi|289156574|gb|EFD05219.1| modification methylase ScrFIB [Peptostreptococcus anaerobius 653-L]
          Length = 329

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 34/91 (37%), Gaps = 5/91 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A +FG+PQ+RER++++  L  +  F F      + R  DI E    D S +     E 
Sbjct: 165 LNAIEFGIPQKRERIFVVSIL-GNNSFDFAKLEKTQTR--DISEFLEKDASNLYEVRQES 221

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
             +            G            T+S
Sbjct: 222 MLRYIRGEPKNNNFRGRLKVI--DKFAYTIS 250


>gi|78776322|ref|YP_392637.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM
           1251]
 gi|78496862|gb|ABB43402.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM
           1251]
          Length = 395

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 35/107 (32%), Gaps = 13/107 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE------------FKFPTPLGIKPRLGDILEEHID 48
           + A D+GVPQ RER++ I      +               +P              + + 
Sbjct: 197 LNAADYGVPQSRERVFFIGIRRDLINDLTINMLINNELSLYPPQTHDYKNDFVSTSDILS 256

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
           D     +     HQK  +  K  GK          +  + T+ A ++
Sbjct: 257 DLPEPEDSSDISHQKYSK-AKWYGKHCQGQTEINPAGLSPTIRAEHH 302


>gi|91206207|ref|YP_538562.1| site-specific DNA methylase [Rickettsia bellii RML369-C]
 gi|91069751|gb|ABE05473.1| Site-specific DNA methylase [Rickettsia bellii RML369-C]
          Length = 308

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 41/103 (39%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-----SVEFKFPTPLGIKPRLGDILEEHIDDKSTI-- 53
           + A  FGVPQ RER+Y +          ++++  P        L DILE+ ID    I  
Sbjct: 142 LNASLFGVPQARERVYFVCLRKDFSSEYNLKYIKPKESYENVFLNDILEKDIDKNLYIDR 201

Query: 54  SNKLWEGH----QKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
           S+ +   +    Q +        KG      +     + TLSA
Sbjct: 202 SDIVLNANSVEKQLKPIRIGQVNKGGQGERIYSPLGHSITLSA 244


>gi|238788388|ref|ZP_04632182.1| DNA-cytosine methyltransferase [Yersinia frederiksenii ATCC 33641]
 gi|238723634|gb|EEQ15280.1| DNA-cytosine methyltransferase [Yersinia frederiksenii ATCC 33641]
          Length = 380

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 5/60 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-----FPTPLGIKPRLGDILEEHIDDKSTISN 55
           +   D+GVPQ R+R+  I       +        PTP    P     L   +  K  IS+
Sbjct: 154 LNTADYGVPQTRKRIIAIGVKAELFDINQLPAFPPTPTHCSPDKNSALPAWVTVKDAISD 213


>gi|225561042|gb|EEH09323.1| C-5 cytosine methyltransferase DmtA [Ajellomyces capsulatus G186AR]
          Length = 650

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 36/106 (33%), Gaps = 8/106 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG---DILEEHIDDKSTISNKL 57
           +   D+GVPQ R+RL I+          FP P    P       I    +    TI + +
Sbjct: 467 LNCRDYGVPQSRQRLVILASGPGEPLPPFPKPTHTSPNTQINTTISTALLPPFRTIHDAI 526

Query: 58  WEGHQKRKENNKIAGKGFGYGLF-FENSATTNTLSA----RYYKDG 98
            +      +++    +        ++      T++      Y+  G
Sbjct: 527 SKIPPHHPDHDIQYARSRPLNRPTYDPHTQARTITCNGGENYHPSG 572


>gi|325069024|ref|ZP_08127697.1| modification methylase XorII [Actinomyces oris K20]
          Length = 201

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 17/46 (36%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G PQ R R  +I          FP P       GD+    
Sbjct: 152 LNAADYGAPQARRRAVLIGHRYDMAVPGFPEPTHSPDGGGDLPPYR 197


>gi|313888225|ref|ZP_07821897.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845756|gb|EFR33145.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 321

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSEFLEKDVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFKGRLKVIKD-FSYTIS 235


>gi|300727022|ref|ZP_07060441.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Prevotella
           bryantii B14]
 gi|299775566|gb|EFI72157.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Prevotella
           bryantii B14]
          Length = 446

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 32/80 (40%), Gaps = 3/80 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A DFG+PQ+R+R+YI+        +  +F  P  IK   G I        +  +  L 
Sbjct: 159 LDASDFGIPQKRKRVYIVGCKKRFGEINLEFNNP-KIKTVEGCIEHGLPVLDNKFTKLLL 217

Query: 59  EGHQKRKENNKIAGKGFGYG 78
             +  +K   K      G  
Sbjct: 218 SYYSPKKLQGKFLKDKRGGK 237


>gi|313677760|ref|YP_004055756.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
 gi|312944458|gb|ADR23648.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
          Length = 346

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 33/91 (36%), Gaps = 5/91 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DF VPQ R R + +   N   EF+FP P+    ++          K ++ +     
Sbjct: 152 LLASDFAVPQNRRRAFFVGLKNSL-EFEFPKPITTDNKITSEEAISDLPKDSLEDGCQYT 210

Query: 61  HQKRKENNKIAGKG----FGYGLFFENSATT 87
              +    +    G    F + +   +  T 
Sbjct: 211 INPKSVFQREMRNGNKVVFNHQITNHSEKTV 241


>gi|127431|sp|P00476|MTBS_BPSPR RecName: Full=Modification methylase SPRI; Short=M.SPRI; AltName:
           Full=Cytosine-specific methyltransferase SPRI
 gi|224091|prf||1010250A methyltransferase
          Length = 439

 Score = 52.7 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 37/113 (32%), Gaps = 30/113 (26%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RERLYII                                   S  F++ 
Sbjct: 149 LNSKFFNVPQNRERLYIIGIREDLIKNEEWSLDFKRKDILQKGKQRLVELDIKSFNFRWT 208

Query: 31  TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFEN 83
                  RL D+LEE++D+K  ++        K    +++        +   N
Sbjct: 209 AQSAATKRLKDLLEEYVDEKYYLNEDKTNSLIKELSTSRLNENLTVEQVGNIN 261


>gi|315611977|ref|ZP_07886895.1| C-5 cytosine-specific DNA methylase [Streptococcus sanguinis ATCC
           49296]
 gi|315315966|gb|EFU64000.1| C-5 cytosine-specific DNA methylase [Streptococcus sanguinis ATCC
           49296]
          Length = 359

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP 23
           + + DFGVPQ RER++I+  L  
Sbjct: 147 LNSKDFGVPQNRERVFIVGHLRG 169


>gi|325678040|ref|ZP_08157677.1| putative modification methylase BspRI [Ruminococcus albus 8]
 gi|324110257|gb|EGC04436.1| putative modification methylase BspRI [Ruminococcus albus 8]
          Length = 358

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 4/38 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLG 34
           + ACD+GVPQ R+R++ +      +    +F FPTP  
Sbjct: 150 LTACDYGVPQARKRVFFVGVNKSKIKHTEKFVFPTPTH 187


>gi|300813808|ref|ZP_07094115.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus sp. oral taxon
           836 str. F0141]
 gi|300512098|gb|EFK39291.1| DNA (cytosine-5-)-methyltransferase [Peptoniphilus sp. oral taxon
           836 str. F0141]
          Length = 321

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSEFLEKDVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFRGRLKVIKD-FSYTIS 235


>gi|195867543|ref|ZP_03079546.1| type II restriction-modification system methylation subunit
           [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
 gi|195867960|ref|ZP_03079957.1| type II restriction-modification system methylation subunit
           [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
 gi|195660356|gb|EDX53616.1| type II restriction-modification system methylation subunit
           [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
 gi|195660787|gb|EDX54041.1| type II restriction-modification system methylation subunit
           [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
          Length = 323

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSEFLEKDVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFKGRLKVIKD-FSYTIS 235


>gi|300124212|gb|ADJ68008.1| M.BanII [Aneurinibacillus aneurinilyticus]
          Length = 385

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/104 (16%), Positives = 37/104 (35%), Gaps = 11/104 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFK--FPTPLGIKPRLGDILEE------HIDD 49
           + +  +GVPQ+RER++ + FLN       F+            + + +          + 
Sbjct: 149 LNSSHYGVPQKRERVFFVGFLNKVLDPQAFQSRIEQKKQKAKSVRETIMHLGPAGTDNNP 208

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           ++  +          +++        G G   +    +NTL A 
Sbjct: 209 QTCTAKITLATKPVMRKSPYAGMIFNGMGRPLKLDDLSNTLPAS 252


>gi|313891845|ref|ZP_07825450.1| putative modification methylase HhaI [Dialister microaerophilus
           UPII 345-E]
 gi|313119839|gb|EFR43026.1| putative modification methylase HhaI [Dialister microaerophilus
           UPII 345-E]
          Length = 394

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/110 (20%), Positives = 39/110 (35%), Gaps = 18/110 (16%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISN----- 55
            + D+GVPQ RER+YI+  L      +  P     +  L  +++    D+    +     
Sbjct: 153 NSKDYGVPQNRERVYIVGHLGERCGRELLPVARKSERALKKVIDGSQGDRVYEPDLSCTL 212

Query: 56  -------KLWEGHQKRKENNKIAGKGFGYGL-----FFENSATTNTLSAR 93
                      G    ++  K      G G      + E +    TL+AR
Sbjct: 213 SSQGGGMGAKTGLYMIQKGCKFRYPERGVGKRTASGYVELTNIAGTLTAR 262


>gi|262402827|ref|ZP_06079388.1| type II restriction-modification system methylation subunit [Vibrio
           sp. RC586]
 gi|262351609|gb|EEZ00742.1| type II restriction-modification system methylation subunit [Vibrio
           sp. RC586]
          Length = 341

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL 33
           +KA DF VPQ R R+ I+   +  +  + FP P+
Sbjct: 155 LKASDFEVPQNRHRVIIVGVRHDVNNNYTFPEPI 188


>gi|303233873|ref|ZP_07320524.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna BVS033A4]
 gi|302495017|gb|EFL54772.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna BVS033A4]
          Length = 315

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+++ +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSEFLEKNVSELYTMTQPYML 209

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
               +  +       F   L       + T+S
Sbjct: 210 KFLNKCID-----NSFRGRLKVIKD-FSYTIS 235


>gi|218441171|ref|YP_002379500.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424]
 gi|218173899|gb|ACK72632.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7424]
          Length = 415

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/54 (20%), Positives = 25/54 (46%), Gaps = 1/54 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDILEEHIDDKSTI 53
           + A ++GVPQ R+RL+++         K+P      K  + + +++  +     
Sbjct: 161 LNAANYGVPQNRKRLFLLGGKKNLPPLKYPEAISDKKTTVWEAIQDLPEVNDYP 214


>gi|326772743|ref|ZP_08232027.1| modification methylase XorII [Actinomyces viscosus C505]
 gi|326637375|gb|EGE38277.1| modification methylase XorII [Actinomyces viscosus C505]
          Length = 364

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 17/46 (36%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEH 46
           + A D+G PQ R R  +I          FP P       GD+    
Sbjct: 152 LNAADYGAPQARRRAVLIGHRYDMAVPGFPEPTHSPDGGGDLPPYR 197


>gi|150400370|ref|YP_001324137.1| DNA-cytosine methyltransferase [Methanococcus vannielii SB]
 gi|150013073|gb|ABR55525.1| DNA-cytosine methyltransferase [Methanococcus vannielii SB]
          Length = 368

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/105 (19%), Positives = 38/105 (36%), Gaps = 14/105 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLG---------IKPRLGDILEEHIDDK 50
           +   D+GVPQ R R+ I+   N  V +  +P P+                D L + ID K
Sbjct: 190 LNTADYGVPQTRIRVIIMGIRNDYVGDIMYPKPVRGNEGLFEWMTSKEAIDDLWDKIDSK 249

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
              ++   +  + +    K     +           + T+ A ++
Sbjct: 250 EVFNHSSKDYSKAKFYPGKKMQGNYK----ILADRPSITIRAEHH 290


>gi|20385949|gb|AAM21516.1|AF438205_2 GST-M.SPRX methyltransferase fusion protein [Mutation screening
           vector pSPRX]
          Length = 659

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 37/113 (32%), Gaps = 30/113 (26%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP------------------------------SVEFKFP 30
           + +  F VPQ RERLYII                                   S  F++ 
Sbjct: 375 LNSKFFNVPQNRERLYIIGIREDLIKNEEWSLDFKRKDILQKGKQRLVELDIKSFNFRWT 434

Query: 31  TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFEN 83
                  RL D+LEE++D+K  ++        K    +++        +   N
Sbjct: 435 AQSAATKRLKDLLEEYVDEKYYLNEDKTNSLIKELSTSRLNENLTVEQVGNIN 487


>gi|170754579|ref|YP_001781640.1| DNA-cytosine methyltransferase [Clostridium botulinum B1 str. Okra]
 gi|169119791|gb|ACA43627.1| DNA-cytosine methyltransferase [Clostridium botulinum B1 str. Okra]
          Length = 444

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 32/83 (38%), Gaps = 8/83 (9%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTIS------ 54
           A D+GVPQ RER++++       +  F +P     + R    +      K   S      
Sbjct: 187 ASDYGVPQNRERVFLVAINEKYGDNKFIYPEKTHGEGRKYPYITVGEAFKYLPSLNSGGG 246

Query: 55  NKLWEGHQKRKENNKIAGKGFGY 77
            ++ + H   +E  K      G+
Sbjct: 247 EEIQQIHYYYEEEYKNNKISEGF 269


>gi|281491831|ref|YP_003353811.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
 gi|281375542|gb|ADA65048.1| C-5 cytosine-specific DNA methylase [Lactococcus lactis subsp.
           lactis KF147]
          Length = 347

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31
           + A DFGVPQ+R R+  +   N   +F FP 
Sbjct: 153 LVASDFGVPQKRRRIVFVGLQNDVFDFNFPE 183


>gi|30019096|ref|NP_830727.1| Type II restriction-modification system methylation subunit
           [Bacillus cereus ATCC 14579]
 gi|29894639|gb|AAP07928.1| Type II restriction-modification system methylation subunit
           [Bacillus cereus ATCC 14579]
          Length = 373

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL 33
           +KA D+GVPQ+R R+  + F     V +KFP P 
Sbjct: 163 LKASDYGVPQQRYRVIFVAFRKDLDVNYKFPLPT 196


>gi|154277578|ref|XP_001539629.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150413214|gb|EDN08597.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 699

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/106 (17%), Positives = 36/106 (33%), Gaps = 8/106 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG---DILEEHIDDKSTISNKL 57
           +   D+GVPQ R+RL I+          FP P    P       I    +    TI + +
Sbjct: 467 LNCRDYGVPQSRQRLVILASGPGEPLPPFPKPTHASPNTQVNTTITTALLPPFRTIHDAI 526

Query: 58  WEGHQKRKENNKIAGKGFGYGLF-FENSATTNTLSA----RYYKDG 98
            +      +++    +        ++      T++      Y+  G
Sbjct: 527 SKIPPHHPDHDIQYARSRPLNRPTYDPHTQARTITCNGGENYHPSG 572


>gi|158320926|ref|YP_001513433.1| DNA-cytosine methyltransferase [Alkaliphilus oremlandii OhILAs]
 gi|158141125|gb|ABW19437.1| DNA-cytosine methyltransferase [Alkaliphilus oremlandii OhILAs]
          Length = 423

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 37/94 (39%), Gaps = 12/94 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEHID-------DKS 51
           M A DFGV Q R+R+ II +     EF +P       +  + ++LE+          DK 
Sbjct: 205 MDAKDFGVLQSRKRVIIIGWRKDL-EFDYPIFESDDKEFTVNNLLEDLPKINSGEIYDKF 263

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSA 85
               K+ +  Q      ++      + +   N+ 
Sbjct: 264 RYRKKINKYLQN--TQLRVEDDIITHHIARPNNE 295


>gi|298735876|ref|YP_003728401.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
 gi|298355065|emb|CBI65937.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
          Length = 312

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q+RERLYI+ F       F FP  L       D L+    D     +    
Sbjct: 139 LNSTDFQLAQKRERLYIVGFRKDLKHPFHFPLGLANDYYFEDFLDA---DNECYLDVSNA 195

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             Q+   N     + F   +    +A  +T
Sbjct: 196 IFQRYLHNPYNHNRVFLENILTLENAVLDT 225


>gi|320007884|gb|ADW02734.1| DNA-cytosine methyltransferase [Streptomyces flavogriseus ATCC
           33331]
          Length = 660

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 41/102 (40%), Gaps = 3/102 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A  +GVPQ R+RL ++   N    F +        +  L D + +        + ++ +
Sbjct: 201 DAWKYGVPQHRKRLILLA-RNDVERFSWRQELEQEQRTTLRDAIGDLPVLPVVPTERVGQ 259

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
                 E ++++G G     +       + ++ R  KD +EI
Sbjct: 260 RELPYDEPSELSGFGKDMRKWARKDRVWDHMTRRVRKDDAEI 301


>gi|302873652|ref|YP_003842285.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
 gi|307686624|ref|ZP_07629070.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
 gi|302576509|gb|ADL50521.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
          Length = 445

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/112 (22%), Positives = 45/112 (40%), Gaps = 14/112 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-------LGDILEEHIDDKSTI 53
           M A ++GVPQRR R+  I + +  V  ++P P   +         + D++ E        
Sbjct: 182 MDAANYGVPQRRNRVIFIAYRDDVVAPQYPEPTVTEETKLTIEDAITDLIRERRVRNRIF 241

Query: 54  SNKLWEGHQKR-----KENNKIAGKGFGYGLFFENSATTNTLSARY--YKDG 98
           + +L +  Q        + N       G     E S+ T  +  R+  +K+G
Sbjct: 242 NGRLSQFQQDSINGRTPDINGNTINSNGVIYNNEVSSHTPIIKERFSLFKEG 293


>gi|147919344|ref|YP_686920.1| C-5 cytosine-specific DNA methyltransferase [uncultured
           methanogenic archaeon RC-I]
 gi|110622316|emb|CAJ37594.1| C-5 cytosine-specific DNA methyltransferase [uncultured
           methanogenic archaeon RC-I]
          Length = 419

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 30/74 (40%), Gaps = 3/74 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL--GDILEEHIDDKSTISNKLW 58
           + A +F V Q R+R+ II +        +P     +      D+L +  + K    +++ 
Sbjct: 200 LNASNFNVLQNRKRIIIIGWKKEY-NLSYPDFAKSQTPYIINDLLSDLPELKPGCGSEIS 258

Query: 59  EGHQKRKENNKIAG 72
                R +  + +G
Sbjct: 259 NYTGDRTKYLQESG 272


>gi|78778033|ref|YP_394348.1| DNA (cytosine-5-)-methyltransferase., Type II site-specific
           deoxyribonuclease [Sulfurimonas denitrificans DSM 1251]
 gi|78498573|gb|ABB45113.1| DNA (cytosine-5-)-methyltransferase., Type II site-specific
           deoxyribonuclease [Sulfurimonas denitrificans DSM 1251]
          Length = 657

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDIL 43
           +KA D+G+PQ R R ++I F +  +   F FP  + +K  + D+ 
Sbjct: 160 IKASDYGLPQLRPRTFMIGFRDEDILKGFNFPPKIPLKFNMSDVW 204


>gi|187923153|ref|YP_001894795.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN]
 gi|187714347|gb|ACD15571.1| DNA-cytosine methyltransferase [Burkholderia phytofirmans PsJN]
          Length = 317

 Score = 52.7 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 28/78 (35%), Gaps = 10/78 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDI---------LEEHIDDK 50
           M A DFGV Q R+R+ I+       VE+ FP     +    D+         L +    +
Sbjct: 144 MNAQDFGVAQERKRIIIVGIRKDLGVEYAFPYATHGEHGEKDLATIRDALDGLPDWPTGE 203

Query: 51  STISNKLWEGHQKRKENN 68
                  W    + +  +
Sbjct: 204 FCEDPFHWYYMSRNRRRD 221


>gi|328947436|ref|YP_004364773.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
 gi|328447760|gb|AEB13476.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
          Length = 439

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 4/86 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + + DF +PQ+RER Y + FL+ + +F FP    I   L DI++    D+   S KL + 
Sbjct: 240 LSSLDFELPQKRERWYCVGFLSKT-DFVFPAGTKIHKNLRDIIDLDNQDE---SLKLPKF 295

Query: 61  HQKRKENNKIAGKGFGYGLFFENSAT 86
              R   +    K     +  +NS  
Sbjct: 296 ELDRIAYHFEMAKNKTDRVKHDNSKY 321


>gi|237737311|ref|ZP_04567792.1| DNA-cytosine methyltransferase [Fusobacterium mortiferum ATCC 9817]
 gi|229421173|gb|EEO36220.1| DNA-cytosine methyltransferase [Fusobacterium mortiferum ATCC 9817]
          Length = 407

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFP--TPLGIKPRLGDILEEHIDDK 50
           + A DFGVPQ R+R+ II + N    FK+P    +     +  +  +    K
Sbjct: 194 LDAKDFGVPQSRKRVIIIGWKNEL-NFKYPNFETIKNDITINQLFADLPKIK 244


>gi|228982443|ref|ZP_04142702.1| Cytosine-specific methyltransferase [Bacillus thuringiensis Bt407]
 gi|228776626|gb|EEM24934.1| Cytosine-specific methyltransferase [Bacillus thuringiensis Bt407]
          Length = 418

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/100 (15%), Positives = 42/100 (42%), Gaps = 6/100 (6%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE-FKFPTP--LGIKPRLGDILEEHIDDKSTISNKLW 58
              ++G+PQ R+R++++   +   + F+FP    +  +  + D + +  +    +++   
Sbjct: 159 DCYEYGIPQHRKRVFMVGIRSNLGKTFEFPEIVSISERKTIRDAIGDLPNPDKVMNS--L 216

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTL-SARYYKD 97
           +  Q   +         GYG+  +     + +     +KD
Sbjct: 217 KDIQYEAQEQSSVHNHVGYGIRSDEKEFVHKIPVGGNWKD 256


>gi|229490017|ref|ZP_04383870.1| modification methylase DdeI [Rhodococcus erythropolis SK121]
 gi|229323118|gb|EEN88886.1| modification methylase DdeI [Rhodococcus erythropolis SK121]
          Length = 431

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLG 34
            A D+GVPQ RER++I+     S     +FP    
Sbjct: 242 NAQDYGVPQFRERVFIVATRRDSGIGPLRFPPKTH 276


>gi|226307434|ref|YP_002767394.1| modification methylase [Rhodococcus erythropolis PR4]
 gi|226186551|dbj|BAH34655.1| putative modification methylase [Rhodococcus erythropolis PR4]
          Length = 444

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLG 34
            A D+GVPQ RER++I+     S     +FP    
Sbjct: 255 NAQDYGVPQFRERVFIVATRRDSSIGPLRFPPKTH 289


>gi|159477134|ref|XP_001696666.1| cytosine-C5 specific DNA methyltransferase [Chlamydomonas
            reinhardtii]
 gi|158282891|gb|EDP08643.1| cytosine-C5 specific DNA methyltransferase [Chlamydomonas
            reinhardtii]
          Length = 1333

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
            + A ++GVPQ R+R++II  L   V   +P P+   
Sbjct: 994  LNAGNYGVPQSRQRVFIIAALPEEVLPNWPRPMHSF 1029


>gi|238765010|ref|ZP_04625947.1| DNA-cytosine methyltransferase [Yersinia kristensenii ATCC 33638]
 gi|238696779|gb|EEP89559.1| DNA-cytosine methyltransferase [Yersinia kristensenii ATCC 33638]
          Length = 338

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 5/60 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-----FPTPLGIKPRLGDILEEHIDDKSTISN 55
           +   D+GVPQ R+R+  I       +        PTP    P     L   +  K  IS+
Sbjct: 150 LNTADYGVPQTRKRVIAIGVKAELFDINQLPAFPPTPTHCSPDKNSALPAWVTVKDAISD 209


>gi|257062089|ref|YP_003139977.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|256592255|gb|ACV03142.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 456

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 7/80 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHID----DKSTI 53
           + + DFG+ Q R+R++I+           F FP PL + P+L + +E         K   
Sbjct: 173 LNSYDFGLSQDRDRVFIVGIHQQIENAAQFSFPEPLNLSPKLYEFIEGIEKQELVKKKFS 232

Query: 54  SNKLWEGHQKRKENNKIAGK 73
            + L+EG             
Sbjct: 233 PDILFEGKIPASRGRFQKND 252


>gi|229126345|ref|ZP_04255362.1| Cytosine-specific methyltransferase [Bacillus cereus BDRD-Cer4]
 gi|228657116|gb|EEL12937.1| Cytosine-specific methyltransferase [Bacillus cereus BDRD-Cer4]
          Length = 363

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL 33
           +KA D+GVPQ+R R+  + F     V +KFP P 
Sbjct: 153 LKASDYGVPQQRYRVIFVAFRKDLDVNYKFPLPT 186


>gi|254225219|ref|ZP_04918832.1| C-5 cytosine-specific DNA methylase superfamily [Vibrio cholerae
           V51]
 gi|125622318|gb|EAZ50639.1| C-5 cytosine-specific DNA methylase superfamily [Vibrio cholerae
           V51]
          Length = 303

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 17/47 (36%), Gaps = 4/47 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV---EFKF-PTPLGIKPRLGDILE 44
            A D+GVPQ R+R++I              F P P       G    
Sbjct: 75  NAKDYGVPQNRKRVFIYGLRQDLDTDSNHVFPPEPTHFSATSGKHPH 121


>gi|53804329|ref|YP_114062.1| C-5 cytosine-specific DNA methylase family protein [Methylococcus
           capsulatus str. Bath]
 gi|53758090|gb|AAU92381.1| C-5 cytosine-specific DNA methylase family protein [Methylococcus
           capsulatus str. Bath]
          Length = 345

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 4/61 (6%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID----DKSTISNKLW 58
           A D+GVPQ RER+ I+  L     F+ P P+    R     +   D    D+    N +W
Sbjct: 196 AADYGVPQTRERVLIVGTLPGVKPFEPPKPIISPSRYITAKQAIDDLAALDEDEEINHVW 255

Query: 59  E 59
            
Sbjct: 256 S 256


>gi|225017397|ref|ZP_03706589.1| hypothetical protein CLOSTMETH_01323 [Clostridium methylpentosum
           DSM 5476]
 gi|224949807|gb|EEG31016.1| hypothetical protein CLOSTMETH_01323 [Clostridium methylpentosum
           DSM 5476]
          Length = 485

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/100 (17%), Positives = 31/100 (31%), Gaps = 6/100 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +    FG PQ RER++I+   +         FP P G    L  ++      +      +
Sbjct: 152 LNTKYFGPPQNRERVFIVACRHPGAGRGPKIFPVPAGSGKALIQLIGGMQGQRVYDPAGI 211

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFEN---SATTNTLSARY 94
                 +          +   L   N   +     + A+Y
Sbjct: 212 SVTMAAQSGGWGGKTGLYFVDLCNGNPKLTDHARCIKAKY 251


>gi|325849320|ref|ZP_08170737.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325480182|gb|EGC83251.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 321

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+ + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSEFLEKDVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFRGRLKVIKD-FSYTIS 235


>gi|319645695|ref|ZP_07999926.1| DNA-cytosine methyltransferase [Bacillus sp. BT1B_CT2]
 gi|317392242|gb|EFV73038.1| DNA-cytosine methyltransferase [Bacillus sp. BT1B_CT2]
          Length = 327

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 35/94 (37%), Gaps = 5/94 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-LGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFGVPQRRER++ I  L  +  F F          + + LE ++     + N    
Sbjct: 147 LNAMDFGVPQRRERVFTISIL-GNKAFNFSKLNRKTAQHIKEFLEGNVTAPQYMIN--IP 203

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
               R E          Y        +  T+S R
Sbjct: 204 SMLNRIEEFNPNADE-KYRYLDVIEDSCWTISTR 236


>gi|205360554|ref|ZP_02684441.2| modification methylase DdeI [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|205348823|gb|EDZ35454.1| modification methylase DdeI [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 394

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 35/90 (38%), Gaps = 10/90 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG---------IKPRLGDILEEHIDDKS 51
           +++ DFGVPQ R+RL+II          FP P             P L D + +     +
Sbjct: 156 LESTDFGVPQIRKRLFIIASRKELKN-PFPKPTHNITGSDGLKKTPTLWDAISDLPQINA 214

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFF 81
              ++  +  ++   + +   +   + +  
Sbjct: 215 REGSEEMDYDKQALTDYQKQLRENSHKISN 244


>gi|238922582|ref|YP_002936095.1| cytosine-specific methyltransferase [Eubacterium rectale ATCC
           33656]
 gi|238874254|gb|ACR73961.1| cytosine-specific methyltransferase [Eubacterium rectale ATCC
           33656]
          Length = 443

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIK 36
           + + D+GVPQ RER++++        E K P P    
Sbjct: 164 LNSADYGVPQVRERVFVVAIKGDEGKEIKLPNPTHRN 200


>gi|209525305|ref|ZP_03273847.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
 gi|209494320|gb|EDZ94633.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
          Length = 342

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 36/99 (36%), Gaps = 14/99 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT------PLGIKPRLGDILEEHIDDKSTIS 54
           + A ++GVPQ+RERL+++ +      + +P       P      + D           ++
Sbjct: 162 INAVNYGVPQKRERLFVVAY---QTAWHWPEAETLAMPYTAGDAIYDTASTIPIGAKFLT 218

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
             + E   + +  +K       Y           TL+ R
Sbjct: 219 PSMLEYIGRYEAKSKCVKPREIY-----LDIPCRTLTCR 252


>gi|325298663|ref|YP_004258580.1| DNA-cytosine methyltransferase [Bacteroides salanitronis DSM 18170]
 gi|324318216|gb|ADY36107.1| DNA-cytosine methyltransferase [Bacteroides salanitronis DSM 18170]
          Length = 463

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP 37
           + A DF +PQ R R++++ FL   +  F FP PL    
Sbjct: 143 LNAADFRIPQDRYRVFVVGFLKDLNCNFHFPHPLQNAH 180


>gi|325846341|ref|ZP_08169331.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325481605|gb|EGC84644.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 315

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+++ +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSEFLEKNVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFRGRLKVIKD-FSYTIS 235


>gi|257877765|ref|ZP_05657418.1| cytosine specific DNA methyltransferase [Enterococcus casseliflavus
           EC20]
 gi|257811931|gb|EEV40751.1| cytosine specific DNA methyltransferase [Enterococcus casseliflavus
           EC20]
          Length = 380

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPT 31
           + A D+GVPQ R+R++ + F        F+FP 
Sbjct: 156 LLAADYGVPQMRKRMFFVGFRKDLNYDYFEFPK 188


>gi|161869727|ref|YP_001598894.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria
           meningitidis 053442]
 gi|161595280|gb|ABX72940.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria
           meningitidis 053442]
          Length = 374

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEE 45
              +FGVPQ RER+ I+     +  +F  P P   +     +L  
Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFHHPEPTHGENTDYGLLPY 204


>gi|326574028|gb|EGE23977.1| DcmB [Moraxella catarrhalis CO72]
          Length = 337

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 30/83 (36%), Gaps = 12/83 (14%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A ++GV Q R+R++ I F     + F FP                 D+K T+ + +W+ 
Sbjct: 145 NAKNYGVAQERKRVFYIGFRKDLAINFNFPIGS----------TAEDDNKITLKDVIWD- 193

Query: 61  HQKRKENNKIAGKGFGYGLFFEN 83
            Q+         +     +    
Sbjct: 194 LQQTAVAALDKNQTNPKAINNNE 216


>gi|79835466|gb|ABB52093.1| Mod [Arthrospira platensis]
 gi|291569838|dbj|BAI92110.1| cytosine-specific methyltransferase [Arthrospira platensis NIES-39]
          Length = 345

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 36/99 (36%), Gaps = 14/99 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT------PLGIKPRLGDILEEHIDDKSTIS 54
           + A ++GVPQ+RERL+++ +      + +P       P      + D           ++
Sbjct: 162 INAVNYGVPQKRERLFVVAY---QTAWNWPEAETLAIPYTAGDAIYDTASTIPIGAKFLT 218

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
             + E   + +  +K       Y           TL+ R
Sbjct: 219 PSMLEYIGRYEAKSKCVKPRDIY-----LDIPCRTLTCR 252


>gi|309808410|ref|ZP_07702309.1| putative modification methylase HhaI [Lactobacillus iners LactinV
           01V1-a]
 gi|308168238|gb|EFO70357.1| putative modification methylase HhaI [Lactobacillus iners LactinV
           01V1-a]
          Length = 198

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDIL 43
           +   ++G+PQ+RER+Y++ F N      F FP P  +   + +  
Sbjct: 152 LNPINYGIPQKRERVYMVCFRNDIERESFVFPQPFKLNRFVENFF 196


>gi|218249004|ref|YP_002374375.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
 gi|218169482|gb|ACK68219.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8801]
          Length = 456

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 32/80 (40%), Gaps = 7/80 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHID----DKSTI 53
           + + DFG+ Q R+R++I+           F FP PL + P+L + +E         K   
Sbjct: 173 LNSYDFGLSQDRDRVFIVGIHQQIENAAQFSFPEPLNLSPKLYEFIEGIEKQELVKKKFS 232

Query: 54  SNKLWEGHQKRKENNKIAGK 73
            + L+EG             
Sbjct: 233 PDILFEGKIPASRGRFQKND 252


>gi|332361316|gb|EGJ39120.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           sanguinis SK1056]
          Length = 454

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP    I     + L         ++ ++  
Sbjct: 151 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFPLRGEISSVSLERLGNVNPSGKGMNGEV-- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
              +        GKG G  +   
Sbjct: 209 YLSRGIAPTLTRGKGEGTKIAIP 231


>gi|325270471|ref|ZP_08137073.1| modification methylase DdeI [Prevotella multiformis DSM 16608]
 gi|324987194|gb|EGC19175.1| modification methylase DdeI [Prevotella multiformis DSM 16608]
          Length = 398

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 29/68 (42%), Gaps = 7/68 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL-GIKPRLGDILEEHIDDK-----STIS 54
           + A D+GVPQ R R   +  L+ + EF FP+P         + + +  +D         +
Sbjct: 202 LLASDYGVPQNRRRAIFVGMLDGT-EFVFPSPTLETPVTCKEAISDLPEDSLPEGGEYPA 260

Query: 55  NKLWEGHQ 62
           +   E  +
Sbjct: 261 DPQSEYQK 268


>gi|225075681|ref|ZP_03718880.1| hypothetical protein NEIFLAOT_00697 [Neisseria flavescens
           NRL30031/H210]
 gi|224952952|gb|EEG34161.1| hypothetical protein NEIFLAOT_00697 [Neisseria flavescens
           NRL30031/H210]
          Length = 389

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 30/77 (38%), Gaps = 3/77 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDILEEHIDD-KSTISNKL 57
           + A D+GVPQ RER+ I+  L    E +                + + +D  +  I+N +
Sbjct: 239 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDEIANHI 298

Query: 58  WEGHQKRKENNKIAGKG 74
           W   +K  +        
Sbjct: 299 WSRAEKSPDQGSRKLDA 315


>gi|323955563|gb|EGB51327.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H263]
          Length = 126

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 15/23 (65%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP 23
           + A D+GVPQ R+R++I    N 
Sbjct: 81  LNARDYGVPQNRKRVFIAGVRND 103


>gi|261392162|emb|CAX49670.1| putative modification methylase (cytosine-specific
           methyltransferase) [Neisseria meningitidis 8013]
 gi|309378365|emb|CBX23011.1| putative DNA cytosine methyltransferase [Neisseria lactamica
           Y92-1009]
          Length = 389

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 30/77 (38%), Gaps = 3/77 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDILEEHIDD-KSTISNKL 57
           + A D+GVPQ RER+ I+  L    E +                + + +D  +  I+N +
Sbjct: 239 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDEIANHI 298

Query: 58  WEGHQKRKENNKIAGKG 74
           W   +K  +        
Sbjct: 299 WSRAEKSPDQGSRKLDA 315


>gi|159122489|gb|EDP47610.1| C-5 cytosine methyltransferase DmtA [Aspergillus fumigatus A1163]
          Length = 628

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 35/108 (32%), Gaps = 17/108 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   D+GVPQ R RL II      V   FP P          L        T  N++   
Sbjct: 468 LNCMDYGVPQSRRRLIIIASGPGEVLPPFPKPTHG-------LPGSGLSDYTTINQMIAN 520

Query: 61  HQKRK-----ENNKIAGKGFGYGLFFENSATTNTLSAR-----YYKDG 98
                     E  +  G   G  + F+ +    T++       Y+  G
Sbjct: 521 IPPNAPDHDIEGARSRGLRNGTRVPFDPNQQAKTVTCSGGENNYHPSG 568


>gi|145218883|ref|YP_001129592.1| DNA-cytosine methyltransferase [Prosthecochloris vibrioformis DSM
           265]
 gi|145205047|gb|ABP36090.1| DNA-cytosine methyltransferase [Chlorobium phaeovibrioides DSM 265]
          Length = 377

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           ++A D+G+PQRR+R  I+ +         P+P  
Sbjct: 152 LEASDYGLPQRRQRTIIVGWKKHLPAVSLPSPTH 185


>gi|265751236|ref|ZP_06087299.1| DcmB protein [Bacteroides sp. 3_1_33FAA]
 gi|270294601|ref|ZP_06200803.1| DNA-cytosine methyltransferase [Bacteroides sp. D20]
 gi|263238132|gb|EEZ23582.1| DcmB protein [Bacteroides sp. 3_1_33FAA]
 gi|270276068|gb|EFA21928.1| DNA-cytosine methyltransferase [Bacteroides sp. D20]
          Length = 466

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP 37
           + A D+ +PQ R R++++ FL   +  F FP P G   
Sbjct: 143 LNAADYYIPQDRYRVFVVGFLKELNCTFNFPKPFGKPY 180


>gi|226349837|ref|YP_002776950.1| modification methylase [Rhodococcus opacus B4]
 gi|226245752|dbj|BAH47019.1| modification methylase [Rhodococcus opacus B4]
          Length = 428

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHI 47
           ++A D+GVPQ R R  ++      +  F +P     +  +G  L++ +
Sbjct: 158 LQASDYGVPQLRPRFVLVALRQEDAAYFHWPEKTPTQDTVGSALKDLM 205


>gi|282883032|ref|ZP_06291633.1| type II restriction-modification system methylation subunit
           [Peptoniphilus lacrimalis 315-B]
 gi|281297089|gb|EFA89584.1| type II restriction-modification system methylation subunit
           [Peptoniphilus lacrimalis 315-B]
          Length = 312

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+++ +  T++     
Sbjct: 151 LNAVDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSEFLEKNVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFRGRLKVIKD-FSYTIS 235


>gi|322510870|gb|ADX06184.1| putative C-5 cytosine-specific DNA methyltransferase [Organic Lake
           phycodnavirus 1]
          Length = 465

 Score = 52.3 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHI 47
           + A  + VPQ+RER++I+    N    F+FP     K  L D+L    
Sbjct: 288 LDASKYDVPQKRERVFIVGVLKNIDRSFEFPNESLTKKVLKDVLYNVP 335


>gi|269986305|gb|EEZ92611.1| DNA-cytosine methyltransferase [Candidatus Parvarchaeum acidiphilum
           ARMAN-4]
          Length = 349

 Score = 51.9 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKF--PTPLG 34
            A ++GVPQ R+R+ I+ +    + F F  P P  
Sbjct: 145 DARNYGVPQERKRVIIVGYRKD-IGFSFLPPEPTH 178


>gi|70984380|ref|XP_747703.1| C-5 cytosine methyltransferase DmtA [Aspergillus fumigatus Af293]
 gi|66845330|gb|EAL85665.1| C-5 cytosine methyltransferase DmtA [Aspergillus fumigatus Af293]
          Length = 628

 Score = 51.9 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 35/108 (32%), Gaps = 17/108 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   D+GVPQ R RL II      V   FP P          L        T  N++   
Sbjct: 468 LNCMDYGVPQSRRRLIIIASGPGEVLPPFPKPTHG-------LPGSGLSDYTTINQMIAN 520

Query: 61  HQKRK-----ENNKIAGKGFGYGLFFENSATTNTLSAR-----YYKDG 98
                     E  +  G   G  + F+ +    T++       Y+  G
Sbjct: 521 IPPNAPDHDIEGARSRGLRNGTRVPFDPNQQAKTVTCSGGENNYHPSG 568


>gi|159477138|ref|XP_001696668.1| cytosine-C5 specific DNA methyltransferase [Chlamydomonas
           reinhardtii]
 gi|158282893|gb|EDP08645.1| cytosine-C5 specific DNA methyltransferase [Chlamydomonas
           reinhardtii]
          Length = 1263

 Score = 51.9 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
           + A ++GVPQ R+R++II  L   V   +P P+   
Sbjct: 916 LNAGNYGVPQSRKRMFIIAALPEEVLPNWPRPMHSF 951


>gi|121635255|ref|YP_975500.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis FAM18]
 gi|313668027|ref|YP_004048311.1| C-5 cytosine-specific DNA methylase [Neisseria lactamica ST-640]
 gi|120866961|emb|CAM10721.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis FAM18]
 gi|313005489|emb|CBN86924.1| C-5 cytosine-specific DNA methylase [Neisseria lactamica 020-06]
          Length = 383

 Score = 51.9 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 30/77 (38%), Gaps = 3/77 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDILEEHIDD-KSTISNKL 57
           + A D+GVPQ RER+ I+  L    E +                + + +D  +  I+N +
Sbjct: 233 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDEIANHI 292

Query: 58  WEGHQKRKENNKIAGKG 74
           W   +K  +        
Sbjct: 293 WSRAEKSPDQGSRKLDA 309


>gi|322514130|ref|ZP_08067198.1| modification methylase NgoPII [Actinobacillus ureae ATCC 25976]
 gi|322120016|gb|EFX92002.1| modification methylase NgoPII [Actinobacillus ureae ATCC 25976]
          Length = 356

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPL----GIKPRLGDILEEHID 48
            A D+GV Q R+R++ I +     ++F+FP         K  L DI+ +  D
Sbjct: 145 NAKDYGVAQERKRVFYIGYRKDLGIDFEFPVGSTIDDDKKISLKDIIWDLKD 196


>gi|251811836|ref|ZP_04826309.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875124|ref|ZP_06283997.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis
           SK135]
 gi|251804633|gb|EES57290.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281295889|gb|EFA88410.1| DNA (cytosine-5-)-methyltransferase [Staphylococcus epidermidis
           SK135]
          Length = 329

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 37/88 (42%), Gaps = 6/88 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID----DKSTISNK 56
           ++  D+ +PQ+R+R++I+ + N  +EF +P  L  K  + + + +       +KS I N 
Sbjct: 153 LQTSDYNIPQKRQRVFIVGYKN--IEFNYPEKLKRKVTIKEAISDLPPLKNGEKSKIPNH 210

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENS 84
               H +            G  L     
Sbjct: 211 FAMNHSQEMLYKMSFISDGGNRLQIPEE 238


>gi|257060181|ref|YP_003138069.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
 gi|256590347|gb|ACV01234.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 8802]
          Length = 336

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A DF +P +RER++I+ F    ++F +   +     L  ILE ++      S ++
Sbjct: 167 LNALDFALPHKRERIFIVGFR-DPLQFTWKNSIIPMKSLEKILENNVAQSYYASQQI 222


>gi|254805366|ref|YP_003083587.1| putative type II DNA modification methylase [Neisseria meningitidis
           alpha14]
 gi|254668908|emb|CBA07091.1| putative type II DNA modification methylase [Neisseria meningitidis
           alpha14]
 gi|308389730|gb|ADO32050.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha710]
          Length = 389

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 30/77 (38%), Gaps = 3/77 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDILEEHIDD-KSTISNKL 57
           + A D+GVPQ RER+ I+  L    E +                + + +D  +  I+N +
Sbjct: 239 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDEIANHI 298

Query: 58  WEGHQKRKENNKIAGKG 74
           W   +K  +        
Sbjct: 299 WSRAEKSPDQGSRKLDA 315


>gi|315654722|ref|ZP_07907628.1| modification methylase NgoPII [Mobiluncus curtisii ATCC 51333]
 gi|315491186|gb|EFU80805.1| modification methylase NgoPII [Mobiluncus curtisii ATCC 51333]
          Length = 360

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 31/83 (37%), Gaps = 12/83 (14%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A ++GV + R+R++ I F    +++F FP              E    K T+ + +W+ 
Sbjct: 154 NAKNYGVAEERKRVFYIGFRKDLNIDFVFPKGS----------TEDDAKKITLRDVIWD- 202

Query: 61  HQKRKENNKIAGKGFGYGLFFEN 83
            Q+         +     +    
Sbjct: 203 LQETAVPAAEKNRHNPEAINNNE 225


>gi|254470861|ref|ZP_05084264.1| DNA-cytosine methyltransferase [Pseudovibrio sp. JE062]
 gi|211960003|gb|EEA95200.1| DNA-cytosine methyltransferase [Pseudovibrio sp. JE062]
          Length = 498

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG 34
           + A  +GVPQ RER++++ +     +   FP P  
Sbjct: 183 LNAAYYGVPQMRERMFLLAYRREITDSIVFPKPTH 217


>gi|145294975|ref|YP_001137796.1| hypothetical protein cgR_0920 [Corynebacterium glutamicum R]
 gi|140844895|dbj|BAF53894.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 331

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 19/38 (50%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38
           ++A +FGVPQ R+RL +I          +P P     +
Sbjct: 129 LQAAEFGVPQSRKRLVLIGARKDVPLPVYPEPTHSARK 166


>gi|227539355|ref|ZP_03969404.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227240668|gb|EEI90683.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 386

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 11/40 (27%), Positives = 18/40 (45%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40
           + + DFGVPQ RER++ +      ++ K   P        
Sbjct: 171 LNSLDFGVPQHRERIFFVGIRRKILDKKIVEPSSFGKWFP 210


>gi|323485262|ref|ZP_08090612.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14163]
 gi|323401440|gb|EGA93788.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14163]
          Length = 335

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 32/94 (34%), Gaps = 11/94 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           +   D+G+PQ RER + +  L  +  +F+      +K     +    + D   ++     
Sbjct: 167 LDCRDYGIPQARERCFTVSILGDNAFDFELMEKRPMKNISNFLEYGDVPDCYLVTQPSVY 226

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
               +K          G           NT++ R
Sbjct: 227 SVIGKK----------GIRRATIIKDYVNTITTR 250


>gi|224418258|ref|ZP_03656264.1| cytosine specific DNA methyltransferase (DDEM) [Helicobacter
           canadensis MIT 98-5491]
 gi|253827583|ref|ZP_04870468.1| putative methylase [Helicobacter canadensis MIT 98-5491]
 gi|313141791|ref|ZP_07803984.1| cytosine-specific DNA methyltransferase [Helicobacter canadensis
           MIT 98-5491]
 gi|253510989|gb|EES89648.1| putative methylase [Helicobacter canadensis MIT 98-5491]
 gi|313130822|gb|EFR48439.1| cytosine-specific DNA methyltransferase [Helicobacter canadensis
           MIT 98-5491]
          Length = 589

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 18/43 (41%), Gaps = 2/43 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43
           + A  +GVPQ RER++ I          FP        + D +
Sbjct: 152 LNAKHYGVPQNRERVFFIAHKERL--LSFPKESNCLVSVKDAI 192


>gi|207108548|ref|ZP_03242710.1| type II DNA modification enzyme [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 171

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHID 48
           + + DF + Q RERLYI+ F       F FP  L       D L+   +
Sbjct: 99  LNSADFQLAQNRERLYIVGFRKDLKHHFVFPLGLANDYHFEDFLDADNE 147


>gi|119467548|ref|XP_001257580.1| C-5 cytosine methyltransferase DmtA [Neosartorya fischeri NRRL 181]
 gi|119405732|gb|EAW15683.1| C-5 cytosine methyltransferase DmtA [Neosartorya fischeri NRRL 181]
          Length = 632

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 39/103 (37%), Gaps = 7/103 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   D+GVPQ R RL II      V   FP P    P  G  L ++      I+N   + 
Sbjct: 468 LNCMDYGVPQSRRRLIIIASGPGEVLPPFPKPTHGLP--GSGLSDYTTINQMIANIPPDA 525

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSAR-----YYKDG 98
                E  +  G   G  + F+ +    T++       Y+  G
Sbjct: 526 PDHDIEGARSRGLRNGTRVPFDPNQQAKTVTCSGGENNYHPSG 568


>gi|88854619|ref|ZP_01129286.1| C-5 cytosine-specific DNA methylase family protein [marine
           actinobacterium PHSC20C1]
 gi|88816427|gb|EAR26282.1| C-5 cytosine-specific DNA methylase family protein [marine
           actinobacterium PHSC20C1]
          Length = 352

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 17/34 (50%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           + A D+G PQ R+R  II  L       FPTP  
Sbjct: 144 LNAADYGAPQARKRAVIIGHLKTLPFPGFPTPTH 177


>gi|79835453|gb|ABB52085.1| Mod [Arthrospira platensis]
 gi|291569776|dbj|BAI92048.1| type II DNA modification methyltransferase [Arthrospira platensis
           NIES-39]
          Length = 429

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 29/86 (33%), Gaps = 5/86 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A D+G+PQ R+RL+I+          FP P        ++   ++         LWE 
Sbjct: 192 LNATDYGIPQVRKRLFILAHRCDLTH-PFPQPTHTTSNQTELFTHNLKKC----PSLWEA 246

Query: 61  HQKRKENNKIAGKGFGYGLFFENSAT 86
                + +   G          +   
Sbjct: 247 ISDLPDIDAGEGAEEMEYNKCPDHEY 272


>gi|283783021|ref|YP_003373775.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis 409-05]
 gi|283441534|gb|ADB14000.1| DNA (cytosine-5-)-methyltransferase [Gardnerella vaginalis 409-05]
          Length = 357

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 1/81 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ R+R  II  +N  V    P+ L  K  + D + +    +S   +++ E 
Sbjct: 150 LNAADFGVPQNRKRAVIIGKMNG-VAPSLPSSLNEKVTIWDAISDLAFLESGEGDEVQEY 208

Query: 61  HQKRKENNKIAGKGFGYGLFF 81
               +   +   +G    L+ 
Sbjct: 209 RYAPQSEYEKKLRGHANLLYN 229


>gi|172036128|ref|YP_001802629.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142]
 gi|171697582|gb|ACB50563.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142]
          Length = 349

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 42/101 (41%), Gaps = 13/101 (12%)

Query: 1   MKACDFGVPQRRERLYIIDF----LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + A  F +PQ RER+Y++ F    L   V+F FP          D   E   +  +IS  
Sbjct: 180 LDAALFDLPQVRERIYLVGFCREYLKERVDFTFPMGQTNDV-YIDRFIEKNIEGYSISKH 238

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSAT-TNTLSARYYK 96
           L + +  +K++ +         +  + S     T  + Y+K
Sbjct: 239 LQQSYLFKKDDGRP-------QIVDQTSQVKVKTFVSTYHK 272


>gi|309776146|ref|ZP_07671137.1| CPG DNA methylase [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916097|gb|EFP61846.1| CPG DNA methylase [Erysipelotrichaceae bacterium 3_1_53]
          Length = 456

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 35/80 (43%), Gaps = 5/80 (6%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS----NKL 57
            A D G+PQ RER ++I  L     ++FP    +  ++ D+LEE +D +   +       
Sbjct: 225 DAADHGIPQHRERCFMISILGEY-SYRFPAGRKLHIQMKDLLEEKVDIRYFQTYRSVCNF 283

Query: 58  WEGHQKRKENNKIAGKGFGY 77
              H++++   +        
Sbjct: 284 LTSHKEKEIGAQPTLDKGAM 303


>gi|462647|sp|P34905|MTB1_BREBE RecName: Full=Modification methylase BbvI; Short=M.BbvI; AltName:
           Full=Cytosine-specific methyltransferase BbvI
          Length = 374

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 5   DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP--RLGDILEEHIDD 49
           ++GVPQRR R+ I+       V F+ P P   +      + L +  +D
Sbjct: 170 EYGVPQRRHRIIIVGIRKDQDVAFRVPEPTHKEKYRTASEALADIPED 217


>gi|322411604|gb|EFY02512.1| C-5 cytosine-specific DNA methylase [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 451

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 29/83 (34%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP          + L         ++ ++  
Sbjct: 148 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFPLRGENSSASLERLGNVNPSGKGMNGEV-- 205

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
              +        GKG G  +   
Sbjct: 206 YLSRGIAPTLTRGKGEGTKIAIP 228


>gi|110765384|ref|XP_001122269.1| PREDICTED: DNA (cytosine-5)-methyltransferase PliMCI [Apis mellifera]
          Length = 1427

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 30/65 (46%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            ++A ++G+PQ R RL I+      V  K+P P  +  +    L   +D+K   SN  W  
Sbjct: 1116 LQAGNYGIPQTRRRLIILAAAPGEVLPKYPEPTHVFSKRACQLSVIVDNKKYSSNCDWTE 1175

Query: 61   HQKRK 65
                +
Sbjct: 1176 SAPYR 1180


>gi|308061739|gb|ADO03627.1| DNA-cytosine methyltransferase [Helicobacter pylori Cuz20]
          Length = 704

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 33/90 (36%), Gaps = 7/90 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A +F VPQ RER+ I+ +L   V F F P        + + L     DKS     L  
Sbjct: 143 LNAKNFSVPQNRERIIIVGYLGSQV-FDFNPIKTNPITDMQNFL-----DKSGHFEILEP 196

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
                 +N  +  +  G       +    T
Sbjct: 197 YEYTLLDNQLLKRQNSGLIFCGYRNKKIRT 226


>gi|1709155|sp|P50196|MTE8_ECOLX RecName: Full=Modification methylase Eco47II; Short=M.Eco47II;
           AltName: Full=Cytosine-specific methyltransferase
           Eco47II
 gi|558571|emb|CAA57629.1| site-specific DNA-methyltransferase (cytosine-specific)
           [Escherichia coli]
 gi|1098127|prf||2115269B methyltransferase Eco47IIM
          Length = 417

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 36/87 (41%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +KA  + VPQ+RERL I+   N     +++++P+       L D L++     S +    
Sbjct: 225 LKAIFYKVPQKRERLIIVAVRNDLADGIDYEWPSSYNKILTLKDALKKGELYDSDVPESE 284

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
            + + KRK          GY       
Sbjct: 285 GQKYPKRKAEILSMVPPGGYWRDLPED 311


>gi|325270791|ref|ZP_08137382.1| modification methylase Eco47II [Prevotella multiformis DSM 16608]
 gi|324986907|gb|EGC18899.1| modification methylase Eco47II [Prevotella multiformis DSM 16608]
          Length = 437

 Score = 51.9 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 44/102 (43%), Gaps = 5/102 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHID-DKSTISNK 56
           +KA  + VPQ+RERL+++   N     V F++P+P      L D   +         S++
Sbjct: 217 LKAVMYKVPQKRERLFLVALRNDLSGHVTFRWPSPYHRIMTLRDAFFKGDLFSCDVPSSE 276

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
                ++++   ++  +G  +    E       + A YY  G
Sbjct: 277 GQAYPERKRRVLELVPEGQDWRSLPEKEQKAY-MGASYYLGG 317


>gi|50949214|emb|CAF31654.1| putative C5-methyltransferase [Cloning vector pGID052]
          Length = 307

 Score = 51.5 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 7/90 (7%)

Query: 2   KACDFGVPQRRERLYIID--FLNPSVEF----KFPTPLGIKPRLGDI-LEEHIDDKSTIS 54
            A D+GVPQ RER++++         +F    KFP P   +  L  + L++ I D  +  
Sbjct: 218 NARDYGVPQSRERVFLVGTNIKKVKQKFDWKYKFPNPTHGEKLLPYVTLKDAIGDLPSSP 277

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENS 84
             ++EG       ++   K +    F   S
Sbjct: 278 PDVFEGAFSPIFMSRNRKKSWNEQSFTIRS 307


>gi|260913722|ref|ZP_05920198.1| modification methylase NgoPII [Pasteurella dagmatis ATCC 43325]
 gi|260632261|gb|EEX50436.1| modification methylase NgoPII [Pasteurella dagmatis ATCC 43325]
          Length = 329

 Score = 51.5 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 33/83 (39%), Gaps = 12/83 (14%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+GV Q R+R++ I F    S+ F+FP               + +DK T+ + +W+ 
Sbjct: 145 NAKDYGVAQERKRVFYIGFRKDLSISFQFPIGS----------TVNDEDKITLKDIIWD- 193

Query: 61  HQKRKENNKIAGKGFGYGLFFEN 83
            Q+         K     +    
Sbjct: 194 LQETAVPALAQNKSNPQAVNNNE 216


>gi|229187780|ref|ZP_04314910.1| Cytosine-specific methyltransferase [Bacillus cereus BGSC 6E1]
 gi|228595683|gb|EEK53373.1| Cytosine-specific methyltransferase [Bacillus cereus BGSC 6E1]
          Length = 365

 Score = 51.5 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP 23
           + + DFGVPQ RER++II  L  
Sbjct: 150 LNSKDFGVPQNRERVFIIGHLRG 172


>gi|50914489|ref|YP_060461.1| DNA-cytosine methyltransferase [Streptococcus pyogenes MGAS10394]
 gi|50903563|gb|AAT87278.1| DNA-cytosine methyltransferase [Streptococcus pyogenes MGAS10394]
          Length = 422

 Score = 51.5 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 30/97 (30%), Gaps = 4/97 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            + D+GVPQ RER+Y I  L      +  P        L  ++      +   ++ +   
Sbjct: 152 NSKDYGVPQNRERVYTIGHLRSRGRRQVLPLQPESSGNLKQLVGGMQSYRVYDTDGISTT 211

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATT---NTLSARY 94
                         +           T     ++ARY
Sbjct: 212 LVGTGGGVGAKTGLYLIDQSTTKPKVTDQARCITARY 248


>gi|17548155|ref|NP_521557.1| DNA modification cytosine-specific methyltransferase [Ralstonia
           solanacearum GMI1000]
 gi|17430462|emb|CAD16935.1| probable site-specific dna methylase protein [Ralstonia
           solanacearum GMI1000]
          Length = 364

 Score = 51.5 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/70 (17%), Positives = 26/70 (37%), Gaps = 3/70 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKF--PTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A ++ VPQ RERL ++ F      +  +  P P   +  + + +    +      N  
Sbjct: 154 LNAANYSVPQNRERLIMVGFNRDLYPDLTWLPPGPKNARLTVREAIGALPEPTYFQRNLT 213

Query: 58  WEGHQKRKEN 67
            +       +
Sbjct: 214 NKDIPHHPNH 223


>gi|325132717|gb|EGC55400.1| DNA-cytosine methyltransferase [Neisseria meningitidis M6190]
 gi|325136737|gb|EGC59337.1| DNA-cytosine methyltransferase [Neisseria meningitidis M0579]
 gi|325138603|gb|EGC61162.1| DNA-cytosine methyltransferase [Neisseria meningitidis ES14902]
 gi|325142796|gb|EGC65168.1| DNA-cytosine methyltransferase [Neisseria meningitidis 961-5945]
 gi|325198710|gb|ADY94166.1| DNA-cytosine methyltransferase [Neisseria meningitidis G2136]
 gi|325201728|gb|ADY97182.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240149]
 gi|325204572|gb|ADZ00026.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240355]
 gi|325208528|gb|ADZ03980.1| DNA-cytosine methyltransferase [Neisseria meningitidis NZ-05/33]
          Length = 316

 Score = 51.5 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 30/77 (38%), Gaps = 3/77 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDILEEHIDD-KSTISNKL 57
           + A D+GVPQ RER+ I+  L    E +                + + +D  +  I+N +
Sbjct: 166 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDEIANHI 225

Query: 58  WEGHQKRKENNKIAGKG 74
           W   +K  +        
Sbjct: 226 WSRAEKSPDQGSRKLDA 242


>gi|319746106|gb|EFV98380.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           agalactiae ATCC 13813]
          Length = 458

 Score = 51.5 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 28/83 (33%), Gaps = 3/83 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF VPQ RER++II         F FP          + L         ++ ++  
Sbjct: 151 LNSKDFQVPQNRERIFIIGHSRRYCSRFLFPLRRESSSTGLERLGNINPSGKGMNGEV-- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFE 82
                       GKG G  +   
Sbjct: 209 YLTSGLAPTLTRGKGEGTKIAIP 231


>gi|213863400|ref|ZP_03386655.1| C-5 cytosine-specific DNA methylase [Salmonella enterica subsp.
          enterica serovar Typhi str. M223]
          Length = 60

 Score = 51.5 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%)

Query: 1  MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL 43
          + + DF VPQ RER++II         F FP      P   + L
Sbjct: 16 LNSKDFQVPQNRERVFIIGHSRRYRPRFLFPLRRENSPAHLERL 59


>gi|317010127|gb|ADU80707.1| DNA-cytosine methyltransferase [Helicobacter pylori India7]
          Length = 703

 Score = 51.5 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLGDILEE 45
           + A DF VPQ RER+ I+ +L   V F F P        + + L++
Sbjct: 143 LNAKDFSVPQNRERIIIVGYLGSQV-FDFNPIKKNPIISMQNFLDK 187


>gi|284050355|ref|ZP_06380565.1| site-specific DNA-methyltransferase [Arthrospira platensis str.
           Paraca]
          Length = 371

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 22/49 (44%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD 49
           + A D+G+PQ R+RL+I+          FP P        ++   ++  
Sbjct: 151 LNATDYGIPQVRKRLFILAHRCDLTH-PFPQPTHTTSNQTELFTHNLKK 198


>gi|255520393|ref|ZP_05387630.1| C-5 cytosine-specific DNA methylase [Listeria monocytogenes FSL
           J1-175]
          Length = 451

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/61 (22%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            + ++GVPQ RER++II  L  +   + FP     +    + ++   D K       ++ 
Sbjct: 149 NSKNYGVPQNRERVFIIGHLRGAGGREIFPLGGENRTFNKNDIKAINDSKKVREQLKFDS 208

Query: 61  H 61
            
Sbjct: 209 L 209


>gi|207091758|ref|ZP_03239545.1| putative site-specific DNA-methyltransferase [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 703

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-PTPLGIKPRLGDILEE 45
           + A DF VPQ RER+ I+ +L   V F F P        + + L++
Sbjct: 143 LNAKDFSVPQNRERIIIVGYLGSQV-FDFNPIKKNPIISMQNFLDK 187


>gi|325478388|gb|EGC81503.1| DNA (cytosine-5-)-methyltransferase [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 321

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 37/93 (39%), Gaps = 10/93 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE  + +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-NFSFNKLERKETRPLSEFLENDVSELYTMT----- 204

Query: 60  GHQKRKENNKIA-GKGFGYGLFFENSATTNTLS 91
             Q                G      A + T+S
Sbjct: 205 --QPYMLKFLNKGIDNSFRGRLKVIKAFSYTIS 235


>gi|332523411|ref|ZP_08399663.1| modification methylase HpaII [Streptococcus porcinus str. Jelinkova
           176]
 gi|332314675|gb|EGJ27660.1| modification methylase HpaII [Streptococcus porcinus str. Jelinkova
           176]
          Length = 451

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DF VPQ RER++II         F FP
Sbjct: 148 LNSKDFQVPQNRERIFIIGHSRRFRPRFLFP 178


>gi|159025987|emb|CAO87894.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 329

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 27/78 (34%), Gaps = 3/78 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + +  F +PQ R R +++ F        F+FP P   +  +  I+    D    IS K  
Sbjct: 142 IDSKYFQIPQSRPRFFLLAFRKDLGIKNFQFPQPCHAEVGIEKIIVPG-DYSIPISEKWQ 200

Query: 59  EGHQKRKENNKIAGKGFG 76
           +               F 
Sbjct: 201 QYIDYYAGRITAEQLSFQ 218


>gi|330997449|ref|ZP_08321300.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT
           11841]
 gi|329570823|gb|EGG52539.1| DNA (cytosine-5-)-methyltransferase [Paraprevotella xylaniphila YIT
           11841]
          Length = 357

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 33/82 (40%), Gaps = 3/82 (3%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPTP---LGIKPRLGDILEEHIDDKSTISNKLWE 59
           A D+GVPQ R+RL  I   +    ++FP P           D + +      T+  ++ +
Sbjct: 156 AADYGVPQIRKRLVFIGLRDSKASYEFPVPYRLPDNYLTCEDAISDLPALVDTLGEEVGK 215

Query: 60  GHQKRKENNKIAGKGFGYGLFF 81
              +   + +   +G    L+ 
Sbjct: 216 YEMEPLNDFQKLMRGACTTLYN 237


>gi|7243959|gb|AAB21481.2| cytosine DNA methyltransferase homolog [Neisseria gonorrhoeae]
          Length = 347

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37
              +FGVPQ RER+ I+     +  +F+ P P   + 
Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 196


>gi|331002097|ref|ZP_08325616.1| hypothetical protein HMPREF0491_00478 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330411191|gb|EGG90607.1| hypothetical protein HMPREF0491_00478 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 706

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT-PLGIKPRLGDILEEHIDDKSTISNKL 57
           + A +FGVPQ RER+ I+  ++  + F F    +     +   L++  D +    +  
Sbjct: 147 LNARNFGVPQNRERIIIVGNIDGRI-FDFTKLKMNTVETMKPFLDKAADFEILPRDSY 203


>gi|86360841|ref|YP_472728.1| DNA (cytosine-5-)-methyltransferase protein [Rhizobium etli CFN 42]
 gi|86284943|gb|ABC94001.1| probable DNA (cytosine-5-)-methyltransferase protein [Rhizobium
           etli CFN 42]
          Length = 504

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG 34
           + A  +GVPQ RER+ +I        + +FP P  
Sbjct: 186 LNAAFYGVPQMRERMILIAIRKELADDVEFPAPTH 220


>gi|282897137|ref|ZP_06305139.1| C-5 cytosine-specific DNA methylase [Raphidiopsis brookii D9]
 gi|281197789|gb|EFA72683.1| C-5 cytosine-specific DNA methylase [Raphidiopsis brookii D9]
          Length = 435

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 18/38 (47%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38
           + A DFGV Q R RL ++ +     +  +P  L  K  
Sbjct: 164 LNAADFGVAQNRSRLILLGWRKDMPKPVYPETLFEKTT 201


>gi|283834911|ref|ZP_06354652.1| C-5 cytosine-specific DNA methylase family protein [Citrobacter
           youngae ATCC 29220]
 gi|291069174|gb|EFE07283.1| C-5 cytosine-specific DNA methylase family protein [Citrobacter
           youngae ATCC 29220]
          Length = 400

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 28/87 (32%), Gaps = 2/87 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQ R R++I+   +     E  +P             +   +     S+ + 
Sbjct: 171 LNAKDYGVPQNRNRVFILGLRSDVNIGEVTWPPVSTHFKDKKPQWKNSSEVFERPSSDII 230

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSA 85
              + +      A   F        S 
Sbjct: 231 RKIENKIGAESTANLIFYKKRSDTCSD 257


>gi|27733906|ref|NP_775697.1| putative C5-methyltransferase [Leuconostoc citreum]
 gi|27552370|emb|CAD38156.1| putative C5-methyltransferase [Leuconostoc citreum]
          Length = 403

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 3/56 (5%)

Query: 2   KACDFGVPQRRERLYIID--FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
            A D+GVPQ RER++++         +F +       P  G+ L  ++  K  I +
Sbjct: 218 NARDYGVPQSRERVFLVGTNIKKVKQKFDW-KYKFPNPTHGEKLLPYVTLKDAIGD 272


>gi|240047747|ref|YP_002961135.1| Cytosine-specific methyltransferase [Mycoplasma conjunctivae
           HRC/581]
 gi|239985319|emb|CAT05332.1| Cytosine-specific methyltransferase [Mycoplasma conjunctivae]
          Length = 211

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 38/103 (36%), Gaps = 11/103 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD----------K 50
           + + DFG  Q R+R++++ +L  + +F++P  +     L  IL+               K
Sbjct: 35  LNSADFGSSQNRQRVFMVSWLT-NKKFEWPATIKHNNNLKKILDLTHLPNEENLASKIFK 93

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
             +++        +K       K       +       TL+A 
Sbjct: 94  YQLTSPRITNSSIKKREIINFTKFNSENYIYYPDFFGPTLTAS 136


>gi|255608013|ref|XP_002538828.1| cytosine-specific methyltransferase, putative [Ricinus communis]
 gi|223510238|gb|EEF23555.1| cytosine-specific methyltransferase, putative [Ricinus communis]
          Length = 209

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 37/103 (35%), Gaps = 16/103 (15%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFP----------TPLGIKPRLGDILEEHIDDK 50
           + A DFGVPQ R RL ++  L        P            +    RL +I     +D 
Sbjct: 29  LDAADFGVPQHRRRLIVVAGLGWKPTLPVPLEGRALVSAKEAISNLTRLKNIANHEPNDH 88

Query: 51  STISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           +      W+  ++ + +       +  G  + +   + T+ A 
Sbjct: 89  APHVVARWKKLKEGEVDP-----NYRRGRIY-SDRPSPTIRAG 125


>gi|163937935|ref|YP_001642821.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4]
 gi|163865790|gb|ABY46846.1| DNA-cytosine methyltransferase [Bacillus weihenstephanensis KBAB4]
          Length = 444

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 27/83 (32%), Gaps = 28/83 (33%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP----------------------------SVEFKFPTP 32
           + +  F V Q RER++++                                 S  F FP  
Sbjct: 185 INSKYFDVAQNRERIFVVCVRKDLVQSEEWRIKGKNVVANCKRNLLNLGVQSFNFDFPAQ 244

Query: 33  LGIKPRLGDILEEHIDDKSTISN 55
             +   L DILEE +D +  I  
Sbjct: 245 EDVNVSLIDILEESVDKRFYIKE 267


>gi|305666023|ref|YP_003862310.1| putative DNA modification methylase [Maribacter sp. HTCC2170]
 gi|88710798|gb|EAR03030.1| putative DNA modification methylase (N.MgoV) [Maribacter sp.
           HTCC2170]
          Length = 493

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 30/87 (34%), Gaps = 9/87 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + D+G+PQ R R+YII F +      FK P       +L   LE+    +        
Sbjct: 145 INSHDYGLPQNRIRVYIIGFKDKRYLDSFKLPDKPLNGHKLFQHLEDLPKPQF------- 197

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSA 85
           +  +            F    F +   
Sbjct: 198 KKKKINPTILFGKNVPFSRTKFQKKDE 224


>gi|269129048|ref|YP_003302418.1| DNA-cytosine methyltransferase [Thermomonospora curvata DSM 43183]
 gi|268314006|gb|ACZ00381.1| DNA-cytosine methyltransferase [Thermomonospora curvata DSM 43183]
          Length = 418

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKP-RLGDILEEHIDDKSTISNKLW 58
           ++A D+GV Q R R  ++         F +P P   +P  +GD+L + +  +       W
Sbjct: 148 LQASDYGVSQLRPRFVLVAMRPEDFSYFHWPEPGKKQPKTVGDLLHDQMASRGWRGADTW 207


>gi|168494837|ref|ZP_02718980.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|168494899|ref|ZP_02719042.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|168494952|ref|ZP_02719095.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|168494999|ref|ZP_02719142.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|183575153|gb|EDT95681.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|183575203|gb|EDT95731.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|183575231|gb|EDT95759.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
 gi|183575300|gb|EDT95828.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae CDC3059-06]
          Length = 360

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 37/124 (29%), Gaps = 25/124 (20%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILE---------EHIDDK 50
           + + +FGVPQ RER++II           FP     +      +            ++ +
Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRRERTRRIFPLSGKNQSTSNQSVMKIGNINPSGNGMNGE 206

Query: 51  STISNKLWEGHQKRKENNKIAG--------------KGFGYGLFFENSATTNTLSARYYK 96
              ++ L       K   +                      G+ +E      T+ A Y  
Sbjct: 207 VYQADGLAPTLTTNKGEGQKIAIKSNTIKQFGVLQPNFNQCGVVYETDGIAPTIRA-YQG 265

Query: 97  DGSE 100
            G E
Sbjct: 266 GGLE 269


>gi|323703857|ref|ZP_08115492.1| DNA-cytosine methyltransferase [Desulfotomaculum nigrificans DSM
           574]
 gi|323531175|gb|EGB21079.1| DNA-cytosine methyltransferase [Desulfotomaculum nigrificans DSM
           574]
          Length = 409

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 34/90 (37%), Gaps = 5/90 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTP---LGIKPRLGDILEEHIDDKSTISN- 55
           + A D+GVPQ+R R++II   +     F FPT      +  +  + L +  D     +  
Sbjct: 186 LCAADYGVPQKRYRIFIIGRRDGKLPGFPFPTHANNPELSLKYFNTLCKSQDAFFPYTEL 245

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSA 85
           K W   ++             Y  +   S 
Sbjct: 246 KKWVTVKEAFSKLTDKDYSKEYNYYANLSP 275


>gi|311977248|gb|ADQ20503.1| M.BbvI [Brevibacillus brevis]
          Length = 367

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 5   DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKP--RLGDILEEHIDD 49
           ++GVPQRR R+ I+       V F+ P P   +      + L +  +D
Sbjct: 170 EYGVPQRRHRIIIVGIRKDQDVAFRVPEPTHKEKYRTASEALADIPED 217


>gi|307290179|ref|ZP_07570098.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0411]
 gi|306498807|gb|EFM68305.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0411]
          Length = 416

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 39/115 (33%), Gaps = 25/115 (21%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FP-------------TPLGIKPRLGDILEEH 46
           + + D+ VPQ RER++II  L      K FP              P+    +  ++L   
Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGKCTRKVFPFERKNGTTAKNNIKPINNSKKTRELLNFD 205

Query: 47  IDDKSTISNKLWEGH-------QKRKENNKIAGKGFGYGL---FFENSATTNTLS 91
             ++    N +           ++ K          G G+    + +     TL+
Sbjct: 206 STNRFYDVNGISPCLNTMQGGDREPKIAVVGNVNPSGSGMNGQVYSSDGLAPTLT 260


>gi|221232312|ref|YP_002511465.1| DNA methylase [Streptococcus pneumoniae ATCC 700669]
 gi|220674773|emb|CAR69346.1| putative DNA methylase [Streptococcus pneumoniae ATCC 700669]
          Length = 369

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + +FGVPQ RER++II      S    FP
Sbjct: 131 LNSKNFGVPQNRERVFIIGHLRGGSGRKVFP 161


>gi|119484300|ref|ZP_01618917.1| modification methylase NlaIV [Lyngbya sp. PCC 8106]
 gi|119457774|gb|EAW38897.1| modification methylase NlaIV [Lyngbya sp. PCC 8106]
          Length = 449

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 37/93 (39%), Gaps = 19/93 (20%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF-----PTPLGIK--------------PRLGD 41
           + + +FG+PQ R R+Y+I  LN S +F       P                    P++ D
Sbjct: 146 LNSVNFGLPQNRVRVYMIGVLNASPQFNLISDLGPKDSHSYNAVQLNLFSLQHFPPKVKD 205

Query: 42  ILEEHIDDKSTISNKLWEGHQKRKENNKIAGKG 74
           ILEE+ D     S +  +   K  + +     G
Sbjct: 206 ILEENPDSSFDCSPEFSQALNKVVQGDLNKLHG 238


>gi|15088756|ref|NP_150145.1| putative DNA methylase [Streptococcus phage MM1]
 gi|15074902|emb|CAC48079.1| putative DNA methylase [Streptococcus phage MM1]
 gi|73747029|gb|AAZ82425.1| C5 methyltransferase alpha subunit [Streptococcus phage MM1 1998]
          Length = 385

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + +FGVPQ RER++II      S    FP
Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRGGSGRKVFP 177


>gi|331090242|ref|ZP_08339130.1| hypothetical protein HMPREF1025_02713 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330402188|gb|EGG81760.1| hypothetical protein HMPREF1025_02713 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 464

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/103 (14%), Positives = 29/103 (28%), Gaps = 12/103 (11%)

Query: 1   MKACDFGVPQRRERLYIID-FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DFGVPQ RER++II    +       P        L  ++      +   ++ +  
Sbjct: 151 LNSKDFGVPQNRERVFIIANLRSRGGREILPLCGENAATLNQLVGGMQGYRVYGTDGISA 210

Query: 60  GHQKRKENNKIAGKGFGYGLFFE-----------NSATTNTLS 91
                          +  G                     T++
Sbjct: 211 TLVGNAGGVGAKTGLYLMGNLNPSGHGQGGNVYHEDGIAPTVT 253


>gi|256821199|ref|YP_003142398.1| DNA-cytosine methyltransferase [Anaerococcus prevotii DSM 20548]
 gi|256799179|gb|ACV29833.1| DNA-cytosine methyltransferase [Anaerococcus prevotii DSM 20548]
          Length = 321

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++     +  F F      + R   + LE++I +  T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSQFGEN-NFSFNKLERKETRPLSEFLEKNISELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFKGRLKVIKD-FSYTIS 235


>gi|258406639|ref|YP_003199380.1| transcriptional regulator, XRE family [Desulfohalobium retbaense
           DSM 5692]
 gi|257798866|gb|ACV69802.1| transcriptional regulator, XRE family [Desulfohalobium retbaense
           DSM 5692]
          Length = 468

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPL 33
           + A D+GVPQ RER+  +   N  S++   P P 
Sbjct: 268 INAKDYGVPQHRERIIFVAVRNDLSIKSSIPDPK 301


>gi|298346143|ref|YP_003718830.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii ATCC
           43063]
 gi|298236204|gb|ADI67336.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii ATCC
           43063]
          Length = 355

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 31/83 (37%), Gaps = 12/83 (14%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A ++GV + R+R++ I F    +++F FP              E    K T+ + +W+ 
Sbjct: 149 NAKNYGVAEERKRVFYIGFRKDLNIDFVFPKGS----------TEDDAKKITLRDVIWD- 197

Query: 61  HQKRKENNKIAGKGFGYGLFFEN 83
            Q+         +     +    
Sbjct: 198 LQETAVPAAEKNRHNPQAINNNE 220


>gi|325130663|gb|EGC53404.1| DNA-cytosine methyltransferase [Neisseria meningitidis OX99.30304]
 gi|325134723|gb|EGC57362.1| DNA-cytosine methyltransferase [Neisseria meningitidis M13399]
 gi|325144843|gb|EGC67131.1| DNA-cytosine methyltransferase [Neisseria meningitidis M01-240013]
 gi|325205668|gb|ADZ01121.1| DNA-cytosine methyltransferase [Neisseria meningitidis M04-240196]
          Length = 316

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 30/77 (38%), Gaps = 3/77 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT--PLGIKPRLGDILEEHIDD-KSTISNKL 57
           + A D+GVPQ RER+ I+  L    E +                + + +D  +  I+N +
Sbjct: 166 LNAADYGVPQTRERVIIVGRLPEIPEIQIEKTNTSNSYVTARQAIGDLVDKVEDEIANHI 225

Query: 58  WEGHQKRKENNKIAGKG 74
           W   +K  +        
Sbjct: 226 WSRAEKSPDQGSRKLDA 242


>gi|225869346|ref|YP_002745294.1| C-5 cytosine-specific DNA methylase [Streptococcus equi subsp.
           zooepidemicus]
 gi|225702622|emb|CAX00673.1| C-5 cytosine-specific DNA methylase [Streptococcus equi subsp.
           zooepidemicus]
          Length = 451

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DF VPQ RER++II         F FP
Sbjct: 148 LNSKDFQVPQNRERIFIIGHSRRYRPRFLFP 178


>gi|163761361|ref|ZP_02168435.1| C-5 cytosine-specific DNA methylase family protein [Hoeflea
           phototrophica DFL-43]
 gi|162281356|gb|EDQ31653.1| C-5 cytosine-specific DNA methylase family protein [Hoeflea
           phototrophica DFL-43]
          Length = 376

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFP 30
           + A D+G PQRR+R++I+       +  F++P
Sbjct: 160 LDARDYGTPQRRQRVFILGIRRDVSTDGFEWP 191


>gi|188581100|ref|YP_001924545.1| DNA-cytosine methyltransferase [Methylobacterium populi BJ001]
 gi|179344598|gb|ACB80010.1| DNA-cytosine methyltransferase [Methylobacterium populi BJ001]
          Length = 446

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 3/48 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID 48
           + A DFGVPQ RERL ++          +P P     R  D L    D
Sbjct: 156 LDAADFGVPQHRERLILLGARRGLPLPVYPLPT---TRPADRLPGLQD 200


>gi|319779704|ref|YP_004130617.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9]
 gi|317109728|gb|ADU92474.1| DNA-cytosine methyltransferase [Taylorella equigenitalis MCE9]
          Length = 339

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           + + D+G+P  R R+Y+I       + EF+FP P+ +   L D L    + +  +   
Sbjct: 152 LNSMDYGLPLNRLRVYMIAIRKDVNTREFEFPKPIPLTSYLEDYLLPDSETEHLVYKG 209


>gi|298253558|ref|ZP_06977348.1| site-specific DNA methylase [Gardnerella vaginalis 5-1]
 gi|297532325|gb|EFH71213.1| site-specific DNA methylase [Gardnerella vaginalis 5-1]
          Length = 317

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 1/81 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFGVPQ R+R  II  +N  V    P+ L  K  + D + +    +S   +++ E 
Sbjct: 110 LNAADFGVPQNRKRAVIIGKMNG-VAPSLPSSLNEKVTIWDAISDLAFLESGEGDEVQEY 168

Query: 61  HQKRKENNKIAGKGFGYGLFF 81
               +   +   +G    L+ 
Sbjct: 169 RYAPQSEYEKKLRGHANLLYN 189


>gi|329768652|ref|ZP_08260136.1| hypothetical protein HMPREF0428_01833 [Gemella haemolysans M341]
 gi|328836366|gb|EGF86031.1| hypothetical protein HMPREF0428_01833 [Gemella haemolysans M341]
          Length = 427

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30
           + + +FGVPQ RER++I+  L     +K FP
Sbjct: 148 LNSKNFGVPQNRERVFIVGHLRGGCTYKVFP 178


>gi|325096531|gb|EGC49841.1| C-5 cytosine methyltransferase DmtA [Ajellomyces capsulatus H88]
          Length = 651

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 34/106 (32%), Gaps = 8/106 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI---DDKSTISNKL 57
           +   D+GVPQ R+RL I+          FP P    P                 TI + +
Sbjct: 468 LNCRDYGVPQSRQRLVILASGPGEPLPPFPKPTHTSPNTQINTTITTALLPPFRTIHDAI 527

Query: 58  WEGHQKRKENNKIAGKGFGYGLF-FENSATTNTLSA----RYYKDG 98
            +      +++    +        ++      T++      Y+  G
Sbjct: 528 SKIPPHHPDHDIQYARSRPLNRPTYDPHTQARTITCNGGENYHPSG 573


>gi|240280401|gb|EER43905.1| C-5 cytosine methyltransferase DmtA [Ajellomyces capsulatus H143]
          Length = 651

 Score = 51.5 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 34/106 (32%), Gaps = 8/106 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI---DDKSTISNKL 57
           +   D+GVPQ R+RL I+          FP P    P                 TI + +
Sbjct: 468 LNCRDYGVPQSRQRLVILASGPGEPLPPFPKPTHTSPNTQINTTITTALLPPFRTIHDAI 527

Query: 58  WEGHQKRKENNKIAGKGFGYGLF-FENSATTNTLSA----RYYKDG 98
            +      +++    +        ++      T++      Y+  G
Sbjct: 528 SKIPPHHPDHDIQYARSRPLNRPTYDPHTQARTITCNGGENYHPSG 573


>gi|40218563|gb|AAR83217.1| chromosome partitioning protein parB [Streptococcus pyogenes]
 gi|50261608|gb|AAT72376.1| methylase [Streptococcus pyogenes]
          Length = 388

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 30/97 (30%), Gaps = 4/97 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            + D+GVPQ RER+Y I  L      +  P        L  ++      +   ++ +   
Sbjct: 152 NSKDYGVPQNRERVYTIGHLRSRGRRQVLPLQPESSGNLKQLVGGMQSYRVYDTDGISTT 211

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATT---NTLSARY 94
                         +           T     ++ARY
Sbjct: 212 LVGTGGGVGAKTGLYLIDQSTTKPKVTDQARCITARY 248


>gi|159029905|emb|CAO90959.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 346

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 27/78 (34%), Gaps = 3/78 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + +  F +PQ R R +++ F        F+FP P   +  +  I+    D    IS K  
Sbjct: 159 IDSKYFQIPQSRPRFFLLAFRKDLGIKNFQFPQPCHAEVGIEKIIVPG-DYSIPISEKWQ 217

Query: 59  EGHQKRKENNKIAGKGFG 76
           +               F 
Sbjct: 218 QYIDYYAGRITAEQLSFQ 235


>gi|149919032|ref|ZP_01907517.1| DNA-cytosine methyltransferase family protein [Plesiocystis
           pacifica SIR-1]
 gi|149820185|gb|EDM79604.1| DNA-cytosine methyltransferase family protein [Plesiocystis
           pacifica SIR-1]
          Length = 401

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 26/68 (38%), Gaps = 9/68 (13%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-----IKPRLGDILEEHIDDKST---I 53
            A D+GVPQ R+RL+++  +    +F  P+P             D +    + +      
Sbjct: 169 NAADYGVPQFRQRLFVLASIEGK-DFSMPSPTHGDGALEYITAWDAIGHLDNKRWPKELS 227

Query: 54  SNKLWEGH 61
               W G 
Sbjct: 228 PTGRWAGL 235


>gi|110834520|ref|YP_693379.1| C-5 cytosine-specific DNA methylase family protein [Alcanivorax
           borkumensis SK2]
 gi|110647631|emb|CAL17107.1| C-5 cytosine-specific DNA methylase family protein [Alcanivorax
           borkumensis SK2]
          Length = 308

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 28/74 (37%), Gaps = 9/74 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG-----IKPRLGDILEEHI--DDKST 52
           +   DFGVPQ R+RL  +   +   E F FP          K  +GD + +     +   
Sbjct: 137 IDVSDFGVPQERKRLIFVGVRSDLGEVFAFPEATHGTAIQNKITIGDAIGDLPLWPEGDY 196

Query: 53  ISNKL-WEGHQKRK 65
            +    W    + +
Sbjct: 197 WTETFHWYYLSRNR 210


>gi|227431785|ref|ZP_03913812.1| possible DNA (cytosine-5-)-methyltransferase [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
 gi|227352468|gb|EEJ42667.1| possible DNA (cytosine-5-)-methyltransferase [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
          Length = 448

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 32/92 (34%), Gaps = 17/92 (18%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            + DFGVPQ RER+YII  L    E + FP           I+++               
Sbjct: 150 NSKDFGVPQNRERVYIIGHLRGDSEREVFPFFGENGEINQSIIKQ--------------- 194

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
                   K+       G  +   +   T+SA
Sbjct: 195 -IGNVSTGKMLENNSQSGRVYSLDSLAPTISA 225


>gi|242022906|ref|XP_002431878.1| DNA cytosine-5,-methyltransferase, putative [Pediculus humanus
            corporis]
 gi|212517219|gb|EEB19140.1| DNA cytosine-5,-methyltransferase, putative [Pediculus humanus
            corporis]
          Length = 1330

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 28/60 (46%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            ++A ++G+PQ R RL+I+          FP P  +       L+  +DDK   +N  W  
Sbjct: 1032 LQAGNYGIPQTRRRLFILAAAPNLKLPLFPEPTHVFSLRASNLQVTVDDKRFTTNCKWST 1091


>gi|326802740|ref|YP_004320558.1| DNA (cytosine-5-)-methyltransferase [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651598|gb|AEA01781.1| DNA (cytosine-5-)-methyltransferase [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 321

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+ +    T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-SFSFDKLERKETRPLSEFLEKDVSGLYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFKGRLKVIKD-FSYTIS 235


>gi|225863800|ref|YP_002749178.1| cytosine-specific methyltransferase NlaX [Bacillus cereus 03BB102]
 gi|225788166|gb|ACO28383.1| cytosine-specific methyltransferase NlaX [Bacillus cereus 03BB102]
          Length = 576

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS 24
           + + DFGVPQ RER++II  L  +
Sbjct: 148 LNSKDFGVPQNRERVFIIGHLRGT 171


>gi|326789360|ref|YP_004307181.1| DNA-cytosine methyltransferase [Clostridium lentocellum DSM 5427]
 gi|326540124|gb|ADZ81983.1| DNA-cytosine methyltransferase [Clostridium lentocellum DSM 5427]
          Length = 446

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPL 33
           + A D+GVPQ RER+++I      +V ++ P   
Sbjct: 165 LNAADYGVPQIRERVFVIAIKKNENVRYELPKAT 198


>gi|227540659|ref|ZP_03970708.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227239483|gb|EEI89498.1| possible DNA (cytosine-5-)-methyltransferase [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 386

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 12/42 (28%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE------------FKFP 30
           + + DFGVPQ RER++ +      ++            F FP
Sbjct: 171 LNSLDFGVPQHRERIFFVGIRKEFLDGKIVEQGSFGKWFPFP 212


>gi|238801891|ref|YP_002925094.1| putative DNA methylase [Streptococcus phage 5093]
 gi|238558577|gb|ACR45907.1| putative DNA methylase [Streptococcus phage 5093]
          Length = 319

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFP 30
           + + DFGVPQ RERL+II           FP
Sbjct: 147 LNSKDFGVPQNRERLFIIGHLRGERGRKVFP 177


>gi|258652183|ref|YP_003201339.1| DNA-cytosine methyltransferase [Nakamurella multipartita DSM 44233]
 gi|258555408|gb|ACV78350.1| DNA-cytosine methyltransferase [Nakamurella multipartita DSM 44233]
          Length = 467

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 32/71 (45%), Gaps = 6/71 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE------HIDDKSTIS 54
           +   +FG+PQ R+R Y +   +   +F++P        +  +L+        I  ++T +
Sbjct: 154 LSPHEFGIPQIRDRAYFVGSRDGLEQFRWPETEKSSTDIKSVLKHDLVDVRPIPAQTTHA 213

Query: 55  NKLWEGHQKRK 65
             +W+   KR 
Sbjct: 214 INMWDDFLKRS 224


>gi|284054848|ref|ZP_06385058.1| DNA-cytosine methyltransferase [Arthrospira platensis str. Paraca]
          Length = 220

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 36/99 (36%), Gaps = 14/99 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT------PLGIKPRLGDILEEHIDDKSTIS 54
           + A ++GVPQ+RERL+++ +      + +P       P      + D           ++
Sbjct: 77  INAVNYGVPQKRERLFVVAY---QTAWNWPEAETLAIPYTAGDAIYDTASTIPIGAKFLT 133

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
             + E   + +  +K       Y           TL+ R
Sbjct: 134 PSMLEYIGRYEAKSKCVKPRDIY-----LDIPCRTLTCR 167


>gi|332665156|ref|YP_004447944.1| DNA-cytosine methyltransferase [Haliscomenobacter hydrossis DSM
           1100]
 gi|332333970|gb|AEE51071.1| DNA-cytosine methyltransferase [Haliscomenobacter hydrossis DSM
           1100]
          Length = 416

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           + A ++GVPQRRER  +I       E  FP P  
Sbjct: 193 LNAANYGVPQRRERFILIGM-KGIKEPAFPLPTH 225


>gi|168490143|ref|ZP_02714342.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae SP195]
 gi|183571468|gb|EDT91996.1| cytosine-specific methyltransferase NlaX (M.NlaX) [Streptococcus
           pneumoniae SP195]
 gi|321157174|emb|CBW39159.1| Cytosine-specific DNA methyltransferase [Streptococcus phage 11865]
          Length = 360

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 37/124 (29%), Gaps = 25/124 (20%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILE---------EHIDDK 50
           + + +FGVPQ RER++II           FP     +      +            ++ +
Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRRERTRRFFPLSGKNQSTSNQSVMKIGNINPSGNGMNGE 206

Query: 51  STISNKLWEGHQKRKENNKIAG--------------KGFGYGLFFENSATTNTLSARYYK 96
              ++ L       K   +                      G+ +E      T+ A Y  
Sbjct: 207 VYQADGLAPTLTTNKGEGQKIAIKSNTIKQFGVLQPNFNQCGVVYETDGIAPTIRA-YQG 265

Query: 97  DGSE 100
            G E
Sbjct: 266 GGLE 269


>gi|315657354|ref|ZP_07910236.1| modification methylase NgoPII [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
 gi|315491826|gb|EFU81435.1| modification methylase NgoPII [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
          Length = 355

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 5/60 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG----IKPRLGDILEEHIDDKSTISNK 56
            A ++GV + R+R++ I F    +++F FP         K  L D++ +  +     + K
Sbjct: 149 NAKNYGVAEERKRVFYIGFRKDLNIDFVFPKGSTEDDAKKITLRDVIWDLQETAVPAAEK 208


>gi|304390097|ref|ZP_07372051.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|304326579|gb|EFL93823.1| DNA (cytosine-5-)-methyltransferase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
          Length = 355

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 5/60 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG----IKPRLGDILEEHIDDKSTISNK 56
            A ++GV + R+R++ I F    +++F FP         K  L D++ +  +     + K
Sbjct: 149 NAKNYGVAEERKRVFYIGFRKDLNIDFVFPKGSTEDDAKKITLRDVIWDLQETAVPAAEK 208


>gi|298492225|ref|YP_003722402.1| DNA-cytosine methyltransferase ['Nostoc azollae' 0708]
 gi|298234143|gb|ADI65279.1| DNA-cytosine methyltransferase ['Nostoc azollae' 0708]
          Length = 434

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 10/45 (22%), Positives = 20/45 (44%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45
           + A ++GVPQ RERL+++           P  +    +  + +  
Sbjct: 157 LNAANYGVPQNRERLFLLGCRQDLKLPNHPDKITHPAKSNNSIAC 201


>gi|160894995|ref|ZP_02075769.1| hypothetical protein CLOL250_02545 [Clostridium sp. L2-50]
 gi|156863426|gb|EDO56857.1| hypothetical protein CLOL250_02545 [Clostridium sp. L2-50]
          Length = 447

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPT 31
           + + DFGVPQ R+R+YI+ +L+         FP 
Sbjct: 164 LNSKDFGVPQSRKRVYIVGYLDGRCAGKILPFPK 197


>gi|153852755|ref|ZP_01994192.1| hypothetical protein DORLON_00174 [Dorea longicatena DSM 13814]
 gi|149754397|gb|EDM64328.1| hypothetical protein DORLON_00174 [Dorea longicatena DSM 13814]
          Length = 367

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPT 31
           + + DFGVPQ R+R+YI+ +L+         FP 
Sbjct: 84  LNSKDFGVPQSRKRVYIVGYLDGRCAGKILPFPK 117


>gi|306835815|ref|ZP_07468812.1| modification methylase NaeI [Corynebacterium accolens ATCC 49726]
 gi|304568289|gb|EFM43857.1| modification methylase NaeI [Corynebacterium accolens ATCC 49726]
          Length = 345

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 7/61 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           ++A ++GVPQ R R  ++       E F +P  +  +  +G+ L      K  ++   W+
Sbjct: 154 LQAANYGVPQLRPRFILVALKKEFSEFFAWPNKVPHQVTVGEAL------KDLMAENGWK 207

Query: 60  G 60
           G
Sbjct: 208 G 208


>gi|212695555|ref|ZP_03303683.1| hypothetical protein ANHYDRO_00072 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212677433|gb|EEB37040.1| hypothetical protein ANHYDRO_00072 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 321

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+R+R++++  L  +  F F      +     +ILE+++ +  T++     
Sbjct: 151 LNAMDFGIPQKRDRIFVVSCLGAN-NFSFNKLERKETSPLSEILEKNVSELYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFRGRLKVIKD-FSYTIS 235


>gi|153815491|ref|ZP_01968159.1| hypothetical protein RUMTOR_01726 [Ruminococcus torques ATCC 27756]
 gi|145847133|gb|EDK24051.1| hypothetical protein RUMTOR_01726 [Ruminococcus torques ATCC 27756]
          Length = 439

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 29/85 (34%), Gaps = 1/85 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DFGVPQ R+R+Y++ +L+        P P      L  I       +      L  
Sbjct: 160 LNSKDFGVPQSRKRVYLVGYLDRRCAGKILPFPAANGTSLIQIRTGSQGKRVYSPEGLSC 219

Query: 60  GHQKRKENNKIAGKGFGYGLFFENS 84
                          +  G+  + +
Sbjct: 220 TLTSLAGGMGGKTGLYEMGIPIKEN 244


>gi|237753192|ref|ZP_04583672.1| cytosine specific DNA methyltransferase [Helicobacter winghamensis
           ATCC BAA-430]
 gi|229375459|gb|EEO25550.1| cytosine specific DNA methyltransferase [Helicobacter winghamensis
           ATCC BAA-430]
          Length = 354

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43
           + A DF VPQ RER + I      + F  P P  ++  + D +
Sbjct: 156 LNAKDFCVPQNRERAFFIAHKKEYLGF--PAPSEMQVCVKDAI 196


>gi|307244197|ref|ZP_07526312.1| DNA (cytosine-5-)-methyltransferase [Peptostreptococcus stomatis
           DSM 17678]
 gi|306492347|gb|EFM64385.1| DNA (cytosine-5-)-methyltransferase [Peptostreptococcus stomatis
           DSM 17678]
          Length = 534

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 28/82 (34%), Gaps = 6/82 (7%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIK----PRLGDILEEHIDD-KSTISN 55
            A  +GVPQ R R+ ++ F     + F FP     +        DI EE  +      S 
Sbjct: 340 NASSYGVPQNRIRVIVVAFRKDLNKMFIFPEEQSKEGLNIGMCLDIPEEVPNQVDWPFSP 399

Query: 56  KLWEGHQKRKENNKIAGKGFGY 77
           +     Q   E        + Y
Sbjct: 400 QAMNLIQHIPEGGSWKSIPYEY 421


>gi|268680630|ref|YP_003305061.1| DNA-cytosine methyltransferase [Sulfurospirillum deleyianum DSM
           6946]
 gi|268618661|gb|ACZ13026.1| DNA-cytosine methyltransferase [Sulfurospirillum deleyianum DSM
           6946]
          Length = 398

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 21/107 (19%), Positives = 35/107 (32%), Gaps = 13/107 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-----------SVEFK-FPTPLGIKPRLGDILEEHID 48
           + A ++GVPQ RER+  I                + EF  +P P          +++ + 
Sbjct: 199 LHAGNYGVPQTRERIIFIGVRKDILSEDLHVKLQNGEFSLYPEPTHDIKHDFVTVKDALF 258

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
           D           HQK  +         G      N     T+ A ++
Sbjct: 259 DLCEPEQSEDLSHQKYSKAKWFGKHCQGQTEINPN-KLAPTIRAEHH 304


>gi|167046802|ref|YP_001661472.1| DNA methyltransferase [Acinetobacter venetianus]
 gi|83833711|gb|ABC47668.1| DNA methyltransferase [Acinetobacter venetianus]
          Length = 737

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 35/94 (37%), Gaps = 9/94 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-------LGIKPRLGDILEEHID-DKST 52
           + +  +GVPQ+RER++++       +F FP P       L     +GD + +  + +   
Sbjct: 155 IDSSLYGVPQKRERVFLMGTRLQHKKFNFPKPDVKPYGFLKSFKNVGDAINDLANFENEE 214

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSAT 86
             N +   H    +  +      G  L       
Sbjct: 215 FPNHIILNHSDIVKR-RYELIPEGGKLPKPEDLP 247



 Score = 47.3 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 33/94 (35%), Gaps = 23/94 (24%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG---------------------IKPRL 39
           + A D+GVPQ R+R  +I      V   FP P                       + P  
Sbjct: 528 INAADYGVPQLRKRFLLIGTKTDLV-IPFPKPKYFSTPDSWQLPYRTVGEVITDLMDPSS 586

Query: 40  GDILEEHIDDKSTISN-KLWEGHQKRKENNKIAG 72
            D+L  H+  K   +  + +   ++ K+ +    
Sbjct: 587 YDLLSHHVPAKHAPTIVERYSYIEEGKKLDIERL 620


>gi|127416|sp|P10283|MTB1_BREEP RecName: Full=Modification methylase BepI; Short=M.BepI; AltName:
           Full=Cytosine-specific methyltransferase BepI
 gi|580766|emb|CAA31907.1| unnamed protein product [Brevibacterium epidermidis]
          Length = 403

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 36/118 (30%), Gaps = 28/118 (23%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK--------------FPTPL---------GIKP 37
           + A ++GV Q RER+  I         K              +P P              
Sbjct: 202 LNAKNYGVAQNRERVIFIGISKRYANKKILDELISLQEKSEVYPYPPYTHGTDPELKPYA 261

Query: 38  RLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
            L  IL    + +   ++K  + + K K       K     +    +    T+ A ++
Sbjct: 262 TLNQILAHLPEPELASTDKSQQSYSKAKL-----FKKTQGNIEVNMNGQAPTIRAEHH 314


>gi|298504551|gb|ADI83274.1| DNA cytosine methyltransferase [Geobacter sulfurreducens KN400]
          Length = 428

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 36/102 (35%), Gaps = 9/102 (8%)

Query: 1   MKACDFGVPQRRERLYIID--FLNPSVEFKFPTPLGIKPRLGDILEEHID-DKSTISNKL 57
           + A D+GVPQ R R +II   F NP+  F  P     KP  G       + D  T +  +
Sbjct: 178 LCAADYGVPQIRWRAFIIGCSFTNPAAVFP-PKKTNFKPNNGYRKAFSEEFDSYTENPHI 236

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS-----ATTNTLSARY 94
           W+  +    +                        T T  ARY
Sbjct: 237 WKTVRDAISDLPEPVGTEVRDAIPPLDLHFGRTPTPTSIARY 278


>gi|46019864|emb|CAE52388.1| putative cytosine-specific methyltransferase [Streptococcus
           thermophilus]
 gi|312279225|gb|ADQ63882.1| Cytosine-specific methyltransferase [Streptococcus thermophilus
           ND03]
          Length = 515

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-PRLGDILEEHIDDKSTISNKLWE 59
           + + +FGVPQ+R R+  + + N     ++P P  +    + D L    +      + + E
Sbjct: 182 LNSANFGVPQQRNRVVFLAYRNDVNPLEYPEPNVLPEVTVRDALTGLYN---INQDDISE 238

Query: 60  GHQKR 64
             Q R
Sbjct: 239 YAQNR 243


>gi|300933957|ref|ZP_07149213.1| DNA-cytosine methyltransferase [Corynebacterium resistens DSM
           45100]
          Length = 363

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 35/92 (38%), Gaps = 9/92 (9%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG------IKPRLGDILEEHIDDKSTIS 54
              ++GVPQ RER+ I+     +   FK P P             G+ LE    +K   +
Sbjct: 152 NFAEYGVPQFRERVLIVGIRRDTGFNFKHPAPTHGPRGELPYMTAGEALEGV--EKVPFN 209

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSAT 86
           N       + +E  K   +G  +    ++S  
Sbjct: 210 NNHMRQMPRTREILKRIPEGGNFTDIPKDSPY 241


>gi|331085773|ref|ZP_08334856.1| hypothetical protein HMPREF0987_01159 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406696|gb|EGG86201.1| hypothetical protein HMPREF0987_01159 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 356

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31
           + A D+GVPQ R+RL  +         KFP 
Sbjct: 149 LCAADYGVPQIRKRLIFMGIRKDIGAPKFPE 179


>gi|268686152|ref|ZP_06153014.1| modification methylase NgoFVII [Neisseria gonorrhoeae SK-93-1035]
 gi|268626436|gb|EEZ58836.1| modification methylase NgoFVII [Neisseria gonorrhoeae SK-93-1035]
          Length = 374

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37
              +FGVPQ RER+ I+     +  +F+ P P   + 
Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 196


>gi|187778292|ref|ZP_02994765.1| hypothetical protein CLOSPO_01884 [Clostridium sporogenes ATCC
           15579]
 gi|187771917|gb|EDU35719.1| hypothetical protein CLOSPO_01884 [Clostridium sporogenes ATCC
           15579]
          Length = 355

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 34/104 (32%), Gaps = 13/104 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPT-PLGIKPRLGDILEEHIDDKSTISNKLW 58
           + + DFGVPQ RER++ I  L      K FP      +  L  ++     ++    + + 
Sbjct: 146 LNSKDFGVPQNRERVFTIGHLRRYGRRKIFPIGGSNGEATLKQLIGGSQGNRVYDPSGIS 205

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN-----------SATTNTLS 91
                +          +  G    N              + T++
Sbjct: 206 CTLAGQAGGQGAKTGLYLVGNVHPNGKGMNGNVYDSKGISPTIT 249


>gi|288906872|emb|CBJ21706.1| type II DNA modification methyltransferase [Streptococcus mitis B6]
          Length = 380

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30
           + + +FGVPQ RER++II  L  +   K FP
Sbjct: 147 LNSKNFGVPQNRERVFIIGHLRGTSGRKVFP 177


>gi|59800809|ref|YP_207521.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           FA 1090]
 gi|254493277|ref|ZP_05106448.1| modification methylase NgoFVII [Neisseria gonorrhoeae 1291]
 gi|260440968|ref|ZP_05794784.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           DGI2]
 gi|268594414|ref|ZP_06128581.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           35/02]
 gi|268596411|ref|ZP_06130578.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           FA19]
 gi|268598542|ref|ZP_06132709.1| modification methylase NgoFVII [Neisseria gonorrhoeae MS11]
 gi|268600894|ref|ZP_06135061.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID18]
 gi|268681681|ref|ZP_06148543.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID332]
 gi|268683908|ref|ZP_06150770.1| modification methylase NgoFVII [Neisseria gonorrhoeae SK-92-679]
 gi|291044296|ref|ZP_06570005.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           DGI2]
 gi|293399487|ref|ZP_06643640.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|59717704|gb|AAW89109.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           FA 1090]
 gi|226512317|gb|EEH61662.1| modification methylase NgoFVII [Neisseria gonorrhoeae 1291]
 gi|268547803|gb|EEZ43221.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           35/02]
 gi|268550199|gb|EEZ45218.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           FA19]
 gi|268582673|gb|EEZ47349.1| modification methylase NgoFVII [Neisseria gonorrhoeae MS11]
 gi|268585025|gb|EEZ49701.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID18]
 gi|268621965|gb|EEZ54365.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID332]
 gi|268624192|gb|EEZ56592.1| modification methylase NgoFVII [Neisseria gonorrhoeae SK-92-679]
 gi|291011190|gb|EFE03186.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           DGI2]
 gi|291610056|gb|EFF39178.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
          Length = 374

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37
              +FGVPQ RER+ I+     +  +F+ P P   + 
Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 196


>gi|112983430|ref|NP_001036980.1| DNA cytosine-5 methyltransferase [Bombyx mori]
 gi|54888739|dbj|BAD67189.1| DNA cytosine-5 methyltransferase [Bombyx mori]
          Length = 1409

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 31/86 (36%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            ++A ++GVPQ R RL I+          +P P  +  R    L   ID K   +N  W+ 
Sbjct: 1106 LQAGNYGVPQTRRRLIILAAAPGYNLPFYPEPTHVFSRRACTLTTTIDGKRFSTNIHWDE 1165

Query: 61   HQKRKENNKIAGKGFGYGLFFENSAT 86
               ++             +    +  
Sbjct: 1166 SAPKRTCTIQDAMSDLPQICNGANKI 1191


>gi|311897184|dbj|BAJ29592.1| putative modification methylase [Kitasatospora setae KM-6054]
          Length = 433

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 33/92 (35%), Gaps = 8/92 (8%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            A D+GVPQ R R+ I+ F     V+ +    L         L      +S ++   WE 
Sbjct: 202 NAADYGVPQIRNRVIIVAFRRDLKVDIELFKELVKPTHSETALI-----RSMMAGGYWEH 256

Query: 61  HQKRKENNKIAGKGFGYGLFFENSA--TTNTL 90
           H     + +   +     +  ++       TL
Sbjct: 257 HADVPPHVREWVEKRLPKVSPKDDGLLPWRTL 288


>gi|310819714|ref|YP_003952072.1| cytosine-specific methyltransferase [Stigmatella aurantiaca
           DW4/3-1]
 gi|309392786|gb|ADO70245.1| Cytosine-specific methyltransferase [Stigmatella aurantiaca
           DW4/3-1]
          Length = 421

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
            A  +GVPQ R+RL I+   +  V F  P+P  
Sbjct: 166 NAASYGVPQLRKRLIIVGARDGKV-FNVPSPTH 197


>gi|11386930|sp|Q59606|MTF7_NEIGO RecName: Full=Modification methylase NgoFVII; Short=M.NgoFVII;
           AltName: Full=Cytosine-specific methyltransferase
           NgoFVII; Short=M.NgoVII
 gi|1165245|gb|AAA86270.1| M.NgoVII [Neisseria gonorrhoeae]
          Length = 374

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37
              +FGVPQ RER+ I+     +  +F+ P P   + 
Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 196


>gi|302380785|ref|ZP_07269249.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna
           ACS-171-V-Col3]
 gi|302311385|gb|EFK93402.1| DNA (cytosine-5-)-methyltransferase [Finegoldia magna
           ACS-171-V-Col3]
          Length = 321

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 8/92 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A DFG+PQ+RER++++  L  +  F F      + R   + LE+ +    T++     
Sbjct: 151 LNAMDFGIPQKRERIFVVSCLGAN-SFSFDKLERKETRPLSEFLEKDVSGLYTMTQPYM- 208

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
                K  NK     F   L       + T+S
Sbjct: 209 ----LKFLNKGIDNSFRGRLKVIKD-FSYTIS 235


>gi|284928852|ref|YP_003421374.1| DNA-methyltransferase Dcm [cyanobacterium UCYN-A]
 gi|284809311|gb|ADB95016.1| DNA-methyltransferase Dcm [cyanobacterium UCYN-A]
          Length = 422

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 13/102 (12%), Positives = 33/102 (32%), Gaps = 18/102 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP-----------LGIKPRLGDILEEHIDD 49
           + A ++GVPQ R+RL+I+   +      +P             +   P +   + +  + 
Sbjct: 157 LNAANYGVPQIRKRLFIMGGKSDLPLPDYPQFLTNYNQEINSTIPFTPTVSQAINDLPEV 216

Query: 50  KSTISNKLWEGHQ-------KRKENNKIAGKGFGYGLFFENS 84
                    +  +          +    +   F Y   ++ +
Sbjct: 217 NHYPELSYKDSMKVNSSKLNDYVKGLLDSNDNFSYKRIYDKN 258


>gi|17232307|ref|NP_488855.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120]
 gi|17133952|dbj|BAB76514.1| site-specific DNA-methyltransferase [Nostoc sp. PCC 7120]
          Length = 414

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 26/75 (34%), Gaps = 4/75 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR---LGDILEEHIDDKSTISNKL 57
           + A ++G+PQ RER++I+      V    P               L    D     +  L
Sbjct: 159 LNAAEYGIPQIRERIFIVGNKKGKV-LGIPKKTHSLQFLNLNRSQLSIFDDMSIIPALTL 217

Query: 58  WEGHQKRKENNKIAG 72
           W+      E N   G
Sbjct: 218 WDAISDLPELNAREG 232


>gi|315636653|ref|ZP_07891886.1| modification methylase Eco47II [Arcobacter butzleri JV22]
 gi|315479079|gb|EFU69779.1| modification methylase Eco47II [Arcobacter butzleri JV22]
          Length = 411

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEEHID-DKSTISNK 56
           +KA  + VPQ+RERL I+         V + +P P      L D L++    DK    + 
Sbjct: 217 LKAIYYKVPQKRERLIIVGIKKEFMEKVTYSYPEPNEKIYTLKDALKKGELFDKDVPKSS 276

Query: 57  LWEGHQKRKE 66
             +  +++KE
Sbjct: 277 GQKYPKRKKE 286


>gi|331219056|ref|XP_003322205.1| hypothetical protein PGTG_03742 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309301195|gb|EFP77786.1| hypothetical protein PGTG_03742 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 1194

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 23/59 (38%), Gaps = 1/59 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG-DILEEHIDDKSTISNKLW 58
           ++A  FG PQ R R+      +     K P P    P  G  IL    D+KS  +    
Sbjct: 694 LQAAQFGSPQARRRIIFAGTRHGLTAIKLPEPTHHYPDEGLAILLPTNDEKSDHNGHRL 752


>gi|302873674|ref|YP_003842307.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
 gi|307686602|ref|ZP_07629048.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
 gi|302576531|gb|ADL50543.1| DNA-cytosine methyltransferase [Clostridium cellulovorans 743B]
          Length = 448

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 29/84 (34%), Gaps = 1/84 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DFGVPQ RER++II  L      +  P     +  L  I+     ++   S  +  
Sbjct: 151 LNSKDFGVPQNRERVFIIASLRSRGRREILPIGGENRATLKQIIGVCQGERVYDSEGVAC 210

Query: 60  GHQKRKENNKIAGKGFGYGLFFEN 83
                          +  G    +
Sbjct: 211 TLTGCGGGGGAKTGLYCVGNINPS 234


>gi|91215328|ref|ZP_01252299.1| modification methylase (Eco47II, Sau96I) [Psychroflexus torquis
           ATCC 700755]
 gi|91186280|gb|EAS72652.1| modification methylase (Eco47II, Sau96I) [Psychroflexus torquis
           ATCC 700755]
          Length = 412

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEH--IDDKSTISNKL 57
           +KA ++ VPQ+RERL ++       +E+ +P+P      L D L++    D K  IS   
Sbjct: 221 LKAINYNVPQKRERLILVGVRKDIDLEYVYPSPYEKVYNLSDALKKGELYDSKVPISKGT 280

Query: 58  WEGHQKRKE 66
            +  + +K+
Sbjct: 281 -QYPENKKK 288


>gi|325133150|gb|EGC55821.1| modification methylase HphIA [Neisseria meningitidis M6190]
 gi|325138766|gb|EGC61318.1| modification methylase HphIA [Neisseria meningitidis ES14902]
 gi|325197365|gb|ADY92821.1| modification methylase HphIA [Neisseria meningitidis G2136]
 gi|325203202|gb|ADY98655.1| modification methylase HphIA [Neisseria meningitidis M01-240355]
          Length = 332

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-IKPRLGDILEEHID 48
           + A DFGVPQ R R+  I       +  FP PL      +G  +     
Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGSAIGHFPK 202


>gi|268602423|ref|ZP_06136590.1| site-specific DNA-methyltransferase HphI [Neisseria gonorrhoeae
           PID18]
 gi|268586554|gb|EEZ51230.1| site-specific DNA-methyltransferase HphI [Neisseria gonorrhoeae
           PID18]
          Length = 315

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-IKPRLGDILEEHID 48
           + A DFGVPQ R R+  I       +  FP PL      +G  +     
Sbjct: 137 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGSAIGHFPK 184


>gi|240114016|ref|ZP_04728506.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           MS11]
          Length = 333

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-IKPRLGDILEEHID 48
           + A DFGVPQ R R+  I       +  FP PL      +G  +     
Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGSAIGHFPK 202


>gi|1098476|gb|AAC37047.1| orf; homologous to Haemophilus parahaemolyticus hphIM(C) Accession
           Number M24625 [Neisseria meningitidis]
          Length = 276

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-IKPRLGDILEEHID 48
           + A DFGVPQ R R+  I       +  FP PL      +G  +     
Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGSAIGHFPK 202


>gi|59802210|ref|YP_208922.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           FA 1090]
 gi|239997871|ref|ZP_04717795.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           35/02]
 gi|240015148|ref|ZP_04722061.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           DGI18]
 gi|240017596|ref|ZP_04724136.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           FA6140]
 gi|240081740|ref|ZP_04726283.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           FA19]
 gi|240116752|ref|ZP_04730814.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           PID18]
 gi|240118973|ref|ZP_04733035.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           PID1]
 gi|240122219|ref|ZP_04735181.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           PID24-1]
 gi|240124509|ref|ZP_04737465.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           PID332]
 gi|240124618|ref|ZP_04737504.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           SK-92-679]
 gi|240129189|ref|ZP_04741850.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|260439487|ref|ZP_05793303.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           DGI2]
 gi|268593717|ref|ZP_06127884.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae 35/02]
 gi|268597838|ref|ZP_06132005.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae FA19]
 gi|268683185|ref|ZP_06150047.1| site-specific DNA-methyltransferase HphI [Neisseria gonorrhoeae
           SK-92-679]
 gi|291042721|ref|ZP_06568462.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae DGI2]
 gi|293398253|ref|ZP_06642458.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|2330911|gb|AAC45838.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae]
 gi|59719105|gb|AAW90510.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           FA 1090]
 gi|268547106|gb|EEZ42524.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae 35/02]
 gi|268551626|gb|EEZ46645.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae FA19]
 gi|268623469|gb|EEZ55869.1| site-specific DNA-methyltransferase HphI [Neisseria gonorrhoeae
           SK-92-679]
 gi|291013155|gb|EFE05121.1| 5-methylcytosine methyltransferase [Neisseria gonorrhoeae DGI2]
 gi|291611516|gb|EFF40586.1| DNA (cytosine-5-)-methyltransferase [Neisseria gonorrhoeae F62]
 gi|317165321|gb|ADV08862.1| putative 5-methylcytosine methyltransferase [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 333

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-IKPRLGDILEEHID 48
           + A DFGVPQ R R+  I       +  FP PL      +G  +     
Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGSAIGHFPK 202


>gi|209546991|ref|YP_002278909.1| DNA-cytosine methyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538235|gb|ACI58169.1| DNA-cytosine methyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 355

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 34/99 (34%), Gaps = 7/99 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A DFG PQRR R  +I  LN   E     P    P L   + +  +  +  +    E 
Sbjct: 147 LNAADFGCPQRRSRYIVIAALNSDPELPKAVPNVEVPTLWQAIGDLPELLNGATVDELEY 206

Query: 61  ----HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
                 +     +         L   N+ +   + ARY 
Sbjct: 207 GGAPLSEYARRMRSDLAKCTGHLVSRNADS---IVARYA 242


>gi|217032692|ref|ZP_03438178.1| hypothetical protein HPB128_202g26 [Helicobacter pylori B128]
 gi|216945622|gb|EEC24273.1| hypothetical protein HPB128_202g26 [Helicobacter pylori B128]
          Length = 211

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHID 48
           + + DF + Q+RERLYI+ F       F FP  L       D L+   +
Sbjct: 139 LNSTDFQLAQKRERLYIVGFRKDLKHPFHFPLGLANDYYFEDFLDADNE 187


>gi|240127759|ref|ZP_04740420.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 347

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37
              +FGVPQ RER+ I+     +  +F+ P P   + 
Sbjct: 133 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 169


>gi|308229518|gb|ADO24171.1| M.AciI [Arthrobacter citreus]
          Length = 703

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 32/92 (34%), Gaps = 9/92 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--------SVEFKFPTPLGIKPRLGDILEEHIDDKST 52
           M A D+GVPQ R R Y +   N         + EF FP    +   +   +E        
Sbjct: 525 MNAKDYGVPQNRNRWYCVGINNDLGVVSTSMNSEF-FPEKEELTTFIDSFIETTFLPTYE 583

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENS 84
           +S    +      E  K + +     L   N+
Sbjct: 584 VSEIAQKNMNAFIEEFKNSPRYNPNHLIIANN 615



 Score = 38.4 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 20/138 (14%), Positives = 39/138 (28%), Gaps = 45/138 (32%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLG------------------- 40
           + + + G+PQ R+R YI+   + P+ +F+          L                    
Sbjct: 165 INSNEAGLPQNRDRTYIVGIKDFPTEKFEEDKRSKKISCLKKELNELEFHGFNFFNNVNF 224

Query: 41  --------DILEEHIDDKSTI-SNKLWEGHQKRKENNKIA----------------GKGF 75
                   DIL++ +D K    S K+         +                        
Sbjct: 225 YNESQIISDILDDIVDKKYYFNSEKMKRFLSTINIDEVNEPVSKIVKVLDLPRETHNDNE 284

Query: 76  GYGLFFENSATTNTLSAR 93
                +  +  + T+ AR
Sbjct: 285 RQRRVYSVNGISPTILAR 302


>gi|317056067|ref|YP_004104534.1| DNA-cytosine methyltransferase [Ruminococcus albus 7]
 gi|315448336|gb|ADU21900.1| DNA-cytosine methyltransferase [Ruminococcus albus 7]
          Length = 425

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP 23
           + + DFGVPQ R+R++II FL  
Sbjct: 146 LNSADFGVPQARKRVFIIGFLRG 168


>gi|194098099|ref|YP_002001147.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998556|ref|ZP_04718480.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           35/02]
 gi|240013681|ref|ZP_04720594.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           DGI18]
 gi|240016120|ref|ZP_04722660.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           FA6140]
 gi|240080261|ref|ZP_04724804.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           FA19]
 gi|240112474|ref|ZP_04726964.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           MS11]
 gi|240115214|ref|ZP_04729276.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           PID18]
 gi|240120750|ref|ZP_04733712.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           PID24-1]
 gi|240123054|ref|ZP_04736010.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           PID332]
 gi|240125307|ref|ZP_04738193.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           SK-92-679]
 gi|193933389|gb|ACF29213.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           NCCP11945]
 gi|317163831|gb|ADV07372.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 347

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37
              +FGVPQ RER+ I+     +  +F+ P P   + 
Sbjct: 133 NFAEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 169


>gi|307354298|ref|YP_003895349.1| DNA-cytosine methyltransferase [Methanoplanus petrolearius DSM
           11571]
 gi|307157531|gb|ADN36911.1| DNA-cytosine methyltransferase [Methanoplanus petrolearius DSM
           11571]
          Length = 421

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEHID 48
           + A DFGV Q R+R+  I +     +F++P          + D+L +  +
Sbjct: 202 LNARDFGVLQNRKRIIFIGWKKEH-DFEYPNFGNHESGYVVWDVLRDLPE 250


>gi|207109252|ref|ZP_03243414.1| putative site-specific DNA-methyltransferase [Helicobacter pylori
           HPKX_438_CA4C1]
          Length = 210

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A DF VPQ RER+ I+ +L   V F F  P+  
Sbjct: 171 LNAKDFSVPQNRERIIIVGYLGSQV-FDF-NPIKK 203


>gi|315585937|gb|ADU40318.1| site-specific DNA-methyltransferase [Helicobacter pylori 35A]
          Length = 295

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 5/56 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + +  +G   RRERL I+   N     F FP P  +     D +   +D K   ++
Sbjct: 91  LNSAWYGSATRRERLIIVAIRNDLPFNFTFPKPTHL----SDEINTKLDFKDLPTS 142


>gi|283549176|ref|NP_001164521.1| DNA methyltransferase 1a [Nasonia vitripennis]
          Length = 1349

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 29/65 (44%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            ++A ++GVPQ R R+ I+      V  K+P PL +  +    L   ID+K       W  
Sbjct: 1039 LQAGNYGVPQTRRRMIILAAAPGEVLPKYPNPLHVFSKSACNLSVVIDNKKYFPTYDWVE 1098

Query: 61   HQKRK 65
                K
Sbjct: 1099 SAPYK 1103


>gi|325690436|gb|EGD32439.1| DNA (cytosine-5-)-methyltransferase [Streptococcus sanguinis SK115]
          Length = 390

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 31/97 (31%), Gaps = 4/97 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            + D+GV Q RER+Y +  L      +  P        L  ++      +   ++ +   
Sbjct: 151 NSKDYGVAQNRERVYTLGHLRSRGRRQVLPVRRESSSHLKQLIGGMQSYRVYDTSGISTT 210

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNT---LSARY 94
                         +           TNT   ++ARY
Sbjct: 211 LVGEGGGVGAKTGLYMIDQSLTAPKVTNTARCITARY 247


>gi|307193684|gb|EFN76367.1| DNA (cytosine-5)-methyltransferase 1 [Harpegnathos saltator]
          Length = 1460

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 28/59 (47%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            ++A ++GVPQ R RL I+          +P P  +  R    L   +D++   SN  W+
Sbjct: 1096 LQAGNYGVPQTRRRLIILAAAPGETLPCYPEPTNVFTRRCCRLSVVVDNRKYSSNCAWK 1154


>gi|311977229|gb|ADQ20489.1| M.AspCNI [Acinetobacter sp. 1690]
          Length = 327

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 16/39 (41%), Gaps = 1/39 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRL 39
              D+GV Q RER+ I+       VEF+ P         
Sbjct: 149 NFADYGVAQLRERVLIVGVRKDLDVEFEAPKKTHSPDSY 187


>gi|312903177|ref|ZP_07762357.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0635]
 gi|310633053|gb|EFQ16336.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0635]
          Length = 398

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 2/55 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + + D+ VPQ RER++II           FP          + ++   + K T  
Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGERTRKVFPLEKKNGTTAKNNIKPINNSKKTRE 200


>gi|308062818|gb|ADO04706.1| site-specific DNA-methyltransferase [Helicobacter pylori Cuz20]
          Length = 418

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 5/56 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + +  +G   +RERL I+   N     F FP P  +     D +   +D K   ++
Sbjct: 214 LNSAWYGSATKRERLIIVAIRNDLPFNFTFPKPTHL----SDEINTKLDFKDLPTS 265


>gi|170718974|ref|YP_001784137.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336]
 gi|168827103|gb|ACA32474.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336]
          Length = 323

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 33/85 (38%), Gaps = 6/85 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + +  +GVPQ RER+Y +          ++FP     KP    I     DD+    ++  
Sbjct: 148 LDSQFYGVPQMRERVYFVGIRKDIKHKPYQFPEMEDAKP----ISYYLSDDRDYTFDENN 203

Query: 59  EGHQKRKENNKIAGKGFGYGLFFEN 83
           E  QK   N    G+     +   +
Sbjct: 204 ETFQKYLNNKYNQGQNNLTEILQTD 228


>gi|311977245|gb|ADQ20501.1| M2.BfuAI [Lysinibacillus fusiformis]
          Length = 342

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK 36
           +   D+GVPQ RER++II       E  FP P   +
Sbjct: 156 LNMADYGVPQLRERVFIIGNRLGH-EVNFPLPTHSE 190


>gi|254673893|emb|CBA09676.1| C-5 cytosine-specific DNA methylase [Neisseria meningitidis
           alpha275]
          Length = 326

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-IKPRLGDILEEHID 48
           + A DFGVPQ R R+  I       +  FP PL      +G  +     
Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGSAIGHFPK 202


>gi|1808696|gb|AAC00045.1| putative type II 5-cytosoine methyltransferase [Corynebacterium
           glutamicum]
          Length = 363

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG 34
              ++GVPQ RER+ I+     +  +FK P P  
Sbjct: 152 NFAEYGVPQFRERVLIVGIRRDTGFDFKHPAPTH 185


>gi|319638577|ref|ZP_07993339.1| modification methylase NgoFVII [Neisseria mucosa C102]
 gi|317400326|gb|EFV80985.1| modification methylase NgoFVII [Neisseria mucosa C102]
          Length = 374

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37
              +FGVPQ RER+ I+     +  +F  P P   + 
Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFHHPEPTHNET 196


>gi|206972356|ref|ZP_03233302.1| modification methylase [Bacillus cereus AH1134]
 gi|206732681|gb|EDZ49857.1| modification methylase [Bacillus cereus AH1134]
          Length = 309

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/102 (21%), Positives = 36/102 (35%), Gaps = 19/102 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL-----GIKPRLGDILEEHIDDKSTISN 55
           +   DF +PQ+R+RL++I F      F  P P        +  + DI E + D       
Sbjct: 154 LDTFDFNLPQKRKRLFVIGFKK---SFSMPDPTQFQFFHRQLTIKDIKETNPD---FSIP 207

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97
              +     K  +  +           +    NT  A Y +D
Sbjct: 208 NYVKFRIDGKYRDLPS--------VKGDDDIGNTCVAHYARD 241


>gi|153008840|ref|YP_001370055.1| DNA-cytosine methyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151560728|gb|ABS14226.1| DNA-cytosine methyltransferase [Ochrobactrum anthropi ATCC 49188]
          Length = 414

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/99 (18%), Positives = 33/99 (33%), Gaps = 7/99 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A   GVPQ R+RL  +           FP PL  +  + D L    +  +       +
Sbjct: 243 LDAQWLGVPQARQRLIFMGVREDLGLNPVFPKPLSYRYSISDALPWLTNGIAVTVEAEAD 302

Query: 60  GHQKRKENNKIAGKGFG-----YGLFFEN-SATTNTLSA 92
             +             G     + L   + +  + T++A
Sbjct: 303 IGRFAIGEEWDKLNPGGQSDRYFQLVRPDPNEPSPTITA 341


>gi|317180612|dbj|BAJ58398.1| Type II modification enzyme [Helicobacter pylori F32]
          Length = 327

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 32/101 (31%), Gaps = 11/101 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG--IKPRLGDILEEHIDD------KST 52
            A D+GV Q R R++ I F     V + FP       K  L D++ +  D       K+ 
Sbjct: 145 NAKDYGVAQERLRVFYIGFRKDLKVNYIFPKGSTHLKKLTLKDVIWDLKDSVVCALAKNK 204

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +      H+    +                     T+ A 
Sbjct: 205 RNPNAINNHEYFIGSYSPIFMS--RNRVKNWDEQAFTIQAS 243


>gi|225076231|ref|ZP_03719430.1| hypothetical protein NEIFLAOT_01268 [Neisseria flavescens
           NRL30031/H210]
 gi|224952355|gb|EEG33564.1| hypothetical protein NEIFLAOT_01268 [Neisseria flavescens
           NRL30031/H210]
          Length = 374

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37
              +FGVPQ RER+ I+     +  +F  P P   + 
Sbjct: 160 NFAEFGVPQFRERVLIVGVRLDTGFDFHHPEPTHNET 196


>gi|315586485|gb|ADU40866.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 35A]
 gi|317178791|dbj|BAJ56579.1| Type II modification enzyme [Helicobacter pylori F30]
          Length = 327

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 32/101 (31%), Gaps = 11/101 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG--IKPRLGDILEEHIDD------KST 52
            A D+GV Q R R++ I F     + + FP       K  L D++ +  D       K+ 
Sbjct: 145 NAKDYGVAQERLRVFYIGFRKDLKINYIFPKGSTHLKKLTLKDVIWDLKDSVVCALAKNK 204

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +      H+    +                     T+ A 
Sbjct: 205 RNPNAINNHEYFIGSYSPIFMS--RNRVKNWDEQAFTIQAS 243


>gi|217034513|ref|ZP_03439924.1| hypothetical protein HP9810_873g29 [Helicobacter pylori 98-10]
 gi|216943054|gb|EEC22533.1| hypothetical protein HP9810_873g29 [Helicobacter pylori 98-10]
          Length = 327

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 32/101 (31%), Gaps = 11/101 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG--IKPRLGDILEEHIDD------KST 52
            A D+GV Q R R++ I F     + + FP       K  L D++ +  D       K+ 
Sbjct: 145 NAKDYGVAQERLRVFYIGFRKDLKINYIFPKGSTHLKKLTLKDVIWDLKDSVVCALAKNK 204

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +      H+    +                     T+ A 
Sbjct: 205 RNPNAINNHEYFIGSYSPIFMS--RNRVKNWDEQAFTIQAS 243


>gi|308063355|gb|ADO05242.1| site-specific DNA methyltransferase [Helicobacter pylori Sat464]
          Length = 327

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 32/101 (31%), Gaps = 11/101 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG--IKPRLGDILEEHIDD------KST 52
            A D+GV Q R R++ I F     + + FP       K  L D++ +  D       K+ 
Sbjct: 145 NAKDYGVAQERLRVFYIGFRKDLKINYIFPKGSTHLKKLTLKDVIWDLKDSVVCALAKNK 204

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +      H+    +                     T+ A 
Sbjct: 205 RNPNAINNHEYFIGSYSPIFMS--RNRVKNWDEQAFTIQAS 243


>gi|30089875|ref|NP_839905.1| putative methylase [Lactococcus phage P335 sensu lato]
 gi|21954664|gb|AAM83053.1|AF489521_14 putative methylase [Lactococcus phage 4268]
          Length = 185

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP 23
           + + +FGVPQ RER++II  L  
Sbjct: 149 LNSKNFGVPQNRERVFIIGHLRG 171


>gi|20530828|gb|AAM27270.1|AF507962_1 methyl transferase [Lactococcus lactis]
          Length = 185

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP 23
           + + +FGVPQ RER++II  L  
Sbjct: 149 LNSKNFGVPQNRERVFIIGHLRG 171


>gi|62390655|ref|YP_226057.1| modification methylase [Corynebacterium glutamicum ATCC 13032]
 gi|21324545|dbj|BAB99169.1| Site-specific DNA methylase or type II 5-cytosine methyltransferase
           [Corynebacterium glutamicum ATCC 13032]
 gi|41325993|emb|CAF20156.1| MODIFICATION METHYLASE [Corynebacterium glutamicum ATCC 13032]
          Length = 363

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 26/92 (28%), Gaps = 10/92 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG------IKPRLGDILEEHIDDKSTIS 54
              ++GVPQ RER+ I+     +  +FK P P             G+ L+     K   +
Sbjct: 152 NFAEYGVPQFRERVLIVGIRRDTGFDFKHPAPTHGPRGDMPYKTAGEALKGV---KDVPT 208

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSAT 86
           N        R                      
Sbjct: 209 NNNHMKIMPRTVEVLKRIPEGENFTAIPKDDP 240


>gi|19552978|ref|NP_600980.1| site-specific DNA methylase or [Corynebacterium glutamicum ATCC
           13032]
          Length = 356

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 26/92 (28%), Gaps = 10/92 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG------IKPRLGDILEEHIDDKSTIS 54
              ++GVPQ RER+ I+     +  +FK P P             G+ L+     K   +
Sbjct: 145 NFAEYGVPQFRERVLIVGIRRDTGFDFKHPAPTHGPRGDMPYKTAGEALKGV---KDVPT 201

Query: 55  NKLWEGHQKRKENNKIAGKGFGYGLFFENSAT 86
           N        R                      
Sbjct: 202 NNNHMKIMPRTVEVLKRIPEGENFTAIPKDDP 233


>gi|188527304|ref|YP_001909991.1| site-specific DNA methyltransferase [Helicobacter pylori Shi470]
 gi|188143544|gb|ACD47961.1| site-specific DNA methyltransferase [Helicobacter pylori Shi470]
          Length = 327

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 32/101 (31%), Gaps = 11/101 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG--IKPRLGDILEEHIDD------KST 52
            A D+GV Q R R++ I F     + + FP       K  L D++ +  D       K+ 
Sbjct: 145 NAKDYGVAQERLRVFYIGFRKDLKINYIFPKGSTHLKKLTLKDVIWDLKDSVVCALAKNK 204

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +      H+    +                     T+ A 
Sbjct: 205 RNPNAINNHEYFIGSYSPIFMS--RNRVKNWDEQAFTIQAS 243


>gi|282901524|ref|ZP_06309446.1| C-5 cytosine-specific DNA methylase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193567|gb|EFA68542.1| C-5 cytosine-specific DNA methylase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 436

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 16/30 (53%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFP 30
           + A DFGV Q R RL ++ +     +  +P
Sbjct: 164 LNAADFGVAQNRSRLILLGWRKDMPKPVYP 193


>gi|270293678|ref|ZP_06199880.1| cytosine-specific methyltransferase [Bacteroides sp. D20]
 gi|270275145|gb|EFA21005.1| cytosine-specific methyltransferase [Bacteroides sp. D20]
          Length = 361

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI 47
           + A ++GVPQRR R++++   N  ++F+FP P   K  + + + +  
Sbjct: 152 LWADEYGVPQRRMRMFMVG-NNQGIDFEFPKPFDYKVSVEEAIGDLP 197


>gi|315162212|gb|EFU06229.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX0645]
          Length = 398

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 2/55 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + + D+ VPQ RER++II           FP          + +    + K T  
Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGERTRKVFPFERKNGTTAKNNIRPINNSKKTRE 200


>gi|197105892|ref|YP_002131269.1| DNA (cytosine-5-)-methyltransferase protein [Phenylobacterium
           zucineum HLK1]
 gi|196479312|gb|ACG78840.1| DNA (cytosine-5-)-methyltransferase protein [Phenylobacterium
           zucineum HLK1]
          Length = 508

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG 34
           + A  +GVPQ RER+ +I       VE +FP P  
Sbjct: 198 LNAAFYGVPQMRERMILIATRRELGVEIRFPAPTH 232


>gi|22538008|ref|NP_688859.1| prophage LambdaSa2, type II DNA modification methyltransferase
           [Streptococcus agalactiae 2603V/R]
 gi|22534910|gb|AAN00732.1|AE014276_13 prophage LambdaSa2, type II DNA modification methyltransferase,
           putative [Streptococcus agalactiae 2603V/R]
          Length = 437

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/108 (16%), Positives = 32/108 (29%), Gaps = 19/108 (17%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVE---FKFPTPLGIKPRLGDILEEHIDD-------KS 51
            + +FGVPQ RER++II  L        F F + +     +      +++        + 
Sbjct: 148 NSKNFGVPQNRERVFIIGHLRGEGTRPIFPFESSITENYPIHTRKIGNVNPSGNGMNGEV 207

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGL---------FFENSATTNTL 90
             S  L       K             L          ++      T+
Sbjct: 208 YDSEGLSPTLTTNKGEGVKIAVNVVGRLPGKFEMPNRVYDPDGLAPTI 255


>gi|257081612|ref|ZP_05575973.1| C-5 cytosine-specific DNA methylase [Enterococcus faecalis E1Sol]
 gi|256989642|gb|EEU76944.1| C-5 cytosine-specific DNA methylase [Enterococcus faecalis E1Sol]
          Length = 398

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 22/55 (40%), Gaps = 2/55 (3%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + + D+ VPQ RER++II           FP          + ++   + K T  
Sbjct: 147 LNSKDY-VPQNRERVFIIGHLRGERTRKVFPLERKNGTTAKNNIKPINNSKKTRE 200


>gi|313676237|ref|YP_004054233.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
 gi|312942935|gb|ADR22125.1| DNA-cytosine methyltransferase [Marivirga tractuosa DSM 4126]
          Length = 448

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 42/119 (35%), Gaps = 27/119 (22%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---------------PSVEFK-FPTPLGIKPRLGDILE 44
           + + D+GVPQ RER++ I                       F  +P+P     +    L+
Sbjct: 239 LHSADYGVPQSRERVFFIGIKKSALKKEALEALSNDYIPSAFDPYPSPTHSFTKDEPYLK 298

Query: 45  EHID--------DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
           + +         ++   S+ L + H  + +     GK        + +    T+ A ++
Sbjct: 299 KPVSLNDILNGLEEPEQSDDLSQRHYSKAKF---MGKHCQGQTEVKLNHIGPTIRAEHH 354


>gi|15901190|ref|NP_345794.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           pneumoniae TIGR4]
 gi|14972819|gb|AAK75434.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           pneumoniae TIGR4]
          Length = 407

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL 43
           + + DFGVP+ RER++II           FP     +    + L
Sbjct: 149 LNSKDFGVPKNRERVFIIGHSRKKGTRLLFPFRREGQATNSETL 192


>gi|109946897|ref|YP_664125.1| site-specific DNA-methyltransferase [Helicobacter acinonychis str.
           Sheeba]
 gi|109714118|emb|CAJ99126.1| site-specific DNA-methyltransferase [Helicobacter acinonychis str.
           Sheeba]
          Length = 418

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 5/56 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + +  +G   +RERL I+   N     F FP P  +     D +   +D K   ++
Sbjct: 214 LNSAWYGSATKRERLIIVAIRNDLPFNFAFPKPTHLN----DEINTKLDFKDLPTS 265


>gi|310817513|ref|YP_003949871.1| cytosine-specific methyltransferase [Stigmatella aurantiaca
           DW4/3-1]
 gi|309390585|gb|ADO68044.1| Cytosine-specific methyltransferase [Stigmatella aurantiaca
           DW4/3-1]
          Length = 332

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ R R  ++      +  F +P      P +G+ +
Sbjct: 153 LNASDYGVPQLRPRFILVALRPVAATHFIWPKAQREIPTVGNTI 196


>gi|115373224|ref|ZP_01460525.1| modification methylase NaeI [Stigmatella aurantiaca DW4/3-1]
 gi|115369825|gb|EAU68759.1| modification methylase NaeI [Stigmatella aurantiaca DW4/3-1]
          Length = 303

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ R R  ++      +  F +P      P +G+ +
Sbjct: 124 LNASDYGVPQLRPRFILVALRPVAATHFIWPKAQREIPTVGNTI 167


>gi|15828514|ref|NP_325874.1| CpG DNA methylase (cytosine-specific methyltransferase) [Mycoplasma
           pulmonis UAB CTIP]
 gi|14089456|emb|CAC13216.1| CPG DNA METHYLASE (CYTOSINE-SPECIFIC METHYLTRANSFERASE) [Mycoplasma
           pulmonis]
          Length = 296

 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/104 (16%), Positives = 31/104 (29%), Gaps = 12/104 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD----------- 49
           + + D+   Q R+R +++       +FK+P     K  L  +L                 
Sbjct: 116 LNSADYNSCQNRQRFFMVSSF-DLSKFKWPEKRSRKKDLSTLLNNKYTKTQDYEKFEFLL 174

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
           K   S      +   K + K           +       TL+A 
Sbjct: 175 KHQRSEFSITKNNIWKSHIKNYTNFNSEAFLYLPKEVGPTLTAS 218


>gi|296329951|ref|ZP_06872435.1| DNA (cytosine-5-)-methyltransferase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305676676|ref|YP_003868348.1| DNA (cytosine-5-)-methyltransferase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296152990|gb|EFG93855.1| DNA (cytosine-5-)-methyltransferase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305414920|gb|ADM40039.1| DNA (cytosine-5-)-methyltransferase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 488

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 27/65 (41%), Gaps = 7/65 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-----IKPRLGDILEEHID-DKSTIS 54
           + A DFGVPQ R R++II         +   P           +G+I    +   K +IS
Sbjct: 183 LNAADFGVPQHRRRIFIIANRLGIDSPRL-KPTHGPEGFPYKTVGEIQHLPVRLPKISIS 241

Query: 55  NKLWE 59
            KL  
Sbjct: 242 EKLKN 246


>gi|159899163|ref|YP_001545410.1| C-5 cytosine-specific DNA methylase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159892202|gb|ABX05282.1| C-5 cytosine-specific DNA methylase [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 362

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 10/33 (30%), Positives = 14/33 (42%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
            A D+G PQ R+R+ I+           P P  
Sbjct: 297 NAADYGTPQLRKRIIILGCKQDLGFVNLPLPTH 329


>gi|147668731|ref|YP_001213549.1| DNA-cytosine methyltransferase [Dehalococcoides sp. BAV1]
 gi|146269679|gb|ABQ16671.1| DNA-cytosine methyltransferase [Dehalococcoides sp. BAV1]
          Length = 335

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFL-NPSVEFKFPTPLGIKPRLGDILEEHID 48
           + A D+ VPQ R+R+ I+ +     + F  P P+  KP L D + +  +
Sbjct: 143 LNAHDYSVPQDRKRVIIVGYHVKTELYFTPPKPIAHKPLLRDAIWDLRE 191


>gi|317011768|gb|ADU85515.1| site-specific DNA-methyltransferase [Helicobacter pylori
          SouthAfrica7]
          Length = 236

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 5/56 (8%)

Query: 1  MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
          + +  +G   +RERL I+   N     F FP P  +     D +   +D K   ++
Sbjct: 32 LNSAWYGSATKRERLIIVAIRNDLPFNFIFPKPTHL----SDEINTKLDFKDLPTS 83


>gi|210617281|ref|ZP_03291507.1| hypothetical protein CLONEX_03729 [Clostridium nexile DSM 1787]
 gi|210149385|gb|EEA80394.1| hypothetical protein CLONEX_03729 [Clostridium nexile DSM 1787]
          Length = 455

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/85 (20%), Positives = 30/85 (35%), Gaps = 1/85 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DFGVPQ R+R+YI+ +L+        P P      L  I       +      L  
Sbjct: 176 LNSKDFGVPQARKRVYIVGYLDFRCAGKILPEPETNGAALVQIRAGSQGKRVYSPKGLSC 235

Query: 60  GHQKRKENNKIAGKGFGYGLFFENS 84
               +          +  G+  + +
Sbjct: 236 TLTSQAGGMGGKTGLYDVGVPIKEN 260


>gi|255279956|ref|ZP_05344511.1| modification methylase AgeI [Bryantella formatexigens DSM 14469]
 gi|255269729|gb|EET62934.1| modification methylase AgeI [Bryantella formatexigens DSM 14469]
          Length = 475

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 15/35 (42%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           + A DFGVPQ RERL  I         K    +  
Sbjct: 247 LNAKDFGVPQNRERLIYIGNRKGIDNKKIFKEINK 281


>gi|168485680|ref|ZP_02710188.1| modification methylase HaeIII (Cytosine-specificmethyltransferase
           HaeIII) (M.HaeIII) [Streptococcus pneumoniae CDC1087-00]
 gi|183571278|gb|EDT91806.1| modification methylase HaeIII (Cytosine-specificmethyltransferase
           HaeIII) (M.HaeIII) [Streptococcus pneumoniae CDC1087-00]
          Length = 363

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/48 (22%), Positives = 19/48 (39%), Gaps = 5/48 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDIL 43
           +   D+GVPQ R+RL +       ++        P+         D+L
Sbjct: 152 LNTADYGVPQSRKRLVLHGIRKEILDNTNLTLNLPSKTHSNIPELDLL 199


>gi|111656823|ref|ZP_01407675.1| hypothetical protein SpneT_02001911 [Streptococcus pneumoniae
           TIGR4]
 gi|148994722|ref|ZP_01823806.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           pneumoniae SP9-BS68]
 gi|148999034|ref|ZP_01826467.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           pneumoniae SP11-BS70]
 gi|307067986|ref|YP_003876952.1| site-specific DNA methylase [Streptococcus pneumoniae AP200]
 gi|147755157|gb|EDK62211.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           pneumoniae SP11-BS70]
 gi|147927053|gb|EDK78094.1| type II DNA modification methyltransferase Spn5252IP [Streptococcus
           pneumoniae SP9-BS68]
 gi|306409523|gb|ADM84950.1| Site-specific DNA methylase [Streptococcus pneumoniae AP200]
 gi|332074668|gb|EGI85142.1| modification methylase HpaII [Streptococcus pneumoniae GA17545]
 gi|332200781|gb|EGJ14853.1| modification methylase HpaII [Streptococcus pneumoniae GA41317]
 gi|332201799|gb|EGJ15869.1| modification methylase HpaII [Streptococcus pneumoniae GA47368]
          Length = 392

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 1/44 (2%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDIL 43
           + + DFGVP+ RER++II           FP     +    + L
Sbjct: 134 LNSKDFGVPKNRERVFIIGHSRKKGTRLLFPFRREGQATNSETL 177


>gi|304388871|ref|ZP_07370921.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|302028149|gb|ADK90963.1| unknown [Neisseria meningitidis]
 gi|304337164|gb|EFM03348.1| DNA (cytosine-5-)-methyltransferase [Neisseria meningitidis ATCC
           13091]
 gi|316985914|gb|EFV64853.1| modification methylase HphIA [Neisseria meningitidis H44/76]
 gi|325143322|gb|EGC65656.1| cytosine-specificmethyltransferase HphIA [Neisseria meningitidis
           961-5945]
          Length = 276

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-IKPRLGDILEEHID 48
           + A DFGVPQ R R+  I       +  FP PL      +G  +     
Sbjct: 155 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGSAIGHFPK 202


>gi|148252729|ref|YP_001237314.1| putative 5-methylcytosine methyltransferase [Bradyrhizobium sp.
           BTAi1]
 gi|146404902|gb|ABQ33408.1| putative 5-methylcytosine methyltransferase [Bradyrhizobium sp.
           BTAi1]
          Length = 381

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 3/50 (6%)

Query: 1   MKACDFGVPQRRERLYIIDF---LNPSVEFKFPTPLGIKPRLGDILEEHI 47
           + A DFGVPQ R R++I+ F       +    P    + P     L   +
Sbjct: 179 INARDFGVPQNRRRVFILGFDRRRVDEMNTWPPKATHVSPDALGELPHWV 228


>gi|225375779|ref|ZP_03753000.1| hypothetical protein ROSEINA2194_01411 [Roseburia inulinivorans DSM
           16841]
 gi|225212376|gb|EEG94730.1| hypothetical protein ROSEINA2194_01411 [Roseburia inulinivorans DSM
           16841]
          Length = 431

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 31/89 (34%), Gaps = 9/89 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-----FPTPLGIKPRLGDILEEHIDDKSTISN 55
           + + DFGVPQ R+R+YI+ +     +F+      P P      L  +       +     
Sbjct: 150 LNSKDFGVPQARKRVYIVGY----FDFRCAGKVLPEPETNGAALVQVRAGSQGKRVYSPK 205

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENS 84
            L      +          +  G+  + +
Sbjct: 206 GLSCTLTSQAGGMGGKTGLYDVGVPIKEN 234


>gi|153854028|ref|ZP_01995361.1| hypothetical protein DORLON_01352 [Dorea longicatena DSM 13814]
 gi|149753410|gb|EDM63341.1| hypothetical protein DORLON_01352 [Dorea longicatena DSM 13814]
          Length = 468

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 31/89 (34%), Gaps = 9/89 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-----FPTPLGIKPRLGDILEEHIDDKSTISN 55
           + + DFGVPQ R+R+YI+ +     +F+      P P      L  +       +     
Sbjct: 187 LNSKDFGVPQARKRVYIVGY----FDFRCAGKVLPEPETNGAALVQVRAGSQGKRVYSPK 242

Query: 56  KLWEGHQKRKENNKIAGKGFGYGLFFENS 84
            L      +          +  G+  + +
Sbjct: 243 GLSCTLTSQAGGMGGKTGLYDVGVPIKEN 271


>gi|158339669|ref|YP_001520676.1| C-5 cytosine-specific DNA methylase [Acaryochloris marina
           MBIC11017]
 gi|158309910|gb|ABW31526.1| C-5 cytosine-specific DNA methylase [Acaryochloris marina
           MBIC11017]
          Length = 382

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 36/96 (37%), Gaps = 9/96 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPT-PLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A DFGVPQRR R++II        +  FP     I   +G+ + + ++ + T      
Sbjct: 154 LDASDFGVPQRRLRIFIIGSRLDLGWKPIFPKSKTKIPLTVGEAISDLLELQPTAMP--- 210

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARY 94
              + +    K       Y      S     +  RY
Sbjct: 211 --LKLKSSGPKQKDCELPYRSA-PESGYQR-IMRRY 242


>gi|261415336|ref|YP_003249019.1| DNA-cytosine methyltransferase [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261371792|gb|ACX74537.1| DNA-cytosine methyltransferase [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302326638|gb|ADL25839.1| cytosine specific DNA methyltransferase [Fibrobacter succinogenes
           subsp. succinogenes S85]
          Length = 418

 Score = 49.6 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 40/97 (41%), Gaps = 16/97 (16%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
            A ++G PQ+RER+ II   + S    + TP   +  L ++ +     +    N L E  
Sbjct: 191 NAANYGAPQKRERIVIICSRDGSKA-PYLTPTHSETGLFNLPKWRTVSEVL--NDLDENV 247

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTNTLSAR-YYKD 97
           Q+  + ++   K F              L A  Y+KD
Sbjct: 248 QEYSKFSEKRLKFFRM------------LKAGQYWKD 272


>gi|51245886|ref|YP_065770.1| modification methylase [Desulfotalea psychrophila LSv54]
 gi|50876923|emb|CAG36763.1| probable modification methylase [Desulfotalea psychrophila LSv54]
          Length = 360

 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 23/56 (41%), Gaps = 3/56 (5%)

Query: 5   DFGVPQRRERLYIIDFLNP-SVEFKFPTPL--GIKPRLGDILEEHIDDKSTISNKL 57
           ++GVPQ R R+ I+      + EFK P P         G+ L      +   + + 
Sbjct: 167 EYGVPQARHRIIIVGIRKDLNTEFKVPAPTTPNQYKSSGEALTCPPIPEDAPNQER 222


>gi|269797252|ref|YP_003311152.1| DNA-cytosine methyltransferase [Veillonella parvula DSM 2008]
 gi|269093881|gb|ACZ23872.1| DNA-cytosine methyltransferase [Veillonella parvula DSM 2008]
          Length = 423

 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/102 (19%), Positives = 29/102 (28%), Gaps = 11/102 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--------SVEFKFPTPLGIKPRLGDILEEH---IDD 49
           + A DFGV Q RER+ I+                + +  P      L   L         
Sbjct: 196 INANDFGVSQNRERVIIVGHRKDLLFNKSFFDYLYNYVEPSPKLKELFADLPNIRAGKSS 255

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
           K    N + +  QK   +N             +N      L 
Sbjct: 256 KKYCCNYVSKYVQKYIRSNDDILTQHIARPHSKNDLRIYKLV 297


>gi|288904476|ref|YP_003429697.1| DNA methylase [Streptococcus gallolyticus UCN34]
 gi|288731201|emb|CBI12749.1| Putative DNA methylase [Streptococcus gallolyticus UCN34]
          Length = 366

 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP 23
           + + DFGVPQ RER+++I  L  
Sbjct: 147 LNSKDFGVPQNRERVFLIGHLRG 169


>gi|229188078|ref|ZP_04315163.1| Cytosine-specific methyltransferase [Bacillus cereus BGSC 6E1]
 gi|228595388|gb|EEK53123.1| Cytosine-specific methyltransferase [Bacillus cereus BGSC 6E1]
          Length = 318

 Score = 49.6 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 28/95 (29%), Gaps = 3/95 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE- 59
           + A  FGVP  RER++ I  L     F F        R      E+  D    S  L   
Sbjct: 140 LDARKFGVPHARERVFCISLLGGKA-FDFNKLRFKPMRDIKEFMEYGPDDEIPSQYLINI 198

Query: 60  -GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                + +       G              T++ R
Sbjct: 199 PSMLNKIKEFNPNPTGSYKRQLDVIDQYCYTITER 233


>gi|228474527|ref|ZP_04059258.1| site-specific DNA methylase [Staphylococcus hominis SK119]
 gi|228271190|gb|EEK12558.1| site-specific DNA methylase [Staphylococcus hominis SK119]
          Length = 414

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 1/51 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + A D+GVPQ RER+ II          FP    + P       ++  D+ 
Sbjct: 149 LNAADYGVPQARERVIIIGNRIGVEN-PFPVISHVAPDDNLSFFDYKSDEE 198


>gi|318042684|ref|ZP_07974640.1| DNA-cytosine methyltransferase [Synechococcus sp. CB0101]
          Length = 361

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 30/79 (37%), Gaps = 4/79 (5%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP---RLGDILEEHIDDKSTISNKLW 58
            + DFG+ Q R R  ++      + F+F +P         + D++ +     S  S    
Sbjct: 152 NSADFGLAQTRHRFMLVGIRRD-IGFRFLSPPPTVQKWATVRDVIGDMPPPPSDCSEHPD 210

Query: 59  EGHQKRKENNKIAGKGFGY 77
             +  + +  K   + F Y
Sbjct: 211 FFNHAQTKITKRNIERFSY 229


>gi|240117500|ref|ZP_04731562.1| site-specific DNA-methyltransferase M.NgoVII [Neisseria gonorrhoeae
           PID1]
 gi|268603200|ref|ZP_06137367.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID1]
 gi|268587331|gb|EEZ52007.1| modification methylase NgoFVII [Neisseria gonorrhoeae PID1]
          Length = 374

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37
              +FGVPQ RER+ I+     +  +F+ P P   + 
Sbjct: 160 NFTEFGVPQFRERVLIVGVRLDTGFDFRHPEPTHNET 196


>gi|218905512|ref|YP_002453346.1| modification methylase ScrFIB [Bacillus cereus AH820]
 gi|218536933|gb|ACK89331.1| modification methylase ScrFIB [Bacillus cereus AH820]
          Length = 324

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 28/95 (29%), Gaps = 3/95 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE- 59
           + A  FGVP  RER++ I  L     F F        R      E+  D    S  L   
Sbjct: 146 LDARKFGVPHARERVFCISLLGGKA-FDFNKLRFKPMRDIKEFMEYGPDDKIPSQYLINI 204

Query: 60  -GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                + +       G              T++ R
Sbjct: 205 PSMLNKIKEFNPNPTGSYKRQLDVIDQYCYTITER 239


>gi|111220172|ref|YP_710966.1| putative DNA modification methylase [Frankia alni ACN14a]
 gi|111147704|emb|CAJ59362.1| putative DNA Modification methylase (Cytosine-specific
           methyltransferase) [Frankia alni ACN14a]
          Length = 401

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 26/59 (44%), Gaps = 2/59 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A ++GVPQRR+R  +I         + P P   +P+        +    T+ + + +
Sbjct: 191 LNAANYGVPQRRQRTIVIGSRIGEP--ELPAPTHQEPQEQAAFFSDLPPWRTVRDAISD 247


>gi|317179735|dbj|BAJ57523.1| Type II DNA modification enzyme [Helicobacter pylori F30]
          Length = 418

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 5/56 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + +  +G   +RERL I+   N     F FP P  +     D +   +D K   ++
Sbjct: 214 LNSAWYGSATKRERLIIVAIKNDLPFNFTFPKPTHL----SDEINTKLDFKDLPTS 265


>gi|309790027|ref|ZP_07684601.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6]
 gi|308227882|gb|EFO81536.1| C-5 cytosine-specific DNA methylase [Oscillochloris trichoides DG6]
          Length = 438

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 26/74 (35%), Gaps = 3/74 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+GVPQRR+RL+I          ++P          + D + +  +       ++ 
Sbjct: 211 LNAVDYGVPQRRQRLFIQGNRLGQ-NIRWPKIETTNRFVTVRDAISDLPNRTPPSLEEIL 269

Query: 59  EGHQKRKENNKIAG 72
               +         
Sbjct: 270 PYQPQHSLTEYQKK 283


>gi|153940750|ref|YP_001392502.1| hypothetical protein CLI_3290 [Clostridium botulinum F str.
           Langeland]
 gi|152936646|gb|ABS42144.1| conserved domain protein [Clostridium botulinum F str. Langeland]
          Length = 338

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP 23
           + + DFGVPQ RER++II  L  
Sbjct: 151 INSRDFGVPQNRERVFIIGHLRE 173


>gi|113478170|ref|YP_724231.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101]
 gi|110169218|gb|ABG53758.1| DNA-cytosine methyltransferase [Trichodesmium erythraeum IMS101]
          Length = 379

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 31/89 (34%), Gaps = 4/89 (4%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTP---LGIKPRLGDILEEHIDDKSTISNKL 57
              D+GVPQ RER+ ++     +   F  P+P   +G K       +   + +   +N  
Sbjct: 159 NFADYGVPQFRERVILVGIRMDTGFNFIHPSPEYGIGRKYTYITAGKALKNVEKVPNNNE 218

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSAT 86
            +  Q R        K  G        + 
Sbjct: 219 HQKIQPRTIEILKRIKAGGNFTDIPKDSP 247


>gi|254671508|emb|CBA09095.1| site-specific DNA-methyltransferase [Neisseria meningitidis
           alpha153]
          Length = 258

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 20/49 (40%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-IKPRLGDILEEHID 48
           + A DFGVPQ R R+  I       +  FP PL      +G  +     
Sbjct: 137 LSAADFGVPQIRSRVIFIG-RRDKGKISFPEPLQISHQTVGSAIGHFPK 184


>gi|110799652|ref|YP_695464.1| DNA-cytosine methyltransferase [Clostridium perfringens ATCC 13124]
 gi|110674299|gb|ABG83286.1| DNA-cytosine methyltransferase [Clostridium perfringens ATCC 13124]
          Length = 446

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 2/43 (4%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDIL 43
           A D+GVPQ RER+++I       E  + +P     + R  + +
Sbjct: 187 AADYGVPQNRERVFLIGINKMYGENPYIYPEKTHGEGRKFEYI 229


>gi|60202519|gb|AAX14651.1| BbvCI methyltransferase 2 [Brevibacillus brevis]
          Length = 396

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGI 35
           ++A D+GVPQ R RL+++   +P     FP     
Sbjct: 154 LQAADYGVPQLRSRLFVVGSRHPIAN-PFPNKTHS 187


>gi|127486|sp|P23737|MTS9_STAAU RecName: Full=Modification methylase Sau96I; Short=M.Sau96I;
           AltName: Full=Cytosine-specific methyltransferase Sau96I
 gi|581567|emb|CAA37260.1| Sau96I DNA methyltransferase [Staphylococcus aureus]
 gi|329730456|gb|EGG66846.1| DNA-binding helix-turn-helix protein [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 430

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKFPTPLGIKPRLGDILEEHIDDKST 52
           + + ++ V Q+RER+ II      V+     F+FP     KP L D+L++    K T
Sbjct: 245 LNSWNYDVAQKRERIVIIGIREDLVKEQKYPFRFPLAQVYKPVLKDVLKDVPKSKVT 301


>gi|144900416|emb|CAM77280.1| modification methylase MthTI [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 356

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV 25
           + AC +GVPQ RER +II +     
Sbjct: 161 LNACHYGVPQSRERAFIIGYRRDLG 185


>gi|323454079|gb|EGB09949.1| hypothetical protein AURANDRAFT_62427 [Aureococcus anophagefferens]
          Length = 634

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 34/91 (37%), Gaps = 8/91 (8%)

Query: 8   VPQRRERLYIIDFLNPSV---EFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLWEGHQK 63
           +PQ RER+YI+           F++P      PR + D+LE+  D +     +       
Sbjct: 353 LPQARERVYIVAIRADLAAARRFRWPALERRGPRSIRDVLEDPPDAERHRVPRAL----Y 408

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARY 94
           R   +           F +     NT+ A Y
Sbjct: 409 RSVVDSAYHAARPRARFPDVDGPANTVRATY 439


>gi|332359910|gb|EGJ37724.1| C-5 cytosine-specific DNA methylase superfamily protein
           [Streptococcus sanguinis SK1056]
          Length = 516

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 19/38 (50%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38
           + A +FGVPQ+R R+  + + N     ++P      P 
Sbjct: 182 LNAANFGVPQQRNRVVFLAYRNDVAPLQYPESDNDIPN 219


>gi|283956744|ref|ZP_06374220.1| hypothetical protein C1336_000290019 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283791719|gb|EFC30512.1| hypothetical protein C1336_000290019 [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 330

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/57 (17%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           +   D+ + Q R R++I+  +  +  F FP     +  +  ++++    K+   +K+
Sbjct: 155 LNTKDYSIAQNRSRIFIVGTIKKN-SFIFPKKENSQISIKKVIDDLPKLKNGEKSKI 210


>gi|154502686|ref|ZP_02039746.1| hypothetical protein RUMGNA_00499 [Ruminococcus gnavus ATCC 29149]
 gi|153796569|gb|EDN78989.1| hypothetical protein RUMGNA_00499 [Ruminococcus gnavus ATCC 29149]
          Length = 458

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 26/62 (41%), Gaps = 1/62 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DFGVPQ R+R+Y++ +L+        P P      L  +      ++   +  L  
Sbjct: 179 LNSKDFGVPQSRKRVYLVGYLDRRCAGKILPFPTANGTPLVQVQTGRQGERIYKAEGLSC 238

Query: 60  GH 61
             
Sbjct: 239 TL 240


>gi|257069715|ref|YP_003155970.1| DNA-methyltransferase Dcm [Brachybacterium faecium DSM 4810]
 gi|256560533|gb|ACU86380.1| DNA-methyltransferase Dcm [Brachybacterium faecium DSM 4810]
          Length = 431

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 9/40 (22%), Positives = 19/40 (47%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLG 40
           ++A DFG PQ R+R+ ++         ++P+       + 
Sbjct: 160 LQAADFGTPQSRKRVIVMGSRKDVTLPEYPSVTHAPRTIK 199


>gi|317127846|ref|YP_004094128.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522]
 gi|315472794|gb|ADU29397.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522]
          Length = 564

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 4/37 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEF----KFPTPL 33
           + A ++GVPQ+R RL+II      V+       P P+
Sbjct: 325 LNAANYGVPQQRRRLFIIGVREDLVKKGRRVTLPEPI 361


>gi|260221505|emb|CBA30136.1| hypothetical protein Csp_C22040 [Curvibacter putative symbiont of
          Hydra magnipapillata]
          Length = 191

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
          M A +FG PQ R RL++I  L        P P   +    DIL    DD+   + 
Sbjct: 1  MNAAEFGAPQSRVRLFLIGGLGLPPPEIRPEPSVKRMTARDIL--DPDDRWKFTP 53


>gi|170077471|ref|YP_001734109.1| site-specific DNA-methyltransferase [Synechococcus sp. PCC 7002]
 gi|169885140|gb|ACA98853.1| site-specific DNA-methyltransferase [Synechococcus sp. PCC 7002]
          Length = 413

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/34 (29%), Positives = 17/34 (50%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           +   D+G PQRR+RL ++ +        +P P  
Sbjct: 158 LNGADYGAPQRRKRLILLGYRRDVPSVAYPAPSH 191


>gi|40850587|gb|AAR96017.1| M2.BsaI [Geobacillus stearothermophilus]
          Length = 381

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL---GIKPRLGDILEEHIDDKSTISN 55
           + + D+GVPQRR R+ II     +   + P P+     +  L D L   I  K  +S+
Sbjct: 278 LNSVDYGVPQRRNRVVIIGDSTGTKNSEPPIPITSLKGEKTLFDALSSAISVKEALSD 335


>gi|89513784|gb|ABD74727.1| site-specific DNA-methyltransferase [Ensifer adhaerens]
          Length = 137

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLG 34
           + A  FGVPQ RERL+I+   +   +  +FP P  
Sbjct: 71  LNAAYFGVPQVRERLFIVALADALDQVPEFPDPTH 105


>gi|119509253|ref|ZP_01628403.1| DNA-cytosine methyltransferase family protein [Nodularia spumigena
           CCY9414]
 gi|119466095|gb|EAW46982.1| DNA-cytosine methyltransferase family protein [Nodularia spumigena
           CCY9414]
          Length = 418

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 31/100 (31%), Gaps = 3/100 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHID--DKSTISNKLW 58
           M A  + +PQ R RL++      + +F FP             E  ++  +         
Sbjct: 238 MNAASYSIPQNRNRLFVFGHRTAN-QFVFPEANLNIVPCYKAFEHPVNNLENHITRQHKA 296

Query: 59  EGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
           E   +  E N       G          + T+ +   K G
Sbjct: 297 ESIIRYMELNYGRRDKLGRVDRLNPDLPSKTVISGGTKGG 336


>gi|283549178|ref|NP_001164522.1| DNA methyltransferase 1a [Apis mellifera]
          Length = 1366

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 29/58 (50%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
            ++A ++G+PQ R R+ I+      +  K+P P  +  +    L   +D+K   SN  W
Sbjct: 1055 LQAGNYGIPQTRRRMIILAAAPGQMLPKYPEPSHVFSKRACQLSVLVDNKKYSSNCNW 1112


>gi|254409526|ref|ZP_05023307.1| DNA-cytosine methyltransferase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196183523|gb|EDX78506.1| DNA-cytosine methyltransferase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 437

 Score = 49.2 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 19/78 (24%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF------PT-------------PLGIKPRLGD 41
           + +  FG+PQ R RLY++  L  S +F+       P              PL     + D
Sbjct: 148 LNSAHFGLPQNRVRLYMVGILGASPKFELISDLGPPDSHSYNCQQLSLFNPLTQPVAVAD 207

Query: 42  ILEEHIDDKSTISNKLWE 59
           ILE++ D K   S +  E
Sbjct: 208 ILEDNPDSKYDCSPEFVE 225


>gi|294788934|ref|ZP_06754174.1| modification methylase HphIA [Simonsiella muelleri ATCC 29453]
 gi|294483036|gb|EFG30723.1| modification methylase HphIA [Simonsiella muelleri ATCC 29453]
          Length = 328

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/107 (18%), Positives = 37/107 (34%), Gaps = 11/107 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR--------LGDILEEHIDDKST 52
           + A DFGVPQ+R R+  I     + +  FP  +    +           +L     +   
Sbjct: 153 LNAVDFGVPQQRSRIVFIG-RRDNGKILFPKSVQATCKTVGETIGHFPPLLSGETHEHIA 211

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA--RYYKD 97
               +    Q  ++ + I   G    +       T  +    RY++D
Sbjct: 212 NHEAMAHTPQMLEKMSFIQNGGNRNDIPEHLRPKTGDIRKYIRYHRD 258


>gi|322418052|ref|YP_004197275.1| DNA-cytosine methyltransferase [Geobacter sp. M18]
 gi|320124439|gb|ADW11999.1| DNA-cytosine methyltransferase [Geobacter sp. M18]
          Length = 385

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 21/59 (35%), Gaps = 4/59 (6%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
            A D+G  Q+R R+ I    N   ++   P P   + R   +L +             +
Sbjct: 175 NAADYGAAQKRHRVIIAGIRNDLGIKLNLPAPTHSRER---LLWDQWITGEYWERHRLK 230


>gi|197124335|ref|YP_002136286.1| DNA-cytosine methyltransferase [Anaeromyxobacter sp. K]
 gi|196174184|gb|ACG75157.1| DNA-cytosine methyltransferase [Anaeromyxobacter sp. K]
          Length = 508

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/40 (27%), Positives = 16/40 (40%), Gaps = 1/40 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRL 39
           + A  +GVPQ RER++ I       V    P    +    
Sbjct: 177 LNAAMYGVPQLRERIFFIGIRKDLAVRPSVPPSTHLIGTP 216


>gi|217033005|ref|ZP_03438476.1| hypothetical protein HPB128_151g1 [Helicobacter pylori B128]
 gi|298736554|ref|YP_003729080.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
 gi|216945262|gb|EEC23940.1| hypothetical protein HPB128_151g1 [Helicobacter pylori B128]
 gi|298355744|emb|CBI66616.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori B8]
          Length = 327

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 32/101 (31%), Gaps = 11/101 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG--IKPRLGDILEEHIDD------KST 52
            A D+GV Q R R++ I F     V + FP       K  L D++ +  D       K+ 
Sbjct: 145 NAKDYGVAQERLRVFYIGFRRDLKVNYIFPKGSTHLKKLTLKDVIWDLKDSVVCALAKNK 204

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +      H+    +                     T+ A 
Sbjct: 205 RNPNAINNHEYFIGSYSPIFMS--RNRVKNWDEQAFTIQAS 243


>gi|126659133|ref|ZP_01730272.1| site-specific DNA-methyltransferase M.NgoVII [Cyanothece sp.
           CCY0110]
 gi|126619540|gb|EAZ90270.1| site-specific DNA-methyltransferase M.NgoVII [Cyanothece sp.
           CCY0110]
          Length = 346

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 1/38 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL 39
              D+GVPQ RER+ II      + FK+  P       
Sbjct: 134 NFADYGVPQLRERVLIIGIRKD-INFKYRKPFPTHKPD 170


>gi|33322745|gb|AAQ07107.1|AF496419_1 cytosine-specific DNA methyltransferase [Lactobacillus delbrueckii
           subsp. lactis]
          Length = 138

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE 26
           + A +FGVPQ RERL  I       +
Sbjct: 106 LNARNFGVPQNRERLIYIGIRKDIAD 131


>gi|317182001|dbj|BAJ59785.1| cytosine specific DNA methyltransferase (BSP6IM) [Helicobacter
           pylori F57]
          Length = 434

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30
           + A DFGV Q RERLYI+  L+  ++   FP
Sbjct: 175 LNAKDFGVAQNRERLYIVGNLSCPIDLDHFP 205


>gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 3
           str. ATCC 700970]
 gi|170762087|ref|YP_001752613.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 3
           str. ATCC 27815]
 gi|171920252|ref|ZP_02931618.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 1
           str. ATCC 27813]
 gi|186701746|ref|ZP_02971433.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 6
           str. ATCC 27818]
 gi|11356834|pir||D82880 cytosine-specific methyltransferase UU528 [imported] - Ureaplasma
           urealyticum
 gi|6899531|gb|AAF30941.1|AE002151_7 cytosine-specific methyltransferase [Ureaplasma parvum serovar 3
           str. ATCC 700970]
 gi|168827664|gb|ACA32926.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 3
           str. ATCC 27815]
 gi|171902654|gb|EDT48943.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 1
           str. ATCC 27813]
 gi|186701017|gb|EDU19299.1| cytosine-specific methyltransferase [Ureaplasma parvum serovar 6
           str. ATCC 27818]
          Length = 299

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/102 (23%), Positives = 42/102 (41%), Gaps = 11/102 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV---------EFKFPTPLGIKPRLGDILEEHIDDKS 51
           + A D+G  QRR+R+Y I  LN            + + P   G + +L D+L+ +   + 
Sbjct: 107 LNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYKIEK 166

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                     Q  +  ++I      Y L   N   T+T++ R
Sbjct: 167 YYQEAYLA--QPNRTFSRIKYVIPKYDLLNPNCYCTSTITTR 206


>gi|260806879|ref|XP_002598311.1| hypothetical protein BRAFLDRAFT_204680 [Branchiostoma floridae]
 gi|229283583|gb|EEN54323.1| hypothetical protein BRAFLDRAFT_204680 [Branchiostoma floridae]
          Length = 1275

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 25/65 (38%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            ++A ++GV Q R R  I+          +P P  +       L   +D+K   SN  W  
Sbjct: 959  LQAGNYGVAQTRRRAIILAAAPGEKLPMYPEPQHVFSPRACQLSVMVDEKKYNSNTQWRQ 1018

Query: 61   HQKRK 65
                +
Sbjct: 1019 SAPYR 1023


>gi|186683285|ref|YP_001866481.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102]
 gi|186465737|gb|ACC81538.1| DNA-cytosine methyltransferase [Nostoc punctiforme PCC 73102]
          Length = 419

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/90 (15%), Positives = 28/90 (31%), Gaps = 1/90 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLWE 59
           + A D+GVPQ R+R++ +      +      P       + D+L   +  K        +
Sbjct: 161 LNASDYGVPQARKRVFFVASKFGEIIPPLHQPQHTVRDAIADLLPVLLLPKQNTQVLSPD 220

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
             +                L   ++    T
Sbjct: 221 WVKGEYAKYLEKIFPNLGILTNISTGFAAT 250


>gi|330723584|gb|AEC45954.1| Cytosine-specific methyltransferase [Mycoplasma hyorhinis MCLD]
          Length = 397

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 35/105 (33%), Gaps = 13/105 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD----------- 49
           + + DFG  Q RER++++  LN    FK+P  +     L  ILE +              
Sbjct: 217 LNSTDFGSSQNRERVFMVSKLNNKP-FKWPLKIKHNNDLSRILESNFQPTAQILELTSKI 275

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFG-YGLFFENSATTNTLSAR 93
           K     +         +        F      + N     TL+A 
Sbjct: 276 KEKGITEFKTTTNNISKAFIKNWSNFNSENYIYNNKGFGPTLTAS 320


>gi|303324183|ref|XP_003072079.1| C-5 cytosine methyltransferase DmtA, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240111789|gb|EER29934.1| C-5 cytosine methyltransferase DmtA, putative [Coccidioides
           posadasii C735 delta SOWgp]
          Length = 535

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 31/91 (34%), Gaps = 5/91 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   D+GVPQ+R+RL +I          FP P    P    +    I D      +    
Sbjct: 415 LSCEDYGVPQQRKRLVMIGAGPGEPLPPFPKPTHGPPGSNLLPHRTILDAIGDIPENAPD 474

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
           H   +   +   K       F   +   T++
Sbjct: 475 HDPERAYFRNITKP-----AFPPRSFAKTIT 500


>gi|254224899|ref|ZP_04918514.1| Site-specific DNA methylase [Vibrio cholerae V51]
 gi|125622587|gb|EAZ50906.1| Site-specific DNA methylase [Vibrio cholerae V51]
          Length = 505

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 27/72 (37%), Gaps = 2/72 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + ACD+G P  R+R +++   N +    +P P       G I      D    S  + + 
Sbjct: 196 LSACDYGAPTIRKRFFLVA-RNDNKPINWPEPTHGPKGSGLIPYATAADIIDWSIPV-KS 253

Query: 61  HQKRKENNKIAG 72
              R++      
Sbjct: 254 IFGREKPLAEKT 265


>gi|320037073|gb|EFW19011.1| hypothetical protein CPSG_04557 [Coccidioides posadasii str.
           Silveira]
          Length = 607

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 31/91 (34%), Gaps = 5/91 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   D+GVPQ+R+RL +I          FP P    P    +    I D      +    
Sbjct: 415 LSCEDYGVPQQRKRLVMIGAGPGEPLPPFPKPTHGPPGSNLLPHRTILDAIGDIPENAPD 474

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
           H   +   +   K       F   +   T++
Sbjct: 475 HDPERAYFRNITKP-----AFPPRSFAKTIT 500


>gi|18700048|gb|AAL03949.1| DNA methyltransferase Bse634IM [Geobacillus stearothermophilus]
          Length = 387

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 9/54 (16%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---------FKFPTPLGIKPRLGDILEE 45
           + A +FG+PQ R R++II F N  +E         F++PTP+    +      E
Sbjct: 172 LNALEFGIPQDRARVFIIGFKNSIIETLQENYMDAFQWPTPIYPDAKTSYNWPE 225


>gi|85710855|ref|ZP_01041916.1| DNA modification methylase M.NGOI [Idiomarina baltica OS145]
 gi|85695259|gb|EAQ33196.1| DNA modification methylase M.NGOI [Idiomarina baltica OS145]
          Length = 345

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 1/57 (1%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           +  FGVPQ R R  ++         FK+P P      +G+ L + +  K       W
Sbjct: 163 SSQFGVPQLRPRTILVALRPEVASHFKWPQPQSKIVTVGEALGDLMASKRWPKVNDW 219


>gi|315650253|ref|ZP_07903326.1| modification methylase BbvI [Eubacterium saburreum DSM 3986]
 gi|315487498|gb|EFU77807.1| modification methylase BbvI [Eubacterium saburreum DSM 3986]
          Length = 349

 Score = 48.8 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 5   DFGVPQRRERLYIIDFLNP-SVEFKFPTP---LGIKPRLGDILEEHIDDKSTISNKLWE 59
           D+G+PQ R R+ I+   N  SV+F  P+P     +     + +E     +   +N+  +
Sbjct: 159 DYGIPQTRHRIIIVGIRNDISVKFNVPSPAPFTHLNNTCRNAIENPPIPQDAFNNEFTK 217


>gi|304372838|ref|YP_003856047.1| Cytosine-specific methyltransferase [Mycoplasma hyorhinis HUB-1]
 gi|304309029|gb|ADM21509.1| Cytosine-specific methyltransferase [Mycoplasma hyorhinis HUB-1]
          Length = 397

 Score = 48.8 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 35/105 (33%), Gaps = 13/105 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD----------- 49
           + + DFG  Q RER++++  LN    FK+P  +     L  ILE +              
Sbjct: 217 LNSTDFGSSQNRERVFMVSKLNNKP-FKWPLKIKHNNDLSRILESNFQPTAQILELTSKI 275

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFG-YGLFFENSATTNTLSAR 93
           K     +         +        F      + N     TL+A 
Sbjct: 276 KEKGITEFKTTTNNISKAFIKNWSNFNSENYIYNNKGFGPTLTAS 320


>gi|227524411|ref|ZP_03954460.1| possible DNA (cytosine-5-)-methyltransferase [Lactobacillus
          hilgardii ATCC 8290]
 gi|227088642|gb|EEI23954.1| possible DNA (cytosine-5-)-methyltransferase [Lactobacillus
          hilgardii ATCC 8290]
          Length = 193

 Score = 48.8 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 15/88 (17%), Positives = 26/88 (29%), Gaps = 3/88 (3%)

Query: 1  MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS--NKLW 58
          +   +FGVPQ R+RL ++        F           + D +      K +     K+ 
Sbjct: 4  INVKNFGVPQNRKRLVLLGSKKQQPNFP-DFTTKNIKTVRDCIGNLTPPKKSTDILQKIH 62

Query: 59 EGHQKRKENNKIAGKGFGYGLFFENSAT 86
            H +  E         G        + 
Sbjct: 63 SNHTEYIEKIISMIPKNGGSRKDLPESY 90


>gi|156549014|ref|XP_001607336.1| PREDICTED: similar to DNA (cytosine-5-)-methyltransferase [Nasonia
            vitripennis]
          Length = 1682

 Score = 48.8 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 24/61 (39%)

Query: 6    FGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRK 65
            +G PQ R R  ++     SV  KFP  L + P+    L   ID K    +  W      +
Sbjct: 1384 YGAPQNRRRSVLLGAAPDSVLPKFPERLHVFPKPLCELGIVIDSKKYTQDTFWTESAPYR 1443

Query: 66   E 66
             
Sbjct: 1444 S 1444


>gi|119173265|ref|XP_001239116.1| hypothetical protein CIMG_10138 [Coccidioides immitis RS]
          Length = 626

 Score = 48.8 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 31/91 (34%), Gaps = 5/91 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   D+GVPQ+R+RL +I          FP P    P    +    I D      +    
Sbjct: 472 LSCEDYGVPQQRKRLVMIGAGPGEPLPPFPKPTHGPPGSNLLPHRTILDAIGDIPENAPD 531

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLS 91
           H   +   +   K       F   +   T++
Sbjct: 532 HDLERAYFRNITKP-----AFPPRSFAKTIT 557


>gi|256397638|ref|YP_003119202.1| DNA-cytosine methyltransferase [Catenulispora acidiphila DSM 44928]
 gi|256363864|gb|ACU77361.1| DNA-cytosine methyltransferase [Catenulispora acidiphila DSM 44928]
          Length = 389

 Score = 48.8 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           + A  FGVPQ+RERL ++      V+ ++P P  
Sbjct: 157 LNAAHFGVPQKRERLILLGAQQG-VKLRWPRPTH 189


>gi|2558956|gb|AAC49849.1| Masc1 [Ascobolus immersus]
          Length = 537

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 17/41 (41%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41
           + A ++GV Q R+RL II          FP P        D
Sbjct: 373 LNAIEYGVCQNRKRLIIIGAAPGEELPPFPLPTHQDFFSKD 413


>gi|57116673|gb|AAW33810.1| M.HinP1I methyltransferase [Haemophilus influenzae]
          Length = 322

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 27/77 (35%), Gaps = 3/77 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKL 57
           + +  +G PQ RER+Y +         ++ FP P         + L      K  I+   
Sbjct: 145 LDSQFYGTPQMRERIYFVGIRKDIHHSDYVFPEPKSNNGNELSNYLIGDGKYKFLINKTF 204

Query: 58  WEGHQKRKENNKIAGKG 74
                 +   ++I+   
Sbjct: 205 ENYINNKYNKDRISLDQ 221


>gi|332674342|gb|AEE71159.1| site-specific DNA-methyltransferase [Helicobacter pylori 83]
          Length = 418

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 5/56 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + +  +G   +RERL I+   N     F FP P  +     D +   +D K+  ++
Sbjct: 214 LNSAWYGSATKRERLIIVAIRNDLPFHFAFPKPTHL----SDEINTKLDFKNLPTS 265


>gi|217965593|ref|YP_002351271.1| modification methylase (cytosine-specific methyltransferase)
           [Listeria monocytogenes HCC23]
 gi|217334863|gb|ACK40657.1| modification methylase (cytosine-specific methyltransferase)
           [Listeria monocytogenes HCC23]
 gi|307569856|emb|CAR83035.1| methyltransferase [Listeria monocytogenes L99]
          Length = 411

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEE 45
            + D+GVPQ RER+++I         F++  P         +L  
Sbjct: 226 NSRDYGVPQLRERVFLIGTHETKQPNFEYILPPPTNGTKKGLLPF 270


>gi|51892448|ref|YP_075139.1| site-specific DNA-methyltransferase [Symbiobacterium thermophilum
           IAM 14863]
 gi|51856137|dbj|BAD40295.1| site-specific DNA-methyltransferase [Symbiobacterium thermophilum
           IAM 14863]
          Length = 486

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKP 37
           + A  +GVPQ RER+++I       VE +FP P     
Sbjct: 181 LNAVHYGVPQMRERMFLIAVAGELGVEPEFPVPTHAFT 218


>gi|290892537|ref|ZP_06555530.1| site-specific DNA-methyltransferase BsuRI [Listeria monocytogenes
           FSL J2-071]
 gi|290557846|gb|EFD91367.1| site-specific DNA-methyltransferase BsuRI [Listeria monocytogenes
           FSL J2-071]
          Length = 409

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/45 (26%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEE 45
            + D+GVPQ RER+++I         F++  P         +L  
Sbjct: 226 NSRDYGVPQLRERVFLIGTHETKQPNFEYILPPPTNGTKKGLLPF 270


>gi|331677320|ref|ZP_08377999.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
 gi|331075055|gb|EGI46371.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli H591]
          Length = 415

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 34/91 (37%), Gaps = 17/91 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFP-----------TPLG------IKPRLGDIL 43
           +   +FGVPQ R R+YII  L   V    P            P         + ++ DIL
Sbjct: 146 LNTSNFGVPQNRVRIYIIASLEKEVTLTIPNDLGAKDTHNYKPSKGGHDFYTESKVSDIL 205

Query: 44  EEHIDDKSTISNKLWEGHQKRKENNKIAGKG 74
           E+  D+    S+   +  +   E +     G
Sbjct: 206 EDSPDESYDCSDWFKQRLEDIFEGDLNKVHG 236


>gi|160931938|ref|ZP_02079330.1| hypothetical protein CLOLEP_00771 [Clostridium leptum DSM 753]
 gi|156868980|gb|EDO62352.1| hypothetical protein CLOLEP_00771 [Clostridium leptum DSM 753]
          Length = 379

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 32/85 (37%), Gaps = 1/85 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DFGVPQ R+R+Y+I +L+     K FP        L  I      ++      +  
Sbjct: 150 LNSKDFGVPQSRKRVYLIGYLDKRCRGKIFPFTETAGTPLIQIRPGAQGERVYSPEGVSC 209

Query: 60  GHQKRKENNKIAGKGFGYGLFFENS 84
               +          +  GL  + +
Sbjct: 210 TLTAQPGGFGGKTGLYEVGLPIKEN 234


>gi|218134945|ref|ZP_03463749.1| hypothetical protein BACPEC_02850 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990330|gb|EEC56341.1| hypothetical protein BACPEC_02850 [Bacteroides pectinophilus ATCC
           43243]
          Length = 416

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 34/75 (45%), Gaps = 5/75 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEHIDDKS--TISNK 56
           + A DFGV Q R+R+ I+ +L  +  +++P+   +  K  + D+L +    K        
Sbjct: 202 LNAQDFGVLQSRKRVIIVGWLKGTG-YEYPSFDVIHSKAEVWDLLNDLPVLKPGEEAIEH 260

Query: 57  LWEGHQKRKENNKIA 71
                ++ K+  K  
Sbjct: 261 TMTDMRRLKKYVKDN 275


>gi|261838825|gb|ACX98591.1| cytosine-methyltransferase [Helicobacter pylori 51]
          Length = 413

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 5/56 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + +  +G   +RERL I+   N     F FP P  +     D +   +D K   ++
Sbjct: 214 LNSAWYGSATKRERLIIVAIRNDLPFHFAFPKPTHL----SDEINTKLDFKDLPTS 265


>gi|109947738|ref|YP_664966.1| site-specific DNA methyltransferase [Helicobacter acinonychis str.
           Sheeba]
 gi|109714959|emb|CAJ99967.1| site-specific DNA methyltransferase [Helicobacter acinonychis str.
           Sheeba]
          Length = 327

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 31/101 (30%), Gaps = 11/101 (10%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG--IKPRLGDILEEHIDD------KST 52
            A D+GV Q R R++ I F     + +  P       +  L D++ +  D       K+ 
Sbjct: 145 NAKDYGVAQERLRVFYIGFRRDLKINYTLPKGSTHLKRLTLKDVIWDLKDSVVCALAKNK 204

Query: 53  ISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
            +      H+    +                     T+ A 
Sbjct: 205 HNPNAINNHEYFIGSYSPIFMS--RNRVKNWDEQAFTIQAS 243


>gi|332673536|gb|AEE70353.1| DNA (cytosine-5-)-methyltransferase [Helicobacter pylori 83]
          Length = 434

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FP 30
           + A DFGV Q RERLYI+  L+ +++   FP
Sbjct: 175 LNAKDFGVAQNRERLYIVGNLSCTIDLDHFP 205


>gi|153870986|ref|ZP_02000267.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS]
 gi|152072545|gb|EDN69730.1| C-5 cytosine-specific DNA methylase [Beggiatoa sp. PS]
          Length = 350

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           + A D+G PQ+R RL+ +   N    F+FP P  
Sbjct: 266 LMAADYGTPQKRRRLFFVAA-NDLQGFQFPAPTH 298


>gi|9858807|gb|AAG01143.1|AF283660_1 BsrFI methylase [Geobacillus stearothermophilus]
          Length = 389

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 9/48 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE---------FKFPTPLGIKPRL 39
           + A +FG+PQ R R++++ F    +E         F++PTP     + 
Sbjct: 174 LNALEFGIPQDRTRVFVVGFKKSIIEALQENNMDIFQWPTPTYPDAKN 221


>gi|315638243|ref|ZP_07893425.1| site-specific DNA-methyltransferase [Campylobacter upsaliensis
           JV21]
 gi|315481779|gb|EFU72401.1| site-specific DNA-methyltransferase [Campylobacter upsaliensis
           JV21]
          Length = 418

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 36/103 (34%), Gaps = 4/103 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A  +G   +RERL I+        +F +P P      +G  L+   D+      K  +
Sbjct: 215 LNAAWYGAATKRERLIIVATRADLQGDFHYPLPRFYDESIGTKLDFSDDE--LAKCKFKK 272

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSA-RYYKDGSEI 101
               R+   KI                  T+   RY K+G  I
Sbjct: 273 PLTLREVLAKIDYTNENDIDNLPMQHNAKTIERFRYIKEGCNI 315


>gi|307149806|ref|YP_003890849.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
 gi|306986606|gb|ADN18484.1| DNA-cytosine methyltransferase [Cyanothece sp. PCC 7822]
          Length = 645

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 36/112 (32%), Gaps = 13/112 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLN-PSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFGVPQ R+R +++   N   +E   P  L I      +       +ST++   W+
Sbjct: 164 LDAADFGVPQCRKRFFLVATNNLIPLELTLPKKLSITWFEATVDLIDDLPESTLAAWQWQ 223

Query: 60  GHQKRKENNKIAGKGFGYGL------------FFENSATTNTLSARYYKDGS 99
                            Y +                +    T+ A    DG 
Sbjct: 224 RLPFDVVQEFKNEADTAYLIERSGARNDRPLHLRTANQPAWTIKAGLGSDGK 275


>gi|313667096|gb|ADR72993.1| M1.BspMI [Bacillus sp. M(2010)]
          Length = 348

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42
           +   D+GVPQ RER+ II       E  FP     +   G++
Sbjct: 158 LNMADYGVPQIRERVIIIGNRLGE-EIDFPEKDYSELPTGNL 198


>gi|193071751|ref|ZP_03052649.1| DNA-cytosine methyltransferase [Escherichia coli E110019]
 gi|192954951|gb|EDV85456.1| DNA-cytosine methyltransferase [Escherichia coli E110019]
          Length = 374

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 22/61 (36%), Gaps = 7/61 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE------FKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           +   D+GVPQ R+R   I       +      F  P P    P     L E +  +  I 
Sbjct: 152 LNTADYGVPQTRKRTIAIGIKRELFDVHSIPAFP-PAPTHRSPDKDVALPEWVCTRDAIG 210

Query: 55  N 55
           +
Sbjct: 211 D 211


>gi|210610975|ref|ZP_03288684.1| hypothetical protein CLONEX_00874 [Clostridium nexile DSM 1787]
 gi|210152200|gb|EEA83207.1| hypothetical protein CLONEX_00874 [Clostridium nexile DSM 1787]
          Length = 423

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/75 (22%), Positives = 34/75 (45%), Gaps = 5/75 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEHIDDKS--TISNK 56
           + A DFGV Q R+R+ I+ +L  +  +++P+   +  K  + D+L +    K        
Sbjct: 202 LNAQDFGVLQSRKRVIIVGWLKGTG-YEYPSFDVIHSKAEVWDLLNDLPVLKPGEEAIEH 260

Query: 57  LWEGHQKRKENNKIA 71
                ++ K+  K  
Sbjct: 261 TMTDMRRLKKYVKDN 275


>gi|160933407|ref|ZP_02080795.1| hypothetical protein CLOLEP_02253 [Clostridium leptum DSM 753]
 gi|156867284|gb|EDO60656.1| hypothetical protein CLOLEP_02253 [Clostridium leptum DSM 753]
          Length = 382

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/117 (17%), Positives = 40/117 (34%), Gaps = 16/117 (13%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK-FPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DFGVPQ R+R+Y++ +L+     K  P        L  I      ++   +  +  
Sbjct: 149 LNSKDFGVPQSRKRVYLVGYLDERCRGKILPFTETAGTPLKQIRSGAQGERIYSTEGVSC 208

Query: 60  GHQKRKENNKIA------------GKGFGYGLFFENSATT---NTLSARYYKDGSEI 101
               +                       GY + +   +      TL+ R  + G +I
Sbjct: 209 TLTSQAGGMGGKTGLYCTGVPIKENTKKGYKMAYPGDSVDLAYPTLNTRRGRVGRKI 265


>gi|296425866|ref|XP_002842459.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295638727|emb|CAZ86650.1| unnamed protein product [Tuber melanosporum]
          Length = 857

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 16/97 (16%), Positives = 32/97 (32%), Gaps = 7/97 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +   ++GVPQ R+RL+++         +FP P    P+  +I           +     G
Sbjct: 666 LHGVEYGVPQTRKRLFLLAASPGEELPEFPKPTHAHPKTANIEGRAPPRTVRDA---ISG 722

Query: 61  HQKRKENNKIAGKGF----GYGLFFENSATTNTLSAR 93
                 ++      F           +    +T+ A 
Sbjct: 723 IPATATSHVHNFSPFLDGPRLSTVNLDLPLMSTILAS 759


>gi|170718749|ref|YP_001783936.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336]
 gi|168826878|gb|ACA32249.1| DNA-cytosine methyltransferase [Haemophilus somnus 2336]
          Length = 372

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGI 35
              +FGVPQ RER+ I+     +   F+ P P   
Sbjct: 159 NFAEFGVPQFRERVLIVGVRLDTGFNFQHPMPTHN 193


>gi|317506240|ref|ZP_07964059.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC
           BAA-974]
 gi|316255486|gb|EFV14737.1| C-5 cytosine-specific DNA methylase [Segniliparus rugosus ATCC
           BAA-974]
          Length = 347

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 29/93 (31%), Gaps = 10/93 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  FGVPQ R+R  +I      VE  +P     +     ++  H D +   SN     
Sbjct: 149 LDASYFGVPQSRKRAVLIASRLGKVELPWP----GEVTPMSVVFAHSDGRVQRSN----- 199

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                                     + T++ R
Sbjct: 200 -YSGSGPVGARTAQERGRTMRGLDQPSVTITRR 231


>gi|145641419|ref|ZP_01796998.1| cytosine specific DNA methyltransferase (BSP6IM) [Haemophilus
           influenzae R3021]
 gi|145273962|gb|EDK13829.1| cytosine specific DNA methyltransferase (BSP6IM) [Haemophilus
           influenzae 22.4-21]
          Length = 298

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 27/77 (35%), Gaps = 3/77 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP--SVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKL 57
           + +  +G PQ RER+Y +         ++ FP P         + L      K  I+   
Sbjct: 121 LDSQFYGTPQMRERIYFVGIRKDIHHSDYIFPEPKSNNGNELSNYLIGDGKYKFLINKTF 180

Query: 58  WEGHQKRKENNKIAGKG 74
                 +   ++I+   
Sbjct: 181 ENYINNKYNKDRISLDQ 197


>gi|303237411|ref|ZP_07323977.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN]
 gi|302482361|gb|EFL45390.1| DNA (cytosine-5-)-methyltransferase [Prevotella disiens FB035-09AN]
          Length = 383

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 34/87 (39%), Gaps = 3/87 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP---SVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           ++A  + VPQ+RER+ ++   N     V F +P P      L D  ++     + +   +
Sbjct: 188 LEAIRYQVPQKRERIVLVAIRNDIAPKVTFHWPAPYYRLMTLNDAFKKGELYPTDVPKSI 247

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENS 84
              + ++KE         G      + 
Sbjct: 248 GAKYPEKKERVLRLVPQGGDWRNLPDD 274


>gi|213964765|ref|ZP_03392965.1| modification methylase NaeI [Corynebacterium amycolatum SK46]
 gi|213952958|gb|EEB64340.1| modification methylase NaeI [Corynebacterium amycolatum SK46]
          Length = 333

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 1/60 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + A + GVPQ R R  ++         F +P P G  P +G+ L   +  +     + W 
Sbjct: 153 IYASEHGVPQLRPRFVLVAVKQEYAPFFHWPEPQGEAPTVGETLYAEMASQGWPGAESWA 212


>gi|170084587|ref|XP_001873517.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164651069|gb|EDR15309.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 1273

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 28/79 (35%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
            ++A  +G PQRRER ++I  L+ +     P P    P+             T  +     
Sbjct: 930  LQAAHYGTPQRRERFFLIAALDGTPLPALPQPTHDFPKEFFKNTNSDVTYKTTPSTSLSI 989

Query: 61   HQKRKENNKIAGKGFGYGL 79
                K+  +      G  L
Sbjct: 990  VYPNKKRIQPIRSANGTAL 1008


>gi|291007577|ref|ZP_06565550.1| DNA-cytosine methyltransferase [Saccharopolyspora erythraea NRRL
           2338]
          Length = 418

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 7/41 (17%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-------EFKFPTPLG 34
           + A D+GVPQ R R  I+      +         ++P P  
Sbjct: 173 LNAADYGVPQARRRAIILATRRDLISEHPERVGVQYPEPTH 213


>gi|239927639|ref|ZP_04684592.1| DNA methylase [Streptomyces ghanaensis ATCC 14672]
 gi|291435979|ref|ZP_06575369.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
 gi|291338874|gb|EFE65830.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672]
          Length = 387

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 2/43 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43
           + A D+GVPQ R+R  +I      V    P P   K    D+ 
Sbjct: 162 LNAADYGVPQTRQRAILIASRTRKV--TAPDPTHAKAPEWDLF 202


>gi|228969065|ref|ZP_04129983.1| Cytosine-specific methyltransferase [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228790631|gb|EEM38314.1| Cytosine-specific methyltransferase [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 326

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 1   MKACDFGVPQRRERLYIIDF 20
           + + +FGVPQ RER++II  
Sbjct: 150 LNSKNFGVPQNRERVFIIGH 169


>gi|300866085|ref|ZP_07110814.1| site-specific DNA-methyltransferase [Oscillatoria sp. PCC 6506]
 gi|300335911|emb|CBN55972.1| site-specific DNA-methyltransferase [Oscillatoria sp. PCC 6506]
          Length = 436

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 21/51 (41%), Gaps = 3/51 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT---PLGIKPRLGDILEEHID 48
           + A  +GVPQ+RERL+++          +P        +      L +  +
Sbjct: 161 LNAAQYGVPQKRERLFLLGCRQDLTLPTYPQAFTHPASRKTSHSELPDSPN 211


>gi|238790792|ref|ZP_04634550.1| site-specific DNA methylase [Yersinia frederiksenii ATCC 33641]
 gi|238721107|gb|EEQ12789.1| site-specific DNA methylase [Yersinia frederiksenii ATCC 33641]
          Length = 712

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 28/73 (38%), Gaps = 2/73 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +KACD+G P  R+RL+++          +P P    P   D+L   +      + +  + 
Sbjct: 242 LKACDYGTPTIRKRLFVVG-RCDGESVVWPEPSHGAPNSADVLSGMLQP-WRTAAECIDW 299

Query: 61  HQKRKENNKIAGK 73
            Q  +        
Sbjct: 300 SQPTRSIFGRKKD 312


>gi|228936963|ref|ZP_04099705.1| Cytosine-specific methyltransferase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228822678|gb|EEM68568.1| Cytosine-specific methyltransferase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
          Length = 326

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 28/95 (29%), Gaps = 3/95 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE- 59
           + A  FGVP  RER++ I  L     F F        R      E+  D    +  L   
Sbjct: 148 LDARKFGVPHARERVFCISLLGGKA-FDFNKLRFKPMRDIKEYMEYGPDDEIPTQYLINI 206

Query: 60  -GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                + +       G              T++ R
Sbjct: 207 PSMLNKIKEFNPNPTGSYKRQLDVIDQYCYTITER 241


>gi|325965496|ref|YP_004243400.1| DNA-methyltransferase Dcm [Arthrobacter phenanthrenivorans Sphe3]
 gi|323471583|gb|ADX75266.1| DNA-methyltransferase Dcm [Arthrobacter phenanthrenivorans Sphe3]
          Length = 389

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 32/102 (31%), Gaps = 12/102 (11%)

Query: 5   DFGVPQRRERLYIIDFLNPS-VEFKFPTPL---------GIKPRLGDILEEHIDDKSTIS 54
           ++GVPQRR+R+ I+        +F+ P+P               +  I     + +    
Sbjct: 183 EYGVPQRRQRIVIVGIREDLQTDFRVPSPEIYNDIDVSAKSALTVPPIPLSAPNHQFVRP 242

Query: 55  NKLWEGHQKRKENNKIAGKGFGYG-LFFENSATTN-TLSARY 94
           +             + A        +       T  T+S  Y
Sbjct: 243 SATVAERLSYLLPGEHAFSPRALQEMPERLHIKTRTTISTTY 284


>gi|209525887|ref|ZP_03274422.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
 gi|209493696|gb|EDZ94016.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
          Length = 406

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 1/51 (1%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKS 51
              D+GVPQ RER+ I+     +   F  P+P     RL   L      K 
Sbjct: 160 NFADYGVPQYRERVLIVGVRMDTGFNFIHPSPEYGSDRLYPYLTAKQALKD 210


>gi|168206039|ref|ZP_02632044.1| Dcm [Clostridium perfringens E str. JGS1987]
 gi|170662518|gb|EDT15201.1| Dcm [Clostridium perfringens E str. JGS1987]
          Length = 339

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   ++     RER++I+          F+F         L  I E  +D+K    + 
Sbjct: 148 LSGINYNSAHSRERVFIVSIRKDIDNGSFEFKEGNNNLVTLESITESFVDEKYYCKDN 205


>gi|67924379|ref|ZP_00517809.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
 gi|67853772|gb|EAM49101.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
          Length = 435

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI-LEEHIDDKSTISN 55
           + + ++GVPQ RERL+++          +P+ +     + D  L      K  I +
Sbjct: 157 LNSANYGVPQLRERLFLLGSKKGLNLPNYPSFITDYTHINDSNLPSTPTVKEAIQD 212


>gi|119483468|ref|ZP_01618882.1| site-specific DNA-methyltransferase [Lyngbya sp. PCC 8106]
 gi|119458235|gb|EAW39357.1| site-specific DNA-methyltransferase [Lyngbya sp. PCC 8106]
          Length = 407

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 11/42 (26%), Positives = 18/42 (42%), Gaps = 1/42 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI 42
           + A D+G+PQ R RL+I+      +   FP           +
Sbjct: 157 LNATDYGIPQNRRRLFIVAS-KVKITHPFPPSTHTIASQSQL 197


>gi|329767774|ref|ZP_08259290.1| hypothetical protein HMPREF0428_00987 [Gemella haemolysans M341]
 gi|328838875|gb|EGF88469.1| hypothetical protein HMPREF0428_00987 [Gemella haemolysans M341]
          Length = 336

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 37/104 (35%), Gaps = 11/104 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----EFKFPTPLGIKPR-----LGDILEEHIDDKS 51
           + A   GVPQ+RER++ I           +  F               G+ ++    +  
Sbjct: 174 LNASTMGVPQKRERVFFICRRKDLNLPELQLNFNEKPIKFKEVREKGKGEEVKGVAGELL 233

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTL-SARY 94
             + K     +K     +  G  F   LF + +   NT+ ++ Y
Sbjct: 234 AYAKKGETNLEKACIRLRGKGSFFNTVLFSDENVP-NTILTSGY 276


>gi|127487|sp|P09795|MTS1_SALIN RecName: Full=Modification methylase SinI; Short=M.SinI; AltName:
           Full=Cytosine-specific methyltransferase SinI
 gi|79032|pir||A32008 site-specific DNA-methyltransferase (cytosine-specific) (EC
           2.1.1.73) - Salmonella sp
 gi|154350|gb|AAA27212.1| modification methylase (M.SinI) [Salmonella enterica subsp.
           enterica serovar Infantis]
          Length = 461

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 28/79 (35%), Gaps = 13/79 (16%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI------------LEEHIDD 49
            + +FGVPQ RER+ II   + S    F  P   +     +            L+    +
Sbjct: 247 NSANFGVPQIRERVIIICSRDGS-RVPFLQPTHSEKGEYGLPKWITLRETITNLKNITHE 305

Query: 50  KSTISNKLWEGHQKRKENN 68
                 K  + ++  KE  
Sbjct: 306 HVLFPEKRLKYYRLLKEGQ 324


>gi|319778406|ref|YP_004129319.1| DNA (cytosine-5-)-methyltransferase [Taylorella equigenitalis MCE9]
 gi|317108430|gb|ADU91176.1| DNA (cytosine-5-)-methyltransferase [Taylorella equigenitalis MCE9]
          Length = 160

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 10/20 (50%), Positives = 16/20 (80%)

Query: 1   MKACDFGVPQRRERLYIIDF 20
           + + +FGVPQ R+R+YI+ F
Sbjct: 141 LNSKNFGVPQNRKRIYIVAF 160


>gi|86142380|ref|ZP_01060890.1| putative 5-methylcytosine methyltransferase [Leeuwenhoekiella
           blandensis MED217]
 gi|85831132|gb|EAQ49589.1| putative 5-methylcytosine methyltransferase [Leeuwenhoekiella
           blandensis MED217]
          Length = 332

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 24/57 (42%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + + D+GVPQ R+R+  I   N          +     + + L  +   KS   +K+
Sbjct: 155 LNSADYGVPQVRKRVIFIGTKNSQKILFPKKEVDKYVTVKEALSSYPKLKSGQESKI 211


>gi|241661827|ref|YP_002980187.1| DNA-cytosine methyltransferase [Ralstonia pickettii 12D]
 gi|240863854|gb|ACS61515.1| DNA-cytosine methyltransferase [Ralstonia pickettii 12D]
          Length = 398

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 5/63 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK---FPTPLGIKPRLGDILEEHIDDKSTISNKL 57
           + A ++GVPQRR R++++   N  ++F    +P P        +  E     K   + K+
Sbjct: 199 LDARNYGVPQRRVRVFVLGVRND-IDFDSSVWP-PAPSHGDAREREENPALKKWVSAAKV 256

Query: 58  WEG 60
           +  
Sbjct: 257 FST 259


>gi|255530844|ref|YP_003091216.1| DNA-cytosine methyltransferase [Pedobacter heparinus DSM 2366]
 gi|255343828|gb|ACU03154.1| DNA-cytosine methyltransferase [Pedobacter heparinus DSM 2366]
          Length = 350

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 32/104 (30%), Gaps = 19/104 (18%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV----------EFKFPTPL--GIKPRLGDILEEHID 48
           +    FG+PQRR R++ +                  F             + DIL +  D
Sbjct: 156 LDTQSFGLPQRRSRIFFVCSKKELEIELTEEAIVRNFNNIDHHGLHTYSNVLDILGKDAD 215

Query: 49  DKSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
            K  +S K+       K      G    +     +     TL+A
Sbjct: 216 QKYYLSEKI-------KHTILDGGSKNFWSKSQIDLDIARTLTA 252


>gi|168211060|ref|ZP_02636685.1| Dcm [Clostridium perfringens B str. ATCC 3626]
 gi|170710923|gb|EDT23105.1| Dcm [Clostridium perfringens B str. ATCC 3626]
          Length = 339

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   ++     RER++I+          F+F         L  I E  +D+K    + 
Sbjct: 148 LSGINYNSAHSRERVFIVSIRKDIDNGSFEFKKGNNNLVTLESITESFVDEKYYCKDN 205


>gi|86475982|dbj|BAE79156.1| putative cytosine methyltransferase [Clostridium perfringens]
          Length = 339

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   ++     RER++I+          F+F         L  I E  +D+K    + 
Sbjct: 148 LSGINYNSAHSRERVFIVSIRKDIDNGSFEFKKGNNNLVTLESITESFVDEKYYCKDN 205


>gi|77465763|ref|YP_355266.1| cytosine-specific DNA methylase [Rhodobacter sphaeroides 2.4.1]
 gi|77390181|gb|ABA81365.1| Cytosine-specific DNA methylase [Rhodobacter sphaeroides 2.4.1]
          Length = 443

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 17/41 (41%), Gaps = 3/41 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGD 41
           + A D+G PQ R+RL++I           P     +    D
Sbjct: 154 LDAADYGTPQHRQRLFLIGAKRGE---TLPEIPPPQTNAAD 191


>gi|168206682|ref|ZP_02632687.1| Dcm [Clostridium perfringens E str. JGS1987]
 gi|190015777|ref|YP_001967782.1| probable site-specific DNA-methyltransferase [Clostridium
           perfringens]
 gi|86450199|gb|ABC96308.1| probable site-specific DNA-methyltransferase [Clostridium
           perfringens]
 gi|170661882|gb|EDT14565.1| Dcm [Clostridium perfringens E str. JGS1987]
          Length = 339

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   ++     RER++I+          F+F         L  I E  +D+K    + 
Sbjct: 148 LSGINYNSAHSRERVFIVSIRKDIDNGSFEFKEGNNNLVTLESITESFVDEKYYCKDN 205


>gi|328947611|ref|YP_004364948.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
 gi|328447935|gb|AEB13651.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
          Length = 391

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 31/89 (34%), Gaps = 2/89 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPL-GIKPRLGDILEEHIDDKSTISNKLWE 59
           + A DFGVPQ R+R +I+   NP+ E   PTP       + D      +     + +  E
Sbjct: 158 LCATDFGVPQTRKRFFILASKNPTTELSAPTPTCKKTVTVQDAFAGLKNVIPNSNQEETE 217

Query: 60  GHQKRKENNKIAGKGFGYGLFFE-NSATT 87
                    K+      +          T
Sbjct: 218 YSNSSSMFEKLMRDDDFWRRTNPQPDKVT 246


>gi|293363234|ref|ZP_06610118.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma alligatoris A21JP2]
 gi|292553093|gb|EFF41842.1| DNA (cytosine-5-)-methyltransferase [Mycoplasma alligatoris A21JP2]
          Length = 428

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDD-KSTISNKLWE 59
           + + DFG+ Q R+R+YII   + +V       +  +  + DI E++++  KS  S +L +
Sbjct: 160 LNSADFGLAQNRKRVYIIGTKDKTVHLN--NFVKKQSNVKDIQEDNLETIKSIFSKQLLK 217

Query: 60  GHQKRKENNKIAGKGFGY 77
            ++ +    K      G 
Sbjct: 218 KYKTKDIYGKSITDKRGG 235


>gi|228989002|ref|ZP_04149032.1| DNA-cytosine methyltransferase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228770724|gb|EEM19259.1| DNA-cytosine methyltransferase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 445

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 32/70 (45%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           M+A D+GVPQ RER+ +I   +    F     L     LG++L++  + +     K +  
Sbjct: 165 MQAHDYGVPQLRERVIVIGTKSNINPFSVIPKLDGPRTLGEVLKDCPESEFFSFKKEYAH 224

Query: 61  HQKRKENNKI 70
             +  +  + 
Sbjct: 225 VMRLIKPGQC 234


>gi|166366204|ref|YP_001658477.1| DNA cytosine methylase [Microcystis aeruginosa NIES-843]
 gi|166088577|dbj|BAG03285.1| DNA cytosine methylase [Microcystis aeruginosa NIES-843]
          Length = 346

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 26/79 (32%), Gaps = 3/79 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS--VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + +  F +PQ R R +++ F        F+FP     +  +  I+    D    IS K  
Sbjct: 159 IDSKYFQIPQSRPRFFLLAFRKDLGIKNFQFPQHCHAEVGIEKIIVPG-DYSIPISGKWQ 217

Query: 59  EGHQKRKENNKIAGKGFGY 77
           +               F  
Sbjct: 218 QYIDYYAGRINAEQLSFQM 236


>gi|323650451|gb|ADX97303.1| M.FseI [Frankia sp. Eul1b]
          Length = 374

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 2/37 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37
           + A DFGVPQRR+R  +I           P     KP
Sbjct: 162 LNAADFGVPQRRQRTIMIGSRIGPP--SLPRATHQKP 196


>gi|312200922|ref|YP_004020983.1| DNA-cytosine methyltransferase [Frankia sp. EuI1c]
 gi|311232258|gb|ADP85113.1| DNA-cytosine methyltransferase [Frankia sp. EuI1c]
          Length = 384

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 2/37 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37
           + A DFGVPQRR+R  +I           P     KP
Sbjct: 172 LNAADFGVPQRRQRTIMIGSRIGPP--SLPRATHQKP 206


>gi|332655061|ref|ZP_08420802.1| modification methylase NgoFVII (Cytosine-specificmethyltransferase
           NgoFVII) (M.NgoFVII) (M.NgoVII) [Ruminococcaceae
           bacterium D16]
 gi|332515921|gb|EGJ45530.1| modification methylase NgoFVII (Cytosine-specificmethyltransferase
           NgoFVII) (M.NgoFVII) (M.NgoVII) [Ruminococcaceae
           bacterium D16]
          Length = 369

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 24/65 (36%), Gaps = 9/65 (13%)

Query: 2   KACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLG------IKPRLGDILEEHIDDKSTIS 54
              ++GVPQ RER+  +     +   F  P P             GD L     +K   +
Sbjct: 158 NFAEYGVPQFRERVLFVGVRIDTGFNFVHPKPTHGPNGELPYVTAGDALVGV--EKVPTN 215

Query: 55  NKLWE 59
           N+L  
Sbjct: 216 NELIN 220


>gi|315169253|gb|EFU13270.1| DNA (cytosine-5-)-methyltransferase [Enterococcus faecalis TX1341]
          Length = 521

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 23/60 (38%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A  FGVPQ+R R+  + + N  V   +P     +  + D       +     +  +  
Sbjct: 182 LNAAHFGVPQQRNRVVFLAYRNDVVPVTYPVINNDRTTVYDAFGSLYPNTDFQYDTQYSF 241


>gi|308229522|gb|ADO24174.1| M.AclI [Acinetobacter calcoaceticus]
          Length = 458

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 2   KACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGD 41
            A D+GVPQ R R++ +   N    E  FP   G     GD
Sbjct: 273 NAKDYGVPQSRARVFFLAIRNDIQSELGFPDAEGNNLTFGD 313


>gi|119513472|ref|ZP_01632497.1| cytosine-specific DNA methyltransferase [Nodularia spumigena
           CCY9414]
 gi|119461873|gb|EAW42885.1| cytosine-specific DNA methyltransferase [Nodularia spumigena
           CCY9414]
          Length = 400

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE 26
           + A ++GVPQ RER+ ++ F N  + 
Sbjct: 172 INAIEYGVPQDRERIILVGFRNNLIN 197


>gi|323691274|ref|ZP_08105549.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14673]
 gi|323504614|gb|EGB20401.1| cytosine-specific methyltransferase [Clostridium symbiosum
           WAL-14673]
          Length = 324

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 36/94 (38%), Gaps = 12/94 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A +FG+PQ RER++ +  LN   +F+F   +    R   + LE+ + D   ++     
Sbjct: 164 LDAREFGLPQARERVFTVSVLNGE-KFEFDDLIRTPMRNLQEFLEDDVPDIYDVTQP--- 219

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                  +        G            T++ R
Sbjct: 220 -------SVLACIGEKGIRRATVIKDCAYTITTR 246


>gi|312890850|ref|ZP_07750379.1| DNA-cytosine methyltransferase [Mucilaginibacter paludis DSM 18603]
 gi|311296633|gb|EFQ73773.1| DNA-cytosine methyltransferase [Mucilaginibacter paludis DSM 18603]
          Length = 336

 Score = 47.7 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIK-PRLGDILEEHI 47
           + + D+GV Q R R  ++       + F +P    +  P +G +L E I
Sbjct: 155 INSSDYGVSQLRPRAILVALKKEYFDLFTWPEKNQLFVPSVGQLLFEEI 203


>gi|323186482|gb|EFZ71828.1| DNA adenine methylase family protein [Escherichia coli 1357]
          Length = 754

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/112 (20%), Positives = 43/112 (38%), Gaps = 16/112 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKF--------PTPLGIKPRLGDILEEHI 47
           + A  FGV QRR R++++      ++     F+F        P+    +           
Sbjct: 198 LDAQYFGVAQRRRRVFVVASARTDLDPATVLFEFEGVRRNIAPSRKKKEIASAITANGAA 257

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKD 97
               +++  L  G     ++ K    GF    F  + +  T +T+ AR +KD
Sbjct: 258 ISGESLNPCLHAGMSPGMKSTKA-VNGFRMAAFGEYIDDETASTVKARDFKD 308


>gi|291543286|emb|CBL16395.1| DNA-methyltransferase (dcm) [Ruminococcus sp. 18P13]
          Length = 369

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/96 (18%), Positives = 36/96 (37%), Gaps = 3/96 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS-VEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + +  FGVPQ+R RLYI+ +L+P      FP   G    L  ++      +   ++ +  
Sbjct: 147 LNSKYFGVPQQRRRLYIVGYLDPRCAGKVFPLSGGNAKNLKQLIPGPQGQRVYETDGIAC 206

Query: 60  GHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSAR 93
                          +   +  +   +     ++AR
Sbjct: 207 TQCAGSGGWGGKTGLYFIDMNADPVITDVARCITAR 242


>gi|189459597|ref|ZP_03008382.1| hypothetical protein BACCOP_00223 [Bacteroides coprocola DSM 17136]
 gi|189433679|gb|EDV02664.1| hypothetical protein BACCOP_00223 [Bacteroides coprocola DSM 17136]
          Length = 387

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37
           + A +FGVPQRR+R++II  L        P P  +  
Sbjct: 290 LNAEEFGVPQRRKRVFIIGSLEEI---SIPQPSPLFY 323


>gi|116750223|ref|YP_846910.1| DNA-cytosine methyltransferase [Syntrophobacter fumaroxidans MPOB]
 gi|116699287|gb|ABK18475.1| DNA-cytosine methyltransferase [Syntrophobacter fumaroxidans MPOB]
          Length = 399

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 21/54 (38%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTIS 54
           + A D+GVPQ R R +II  L    +  FP      P   +      + +    
Sbjct: 163 LCAADYGVPQIRWRAFIIGCLFTDPKKVFPPKRTNYPTDLNNRRIFAEKEVPYI 216


>gi|46019827|emb|CAE52349.1| putative cytosine-specific methyltransferase [Streptococcus
           thermophilus]
          Length = 408

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 37/92 (40%), Gaps = 7/92 (7%)

Query: 4   CDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQK 63
            DFGVPQ+R+R+ II     +    +   L     L   L  H   K T+ + + +    
Sbjct: 188 SDFGVPQKRKRVIIIGVRRDNQSTDYQEILNQIYSLIHNLSTHQQTK-TVRDAISDLPPL 246

Query: 64  RKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
               N    K +       N ++ N  S+R++
Sbjct: 247 YPVENPTRTKAYT------NDSSINGHSSRFH 272


>gi|329121769|ref|ZP_08250386.1| DNA (cytosine-5-)-methyltransferase [Dialister micraerophilus DSM
           19965]
 gi|327468239|gb|EGF13725.1| DNA (cytosine-5-)-methyltransferase [Dialister micraerophilus DSM
           19965]
          Length = 416

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK--FPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           + A D+G PQRR R +I  F N +  F   F         + + ++  +   +T+SN+L 
Sbjct: 162 INAADYGYPQRRRRTFIFAFRNETKFFDYVFNISREDIDEIEEFIKTMVPFSNTMSNELV 221

Query: 59  EGHQKRKENNKIAGKGF 75
            G +    N   + + F
Sbjct: 222 AGIENVDLNLAESLEEF 238


>gi|317127844|ref|YP_004094126.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522]
 gi|315472792|gb|ADU29395.1| DNA-cytosine methyltransferase [Bacillus cellulosilyticus DSM 2522]
          Length = 360

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 27/87 (31%), Gaps = 1/87 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR-LGDILEEHIDDKSTISNKLWE 59
           + A +FGVPQ+R R + I       +  F          + D L E  + +  +      
Sbjct: 153 LDASEFGVPQKRLRAFFIATRKDIPQITFDKLKKKPIVLVKDALGELYELEEQMGKNRSN 212

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSAT 86
                K ++             EN   
Sbjct: 213 YFLSSKPDSSYRKYLRNSKNSIENHEI 239


>gi|318057151|ref|ZP_07975874.1| DNA-cytosine methyltransferase [Streptomyces sp. SA3_actG]
 gi|318076183|ref|ZP_07983515.1| DNA-cytosine methyltransferase [Streptomyces sp. SA3_actF]
          Length = 386

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 12/40 (30%), Positives = 17/40 (42%), Gaps = 1/40 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKPRL 39
           + A D+GVPQ R R  +I       E  + P P   +   
Sbjct: 155 LNAADYGVPQARRRAIVIATRRDLGEPLRHPIPTHRRATD 194


>gi|160894869|ref|ZP_02075643.1| hypothetical protein CLOL250_02419 [Clostridium sp. L2-50]
 gi|156863300|gb|EDO56731.1| hypothetical protein CLOL250_02419 [Clostridium sp. L2-50]
          Length = 423

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP--LGIKPRLGDILEEHID--DKSTISNK 56
           + A +FGV Q R+R+ I+ +L  +  +++P+   +  K  + D+L++             
Sbjct: 202 LNAQNFGVLQSRKRVIIVGWLKGTG-YEYPSFDVIHSKAEVWDLLKDLPPLTPGIEAREH 260

Query: 57  LWEGHQKRKENNKIAG 72
                ++ K+  K  G
Sbjct: 261 TMNDMRRLKKYVKDNG 276


>gi|226945654|ref|YP_002800727.1| C-5 cytosine-specific DNA methylase [Azotobacter vinelandii DJ]
 gi|226720581|gb|ACO79752.1| C-5 cytosine-specific DNA methylase [Azotobacter vinelandii DJ]
          Length = 501

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTPLG 34
           + A  +GVPQ RERL+++       V  +FP+P  
Sbjct: 199 LNAAFYGVPQLRERLFLVAVDATLDVIPQFPSPTH 233


>gi|228964036|ref|ZP_04125166.1| hypothetical protein bthur0004_8960 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228795688|gb|EEM43165.1| hypothetical protein bthur0004_8960 [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 478

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
           + + DFGVPQ+R+R+ II   +      +P    
Sbjct: 181 LNSADFGVPQQRKRVVIIANKHGIEN-TYPKNTH 213


>gi|307825806|ref|ZP_07656022.1| DNA-cytosine methyltransferase [Methylobacter tundripaludum SV96]
 gi|307733114|gb|EFO03975.1| DNA-cytosine methyltransferase [Methylobacter tundripaludum SV96]
          Length = 359

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 22/32 (68%), Gaps = 3/32 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFK--FP 30
           + A D+G+PQRR+R++I+   +  +EF   +P
Sbjct: 161 LDARDYGLPQRRKRVFILGIRSD-IEFNSVWP 191


>gi|210614083|ref|ZP_03290039.1| hypothetical protein CLONEX_02252 [Clostridium nexile DSM 1787]
 gi|210150861|gb|EEA81869.1| hypothetical protein CLONEX_02252 [Clostridium nexile DSM 1787]
          Length = 244

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 18/23 (78%)

Query: 1   MKACDFGVPQRRERLYIIDFLNP 23
           + + DFGVPQ R+R+Y+I +L+ 
Sbjct: 140 LNSKDFGVPQSRKRVYLIGYLDE 162


>gi|262283530|ref|ZP_06061296.1| cytosine-specific methyltransferase NlaX [Streptococcus sp.
           2_1_36FAA]
 gi|262261021|gb|EEY79721.1| cytosine-specific methyltransferase NlaX [Streptococcus sp.
           2_1_36FAA]
          Length = 411

 Score = 47.7 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/99 (21%), Positives = 35/99 (35%), Gaps = 10/99 (10%)

Query: 1   MKACDFGVPQRRERLYIIDF-LNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + +  FGVPQ R+R++++           FP  LG   R    L E   +  T      +
Sbjct: 147 LNSSHFGVPQNRQRVFLVGHSRRRGTRPIFP--LGSYNREVAELSEIRTNSLTAQYPGGQ 204

Query: 60  GHQKRKENNKIAGKGFGY-------GLFFENSATTNTLS 91
           G+      +K    G  +       G  +       TL+
Sbjct: 205 GNGSYIIESKPKRVGNIHPSGKGMNGDVYSAEGPAPTLT 243


>gi|257453711|ref|ZP_05618997.1| modification methylase Eco47II [Enhydrobacter aerosaccus SK60]
 gi|257448894|gb|EEV23851.1| modification methylase Eco47II [Enhydrobacter aerosaccus SK60]
          Length = 415

 Score = 47.3 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 3/79 (3%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSV---EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           KA  + VPQ+RERL II   N  V   +F  P+P      + D L+      S +   + 
Sbjct: 227 KAVFYKVPQKRERLIIIGVRNDLVAKAKFVKPSPYYRLLTVKDALQAGELFDSAVPESVG 286

Query: 59  EGHQKRKENNKIAGKGFGY 77
           + + KRK          GY
Sbjct: 287 QAYPKRKAEIMAYVPEGGY 305


>gi|288958310|ref|YP_003448651.1| DNA (cytosine-5-)-methyltransferase [Azospirillum sp. B510]
 gi|288910618|dbj|BAI72107.1| DNA (cytosine-5-)-methyltransferase [Azospirillum sp. B510]
          Length = 375

 Score = 47.3 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 2/37 (5%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKP 37
           + A DFGVPQ+R+R  II         + P P   + 
Sbjct: 171 LHAADFGVPQKRQRAIIIGSRVGKP--RLPMPTHQQK 205


>gi|295395397|ref|ZP_06805596.1| modification methylase NaeI [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971719|gb|EFG47595.1| modification methylase NaeI [Brevibacterium mcbrellneri ATCC 49030]
          Length = 355

 Score = 47.3 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 3   ACDFGVPQRRERLYIIDFLNPSVEFKFPT 31
           + DFGVPQ R R  ++   +   +F+FP+
Sbjct: 147 SADFGVPQLRPRAVLVALKDGEADFEFPS 175


>gi|242237482|ref|YP_002985663.1| DNA-cytosine methyltransferase [Dickeya dadantii Ech703]
 gi|242129539|gb|ACS83841.1| DNA-cytosine methyltransferase [Dickeya dadantii Ech703]
          Length = 465

 Score = 47.3 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 26/68 (38%), Gaps = 1/68 (1%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
            A +FG PQ RER+ II   N      + TP        ++   +  + S    K  +  
Sbjct: 247 NAANFGTPQIRERVIIICSRNGKTP-PYLTPTHSDDPYFELPHWNTLESSISDLKNHDHL 305

Query: 62  QKRKENNK 69
              ++  K
Sbjct: 306 NFPEKRLK 313


>gi|261736050|ref|YP_003257392.1| DNA methylase [Streptomyces sp. ZL12]
 gi|261349173|gb|ACX71105.1| DNA methylase [Streptomyces sp. ZL12]
          Length = 368

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 2/43 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDIL 43
           + A ++GVPQ RER  +I      V    P P   +    D+ 
Sbjct: 170 LNAANYGVPQTRERAVLIASRVRDV--TAPEPTHAEHPADDLF 210


>gi|328708218|ref|XP_003243626.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Acyrthosiphon
           pisum]
          Length = 1227

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHI-DDKSTISNKLWE 59
           ++A +FGVPQ R RL I+          +P P+ +  R    L   + D+K   + K   
Sbjct: 922 LQAGNFGVPQTRRRLIIMAAAPGEKLPFYPEPINVFNRKSSSLSVQVGDEKFKTNCKYVN 981

Query: 60  G 60
            
Sbjct: 982 S 982


>gi|220926735|ref|YP_002502037.1| DNA-cytosine methyltransferase [Methylobacterium nodulans ORS 2060]
 gi|219951342|gb|ACL61734.1| DNA-cytosine methyltransferase [Methylobacterium nodulans ORS 2060]
          Length = 454

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILE 44
           + A   GVPQ R+RL  +   +       FP PL  +  + D L 
Sbjct: 251 LDAQWLGVPQARQRLIFVGVRDDLGLSPAFPKPLPFRYSVRDALP 295


>gi|218848105|ref|YP_002454768.1| DNA-cytosine methyltransferase [Bacillus cereus G9842]
 gi|218546236|gb|ACK98629.1| DNA-cytosine methyltransferase [Bacillus cereus G9842]
          Length = 438

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/70 (25%), Positives = 31/70 (44%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           M+A D+GVPQ RER+ +I   +    F     L     LG++L++    +     K +  
Sbjct: 158 MQAHDYGVPQLRERVIVIGTKSNINPFSVIPKLDGPRTLGEVLKDCPKSEFFSFKKEYAH 217

Query: 61  HQKRKENNKI 70
             +  +  K 
Sbjct: 218 VMQLIKPGKC 227


>gi|86559571|ref|YP_473392.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens CPE
           str. F4969]
 gi|168215006|ref|ZP_02640631.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens CPE
           str. F4969]
 gi|86475843|dbj|BAE79019.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens]
 gi|94958361|gb|ABF47322.1| Dcm [Clostridium perfringens]
 gi|170713579|gb|EDT25761.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens CPE
           str. F4969]
          Length = 339

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   ++     RER++I+          FKF         L  I E  +D+K    + 
Sbjct: 148 LSGINYNSAHSRERVFIVSIRKDIDNGSFKFKEGNDNLVTLESITENFVDEKYYCKDN 205


>gi|254416651|ref|ZP_05030402.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
 gi|196176617|gb|EDX71630.1| C-5 cytosine-specific DNA methylase superfamily [Microcoleus
           chthonoplastes PCC 7420]
          Length = 428

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 4/52 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTP----LGIKPRLGDILEEHID 48
           + A +FGVPQ+R+RL+I+          +P P          + D + +  +
Sbjct: 173 LNAVNFGVPQQRQRLFILGNQVGVKPLTYPQPQLQSPSEFCTVRDAIADLPN 224


>gi|289669548|ref|ZP_06490623.1| DNA-cytosine methyltransferase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 330

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 2/44 (4%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILE 44
           + A D+GVPQ RER  ++           P P   K   G +L 
Sbjct: 145 INAADYGVPQIRERCIVMGIKGRDP--CPPLPTHSKNPDGFMLP 186


>gi|296814510|ref|XP_002847592.1| site-specific DNA-methyltransferase HphI [Arthroderma otae CBS
           113480]
 gi|238840617|gb|EEQ30279.1| site-specific DNA-methyltransferase HphI [Arthroderma otae CBS
           113480]
          Length = 586

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 15/33 (45%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
              D+GVPQ R+RL II          FP P  
Sbjct: 426 NCKDYGVPQSRKRLVIIAAGPGEELPPFPPPTH 458


>gi|168210881|ref|ZP_02636506.1| Dcm [Clostridium perfringens B str. ATCC 3626]
 gi|209947599|ref|YP_002291106.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens]
 gi|170711042|gb|EDT23224.1| Dcm [Clostridium perfringens B str. ATCC 3626]
 gi|209910390|dbj|BAG75479.1| C-5 cytosine-specific DNA methylase [Clostridium perfringens]
          Length = 339

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   ++     RER++I+          F+F         L  I E  +D+K    + 
Sbjct: 148 LSGINYNSAHSRERVFIVSIRKDIDNGSFEFKEGNDNLVTLESITESFVDEKYYCKDN 205


>gi|157691446|ref|YP_001485908.1| DNA (cytosine-5-)-methyltransferase [Bacillus pumilus SAFR-032]
 gi|157680204|gb|ABV61348.1| DNA (cytosine-5-)-methyltransferase [Bacillus pumilus SAFR-032]
          Length = 548

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 19/51 (37%), Gaps = 5/51 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + +  FGVPQ R+R +II + N       P+         D        K 
Sbjct: 322 LNSAHFGVPQERKRYFIIGYRNSK-----PSLPKSILSKEDFFNIGHAIKE 367


>gi|308183509|ref|YP_003927636.1| DNA-cytosine methyltransferase [Helicobacter pylori PeCan4]
 gi|308065694|gb|ADO07586.1| DNA-cytosine methyltransferase [Helicobacter pylori PeCan4]
          Length = 238

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 33/99 (33%), Gaps = 13/99 (13%)

Query: 1   MKACDFGVPQRRERLYIID----FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +K  DFGV Q RER+ ++     +      FK        P + +IL++           
Sbjct: 83  LKVSDFGVSQLRERVIMVGVNESYFKEPFNFKILKKSH-APFVYEILKDL--------EN 133

Query: 57  LWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYY 95
           L EG       +K                   T+ A ++
Sbjct: 134 LTEGAMPNHFYSKAKRNKGQGNNAINKDTYAPTMRAEHH 172


>gi|253997214|ref|YP_003049278.1| DNA-cytosine methyltransferase [Methylotenera mobilis JLW8]
 gi|253983893|gb|ACT48751.1| DNA-cytosine methyltransferase [Methylotenera mobilis JLW8]
          Length = 358

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 5   DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRL 39
           ++G+PQ R R+ ++ F +  +++F  P P       
Sbjct: 168 EYGIPQSRHRIILVGFRSDLNIKFSPPAPTHKDKPN 203


>gi|94958344|gb|ABF47306.1| Dcm [Clostridium perfringens]
 gi|94958377|gb|ABF47337.1| Dcm [Clostridium perfringens]
          Length = 339

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   ++     RER++I+          FKF         L  I E  +D+K    + 
Sbjct: 148 LSGINYNSAHSRERVFIVSIRKDIDNGSFKFKEGNDNLVTLESITENFVDEKYYCKDN 205


>gi|67924690|ref|ZP_00518097.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
 gi|67853467|gb|EAM48819.1| C-5 cytosine-specific DNA methylase [Crocosphaera watsonii WH 8501]
          Length = 420

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 33/98 (33%), Gaps = 24/98 (24%)

Query: 1   MKACDFGVPQRRERLYIID---------------------FLNPSVEFKFPTPLGIKP-- 37
           + + +F VPQ R R+YI+                      F    ++     P+      
Sbjct: 146 LNSSNFNVPQNRVRIYIVGKKGSQPNLTIKSDKGAIDSHSFKKNIIQGDLFAPINYPTKP 205

Query: 38  -RLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKG 74
             + DIL++ +++K   S +      +    N     G
Sbjct: 206 LTVKDILKDIVEEKYFCSQEFTNLLNRAVRGNFNKLHG 243


>gi|15828657|ref|NP_326017.1| CpG DNA methylase (cytosine-specific methyltransferase SSSI)
           [Mycoplasma pulmonis UAB CTIP]
 gi|14089599|emb|CAC13359.1| CPG DNA METHYLASE (CYTOSINE-SPECIFIC METHYLTRANSFERASE SSSI)
           [Mycoplasma pulmonis]
          Length = 264

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 39/103 (37%), Gaps = 12/103 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLN---------PSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + + D+G  Q R+R+Y I  LN           ++   P P   +  + DIL+   +++ 
Sbjct: 68  LNSSDYGSVQSRKRVYAISILNYWGKIDQDGNILDIDKPLPTPKRKSIKDILKVDYENEH 127

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGL-FFENSATTNTLSAR 93
                L    Q  +  ++         +     S+   TL+ R
Sbjct: 128 HYQEALIS--QPNRTPSRKTIFEKNPKIDINSTSSLIRTLTTR 168


>gi|313144510|ref|ZP_07806703.1| cytosine specific DNA methyltransferase [Helicobacter cinaedi CCUG
           18818]
 gi|313129541|gb|EFR47158.1| cytosine specific DNA methyltransferase [Helicobacter cinaedi CCUG
           18818]
          Length = 323

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 37/90 (41%), Gaps = 2/90 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q RER+Y +        +F F +    K  L + L    D+  +  ++ ++
Sbjct: 145 LNSLDFALAQARERVYFVGIRKDKKRDFSF-SQRMTKKALKEFLTPKQDNIFSRDSQSYQ 203

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
              +  EN    G+     +  ++    +T
Sbjct: 204 TFLRFLENKYNKGRFDLTQILDKDFLVLDT 233


>gi|295836816|ref|ZP_06823749.1| modification methylase NaeI [Streptomyces sp. SPB74]
 gi|295826219|gb|EDY44437.2| modification methylase NaeI [Streptomyces sp. SPB74]
          Length = 449

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/109 (20%), Positives = 36/109 (33%), Gaps = 16/109 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPS---VEFKFPTPL-GIKPRLGDILEEHIDD------- 49
           + +  FGVPQ R R  ++ F        +F++P         + D+L E + +       
Sbjct: 195 LDSNKFGVPQLRPRAILVAFREDIARFEDFRWPVRSAEEAESVFDVLREEMRERYEPYWT 254

Query: 50  KSTISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
           K  +      G Q  +   + A       L         TL     K G
Sbjct: 255 KRPLGPGSLTGKQAYERWEERASAADARKL-----KVAPTLVGGSRKHG 298


>gi|194335797|ref|YP_002017591.1| DNA-cytosine methyltransferase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308274|gb|ACF42974.1| DNA-cytosine methyltransferase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 434

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 21/55 (38%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           + A D+GVPQ R R +I+       +  FP      P  G            I++
Sbjct: 178 LCAADYGVPQIRWRAFIVGCKFADPQAVFPPKKTHFPHKGYRQRFVESSIPYIAD 232


>gi|324111159|gb|EGC05144.1| DNA adenine methylase [Escherichia fergusonii B253]
          Length = 1095

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 42/112 (37%), Gaps = 16/112 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKF--------PTPLGIKPRLGDILEEHI 47
           + A  FGV QRR R++++      ++     F+F        P+    +     I     
Sbjct: 539 LDAQYFGVAQRRRRVFVVASARTDLDPATVLFEFEGVRRDIAPSRKKKEIASAIIANGAA 598

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKD 97
               +++  L        ++ K     F    F  + +  T +T+ AR +KD
Sbjct: 599 ISGESLNPCLHADMPPGMKSTKA-VNAFRMAAFGEYIDDETASTVKARDFKD 649


>gi|323969240|gb|EGB64542.1| DNA adenine methylase [Escherichia coli TA007]
          Length = 754

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 42/112 (37%), Gaps = 16/112 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKF--------PTPLGIKPRLGDILEEHI 47
           + A  FGV QRR R++++      ++     F+F        P+    +     I     
Sbjct: 198 LDAQYFGVAQRRRRVFVVASARTDLDPATVLFEFEGVRRNIAPSRKKKEIASAIIANGAA 257

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKD 97
               +++  L        ++ K     F    F  + +  T +T+ AR +KD
Sbjct: 258 ISGESLNPCLHADMPPGMKSTKA-VNAFRMAAFGEYIDDETASTVKARDFKD 308


>gi|331655761|ref|ZP_08356750.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718]
 gi|331046535|gb|EGI18624.1| DNA (cytosine-5-)-methyltransferase [Escherichia coli M718]
          Length = 754

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 42/112 (37%), Gaps = 16/112 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKF--------PTPLGIKPRLGDILEEHI 47
           + A  FGV QRR R++++      ++     F+F        P+    +     I     
Sbjct: 198 LDAQYFGVAQRRRRVFVVASARTDLDPATVLFEFKGVRRNIAPSRKKKEIASAIIANGAA 257

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKD 97
               +++  L        ++ K     F    F  + +  T +T+ AR +KD
Sbjct: 258 ISGESLNPCLHADMPPGMKSTKA-VNAFRMAAFGEYIDDETASTVKARDFKD 308


>gi|169342462|ref|ZP_02863522.1| Dcm [Clostridium perfringens C str. JGS1495]
 gi|169299461|gb|EDS81526.1| Dcm [Clostridium perfringens C str. JGS1495]
          Length = 339

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   ++     RER++I+          FKF         L  I E  +D+K    + 
Sbjct: 148 LSGINYNSAHSRERVFIVSIRKDIDNGSFKFKEGNDNLVTLESITENFVDEKYYCKDN 205


>gi|195873685|ref|ZP_02698511.2| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195632788|gb|EDX51242.1| DNA-cytosine methyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 382

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPT 31
           + + D+G+PQ RERL+++ F      F F  
Sbjct: 163 LNSLDYGIPQDRERLFVVGFKK---SFIFDK 190


>gi|75906954|ref|YP_321250.1| C-5 cytosine-specific DNA methylase [Anabaena variabilis ATCC
           29413]
 gi|75700679|gb|ABA20355.1| C-5 cytosine-specific DNA methylase [Anabaena variabilis ATCC
           29413]
          Length = 385

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 25/60 (41%), Gaps = 1/60 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           + A ++GVPQ RER+ ++ F     +  F        +L + L           +K++  
Sbjct: 172 INAIEYGVPQNRERIILLGFSKKFFQ-DFWGINSHNQKLLEFLFPWESKVLYPKDKVFAY 230


>gi|228950066|ref|ZP_04112251.1| DNA-cytosine methyltransferase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228809593|gb|EEM56029.1| DNA-cytosine methyltransferase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 445

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 31/70 (44%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           M+A D+GVPQ RER+ +I   +    F     L     LG++L++    +     K +  
Sbjct: 165 MQAHDYGVPQLRERVIVIGTKSNINPFSVIPKLDGPRTLGEVLKDCPKSEFFSFKKEYAH 224

Query: 61  HQKRKENNKI 70
             +  +  + 
Sbjct: 225 VMQLIKPGQC 234


>gi|172038906|ref|YP_001805407.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142]
 gi|171700360|gb|ACB53341.1| C-5 cytosine-specific DNA methylase [Cyanothece sp. ATCC 51142]
          Length = 427

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 16/91 (17%), Positives = 34/91 (37%), Gaps = 3/91 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI---LEEHIDDKSTISNKL 57
           + A ++GVPQ RERL+++          +P  +    +  ++   L   + D      ++
Sbjct: 157 LNAANYGVPQLRERLFLLGAKQGLKLPNYPDFVTKYNQQDNLSLPLTPTVKDAIQDLPEV 216

Query: 58  WEGHQKRKENNKIAGKGFGYGLFFENSATTN 88
               +    +  IA  G           ++N
Sbjct: 217 NHYSELNHRDWVIANYGKPSQYVETLRKSSN 247


>gi|153835199|ref|ZP_01987866.1| site-specific DNA methylase [Vibrio harveyi HY01]
 gi|148868309|gb|EDL67437.1| site-specific DNA methylase [Vibrio harveyi HY01]
          Length = 475

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 39/128 (30%), Gaps = 31/128 (24%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG-----IKPRLGDILEEHIDDKSTISN 55
           +KACD+G    RER +++       + ++P P             D ++  I  KS    
Sbjct: 200 LKACDYGCGTSRERFFLVA-RKDGEDIQWPEPTHGEGKASYVTAADSVDWSIPVKSIFGR 258

Query: 56  KL---WEGHQKRKENNKI----AGKGFG-----------------YGLFFENSATTNTLS 91
           K     +  ++  +  +         F                              T++
Sbjct: 259 KRPLAPKTLERIAKGLEKFVINNDNPFFVPEQAQIPFVTECANSSNQRNMPIDEPLRTIT 318

Query: 92  ARYYKDGS 99
           A Y K GS
Sbjct: 319 A-YPKGGS 325


>gi|332665024|ref|YP_004447812.1| DNA-cytosine methyltransferase [Haliscomenobacter hydrossis DSM
           1100]
 gi|332333838|gb|AEE50939.1| DNA-cytosine methyltransferase [Haliscomenobacter hydrossis DSM
           1100]
          Length = 366

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 34/104 (32%), Gaps = 11/104 (10%)

Query: 1   MKACDFGVPQRRERLYIIDFLN------PSVEFKFPTPLGIKP--RLGDILEEHIDDKST 52
           + A DF VPQ RER++ I F N         +   P  +          +L++  +  + 
Sbjct: 144 LNATDFDVPQARERVFFIGFKNNSQIIPDLTKMLEPYKIKAPTVRAALSVLDKAGEGNNI 203

Query: 53  ISNKLWEGHQKR---KENNKIAGKGFGYGLFFENSATTNTLSAR 93
              K           +++        G G   +      TL A 
Sbjct: 204 GVCKAKITLTPNPVMRKSPFAGMLFNGLGRPVKIDGYCATLPAS 247


>gi|33338827|gb|AAQ14149.1| Dmt, incomplete [Enterobacteria phage P1]
          Length = 638

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 41/112 (36%), Gaps = 16/112 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKF--------PTPLGIKPRLGDILEEHI 47
           + A  FGV QRR R++++      ++     F+F        P     +     I     
Sbjct: 198 LDAQYFGVAQRRRRVFVVASARTDLDPATVLFEFEGVRRNIAPRRKKKEIASAIIANGAA 257

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKD 97
               +++  L        ++ K     F    F  + +  T +T+ AR +KD
Sbjct: 258 ISGESLNPCLHADMPPSMKSTKA-VNAFRMAAFGEYIDDETASTVKARDFKD 308


>gi|46401691|ref|YP_006537.1| Dmt [Enterobacteria phage P1]
 gi|33338718|gb|AAQ14041.1| Dmt [Enterobacteria phage P1]
          Length = 754

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 41/112 (36%), Gaps = 16/112 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKF--------PTPLGIKPRLGDILEEHI 47
           + A  FGV QRR R++++      ++     F+F        P     +     I     
Sbjct: 198 LDAQYFGVAQRRRRVFVVASARTDLDPATVLFEFEGVRRNIAPRRKKKEIASAIIANGAA 257

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKD 97
               +++  L        ++ K     F    F  + +  T +T+ AR +KD
Sbjct: 258 ISGESLNPCLHADMPPSMKSTKA-VNAFRMAAFGEYIDDETASTVKARDFKD 308


>gi|238917713|ref|YP_002931230.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC
           27750]
 gi|238873073|gb|ACR72783.1| DNA (cytosine-5-)-methyltransferase [Eubacterium eligens ATCC
           27750]
          Length = 477

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/109 (22%), Positives = 31/109 (28%), Gaps = 12/109 (11%)

Query: 1   MKACDFGVPQRRERLYIID---------FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           + A +FGVPQ RERL  I            N         P          L E    + 
Sbjct: 247 LNAKNFGVPQNRERLIYIGNCMGVDNEQIFNEIFALSENIPEHNLGDALFALRELEASRV 306

Query: 52  TISNKLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLS---ARYYKD 97
             S +        K       +   Y  +       N +S   ARY  D
Sbjct: 307 KNSTESGSIESGYKIEKNNITETNDYISYINQDKVVNVVSNHKARYNND 355


>gi|302836690|ref|XP_002949905.1| maintenance DNA methyltransferase [Volvox carteri f. nagariensis]
 gi|300264814|gb|EFJ49008.1| maintenance DNA methyltransferase [Volvox carteri f. nagariensis]
          Length = 2277

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
            + A  FGVPQ R+R +I   L   V  ++PTP  
Sbjct: 1935 LNAGHFGVPQSRKRTFIWAALPGEVLPEWPTPRH 1968


>gi|302559403|ref|ZP_07311745.1| modification methylase NaeI [Streptomyces griseoflavus Tu4000]
 gi|302477021|gb|EFL40114.1| modification methylase NaeI [Streptomyces griseoflavus Tu4000]
          Length = 429

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 2/61 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-FKFPTPLGIKP-RLGDILEEHIDDKSTISNKLW 58
           + A DFGVPQ R R  ++  L    E F +P  L      +G  LE  +  K     K W
Sbjct: 153 LHASDFGVPQLRPRFVLVALLPEYAEYFSWPEELPDARLTVGAALEGLMAAKGWEGAKTW 212

Query: 59  E 59
            
Sbjct: 213 A 213


>gi|167759130|ref|ZP_02431257.1| hypothetical protein CLOSCI_01477 [Clostridium scindens ATCC 35704]
 gi|167663248|gb|EDS07378.1| hypothetical protein CLOSCI_01477 [Clostridium scindens ATCC 35704]
          Length = 324

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 36/94 (38%), Gaps = 12/94 (12%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRL-GDILEEHIDDKSTISNKLWE 59
           + A +FG+PQ RER++ I  LN   +F+F   +    R   + LE+ + D   ++     
Sbjct: 164 LDAREFGLPQARERVFTISVLNGE-KFEFDDLIRTPMRNLQEFLEDDVPDIYDVTQP--- 219

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNTLSAR 93
                  +        G            T++ R
Sbjct: 220 -------SVLACIGEKGIRRATVIKDCAYTITTR 246


>gi|119488852|ref|ZP_01621814.1| NgoIM [Lyngbya sp. PCC 8106]
 gi|119455013|gb|EAW36155.1| NgoIM [Lyngbya sp. PCC 8106]
          Length = 385

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/92 (19%), Positives = 38/92 (41%), Gaps = 6/92 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +    FG+PQ R+R++I+   + +       PL    +   +L +   D   +  +  E 
Sbjct: 144 INPLHFGIPQNRDRVFILGTKSTTKN-----PLPNIEKYLVLLTQGDCDVLEMGVETLEK 198

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSA 92
             +     K   K + +G+ ++N   T  + A
Sbjct: 199 CLQ-PIVFKQQTKNYNWGIAYQNKMYTQEIPA 229


>gi|89243223|gb|ABD64771.1| Met1 [Volvox carteri f. nagariensis]
          Length = 2262

 Score = 47.3 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 1    MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLG 34
            + A  FGVPQ R+R +I   L   V  ++PTP  
Sbjct: 1920 LNAGHFGVPQSRKRTFIWAALPGEVLPEWPTPRH 1953


>gi|323650698|gb|ADX97433.1| M1.BspACI [Bacillus psychrodurans]
          Length = 320

 Score = 47.3 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 5/60 (8%)

Query: 1   MKACDFGVPQRRERLYIID-----FLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISN 55
           M A  +GVPQ R R Y +      F    +   FP    ++  +   +E+++     +S 
Sbjct: 144 MNAKYYGVPQNRNRWYCVGYDASQFSKIDIHNIFPEEENLETFIDSYIEKNVSQDYQMSK 203


>gi|242217704|ref|XP_002474649.1| predicted protein [Postia placenta Mad-698-R]
 gi|220726179|gb|EED80137.1| predicted protein [Postia placenta Mad-698-R]
          Length = 1157

 Score = 47.3 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDK 50
           ++A  +G PQ R R ++I   +      FP P    P L D L+    +K
Sbjct: 867 LQAAHYGTPQSRIRFFLIAARSGHPLPAFPQPTHDFP-LKDSLKLEFTNK 915


>gi|168207074|ref|ZP_02633079.1| Dcm [Clostridium perfringens E str. JGS1987]
 gi|170661488|gb|EDT14171.1| Dcm [Clostridium perfringens E str. JGS1987]
          Length = 339

 Score = 47.3 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 11/65 (16%), Positives = 22/65 (33%), Gaps = 4/65 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           +   ++     RER++I+          F+F         L  I E  +D+K    +   
Sbjct: 148 LSGINYNSAHSRERVFIVSIRKDIDNGSFEFKEGNDNIVTLESITESFVDEKYYCKDN-- 205

Query: 59  EGHQK 63
              + 
Sbjct: 206 SYLKN 210


>gi|86559667|ref|YP_473487.1| cytosine methyltransferase [Clostridium perfringens]
 gi|86475939|dbj|BAE79114.1| cytosine methyltransferase [Clostridium perfringens]
          Length = 314

 Score = 47.3 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE--FKFPTPLGIKPRLGDILEEHIDDKSTISNK 56
           +   ++     RER++I+          FKF         L  I E  +D+K    + 
Sbjct: 148 LSGINYNSAHSRERVFIVSIRKDIDNGSFKFKEGNDNLVTLESITENFVDEKYYCKDN 205


>gi|224438066|ref|ZP_03659005.1| DNA-cytosine methyltransferase [Helicobacter cinaedi CCUG 18818]
          Length = 342

 Score = 46.9 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 37/90 (41%), Gaps = 2/90 (2%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSV-EFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59
           + + DF + Q RER+Y +        +F F +    K  L + L    D+  +  ++ ++
Sbjct: 164 LNSLDFALAQARERVYFVGIRKDKKRDFSF-SQRMTKKALKEFLTPKQDNIFSRDSQSYQ 222

Query: 60  GHQKRKENNKIAGKGFGYGLFFENSATTNT 89
              +  EN    G+     +  ++    +T
Sbjct: 223 TFLRFLENKYNKGRFDLTQILDKDFLVLDT 252


>gi|209527672|ref|ZP_03276170.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
 gi|209491900|gb|EDZ92257.1| DNA-cytosine methyltransferase [Arthrospira maxima CS-328]
          Length = 429

 Score = 46.9 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 32/96 (33%), Gaps = 25/96 (26%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKF----------------------PTPLGIKPR 38
           + + ++GVPQ R R Y++  LN +  F                        P P     +
Sbjct: 148 LNSSNYGVPQNRVRAYMMGVLNQTPHFNLVSDLGAKDSHSYESGQLSLFSAPKPS---CK 204

Query: 39  LGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKG 74
           + DILE++       S +     +     N     G
Sbjct: 205 VRDILEDNPPHHYDCSAEFTTALRTFLRGNLEKLHG 240


>gi|145250405|ref|XP_001396716.1| C-5 cytosine methyltransferase DmtA [Aspergillus niger CBS 513.88]
 gi|134082235|emb|CAL00990.1| unnamed protein product [Aspergillus niger]
          Length = 613

 Score = 46.9 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 32/102 (31%), Gaps = 8/102 (7%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +K  D+GVPQ R RL II          FP      P  G      I+   +   +    
Sbjct: 450 LKCADYGVPQLRRRLVIIASGPGETLPPFPEATHGLPGSGLRDYVTINQVISRIPRGAPD 509

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSAR----YYKDG 98
           H       + A     +      +    T++      Y+  G
Sbjct: 510 HDVEGALQRSAIDRRPFNA----NRQARTITCGGGENYHPSG 547


>gi|323949009|gb|EGB44903.1| DNA adenine methylase [Escherichia coli H252]
          Length = 762

 Score = 46.9 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 22/112 (19%), Positives = 42/112 (37%), Gaps = 16/112 (14%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVE-----FKF--------PTPLGIKPRLGDILEEHI 47
           + A  FGV QRR R++++      ++     F+F        P+    +     I     
Sbjct: 201 LDAQYFGVAQRRRRVFVVASARTDLDPATILFEFEGVRRDIAPSRKKKEIASAIIANGAA 260

Query: 48  DDKSTISNKLWEGHQKRKENNKIAGKGFGYGLF--FENSATTNTLSARYYKD 97
               +++  L        ++ K     F    F  + +  T +T+ AR +KD
Sbjct: 261 ISGESLNPCLHADIPPGMKSTKA-VNAFRMAAFGEYIDDETASTVKARDFKD 311


>gi|294794108|ref|ZP_06759245.1| DNA (cytosine-5-)-methyltransferase [Veillonella sp. 3_1_44]
 gi|294455678|gb|EFG24050.1| DNA (cytosine-5-)-methyltransferase [Veillonella sp. 3_1_44]
          Length = 527

 Score = 46.9 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 25/87 (28%), Gaps = 10/87 (11%)

Query: 2   KACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGH 61
            A  FGVPQ R R  +I          +P      P   D L  +  + + +        
Sbjct: 317 NAEWFGVPQTRRRYIVIGIRKDL----YPNINPSLPGNPDTLNINTVEDAIMD------L 366

Query: 62  QKRKENNKIAGKGFGYGLFFENSATTN 88
              +   +   K   Y      S   N
Sbjct: 367 VSYEAGYEKDYKEIPYNSDDILSDYAN 393


>gi|328947038|ref|YP_004364375.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
 gi|328447362|gb|AEB13078.1| DNA-cytosine methyltransferase [Treponema succinifaciens DSM 2489]
          Length = 466

 Score = 46.9 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 3/50 (6%)

Query: 5   DFGVPQRRERLYIIDFLN---PSVEFKFPTPLGIKPRLGDILEEHIDDKS 51
           +FG+PQ R+R+YI+  L       +FKFP            + +  DD  
Sbjct: 173 NFGIPQHRKRIYIVGRLKSKGGLKDFKFPPHEEKVECNIKSVIDESDDDF 222


>gi|78778049|ref|YP_394364.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM
           1251]
 gi|78498589|gb|ABB45129.1| DNA (cytosine-5-)-methyltransferase [Sulfurimonas denitrificans DSM
           1251]
          Length = 435

 Score = 46.9 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 39/102 (38%), Gaps = 12/102 (11%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWE- 59
           + A D+G+PQRR R++I+ + N +     P     +    ++L +      T   K+ + 
Sbjct: 187 INASDYGMPQRRRRVFIMAYKNGTK----PYLNLQQKTPFEVLSKDGIFAKTFPIKMIQE 242

Query: 60  ---GHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDG 98
                 K  ++       F      +NS       + Y  DG
Sbjct: 243 DDIFSLKLSDDLVDITDNFNKNTSNKNSFY----DSGYMIDG 280


>gi|67540936|ref|XP_664242.1| hypothetical protein AN6638.2 [Aspergillus nidulans FGSC A4]
 gi|28208637|gb|AAO37378.1|AF428247_1 c5 cytosine methyltransferase DmtA [Emericella nidulans]
 gi|40738977|gb|EAA58167.1| hypothetical protein AN6638.2 [Aspergillus nidulans FGSC A4]
 gi|259480219|tpe|CBF71150.1| TPA: C5 cytosine methyltransferase DmtAPutative uncharacterized
           protein ; [Source:UniProtKB/TrEMBL;Acc:Q876R1]
           [Aspergillus nidulans FGSC A4]
          Length = 615

 Score = 46.9 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 21/102 (20%), Positives = 29/102 (28%), Gaps = 7/102 (6%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           +    +GVPQ R+RL II         + P P    P  G      I             
Sbjct: 453 LNCMWYGVPQSRKRLIIIASGPGESLPRLPRPTHGLPGSGLRDLTTISQAIRDIPTGSPD 512

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSAR----YYKDG 98
           H       +  G       F  N     T++      Y+  G
Sbjct: 513 HDV--VAARGRGVHNRRAPFDGN-RQARTITCGGGDNYHPSG 551


>gi|196047975|ref|ZP_03115153.1| C-5 cytosine-specific DNA methylase [Bacillus cereus 03BB108]
 gi|196021231|gb|EDX59960.1| C-5 cytosine-specific DNA methylase [Bacillus cereus 03BB108]
          Length = 471

 Score = 46.9 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 30/71 (42%), Gaps = 1/71 (1%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           ++ACD+G P  R+RL++I          +P P    P+  ++L   +    T +  +   
Sbjct: 166 LRACDYGAPTIRKRLFLIA-RCDGKPINWPKPTHGDPKSKEVLNGTLKPWRTAAEIIDWS 224

Query: 61  HQKRKENNKIA 71
            +     N+  
Sbjct: 225 LECPSIFNRKK 235


>gi|261420917|ref|YP_003254598.1| DNA-cytosine methyltransferase [Geobacillus sp. Y412MC61]
 gi|319768595|ref|YP_004134095.1| DNA-cytosine methyltransferase [Geobacillus sp. Y412MC52]
 gi|261377375|gb|ACX80116.1| DNA-cytosine methyltransferase [Geobacillus sp. Y412MC61]
 gi|317113461|gb|ADU95952.1| DNA-cytosine methyltransferase [Geobacillus sp. Y412MC52]
          Length = 370

 Score = 46.9 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 22/53 (41%), Gaps = 3/53 (5%)

Query: 5   DFGVPQRRERLYIIDFLNP-SVEFKFPTPL--GIKPRLGDILEEHIDDKSTIS 54
           ++GVPQ R R+ I+      +++FK P P          + +      +   +
Sbjct: 165 EYGVPQMRHRI