RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >gnl|CDD|143915 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase. Length = 319 Score = 83.9 bits (208), Expect = 8e-18 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 10/108 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV------EFKFPTPLGIKPRLGDILEE--HIDDKST 52 + A D+GVPQ RER++I+ N + EF FP P + D+LEE ++K Sbjct: 141 LNASDYGVPQNRERVFIVGIRNDLILNFPVPEFDFPKPSTATDTIRDLLEEPSLDENKYN 200 Query: 53 ISNKLWEGHQKRKENNKIAGKGFGYGLFF--ENSATTNTLSARYYKDG 98 +S+K E H++RK K G G+ Y L + S Y K G Sbjct: 201 LSDKFVENHERRKPTTKAPGGGYPYLLRNRIDKVEEGKGPSFTYRKSG 248 >gnl|CDD|30619 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair]. Length = 328 Score = 49.7 bits (118), Expect = 2e-07 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 1/100 (1%) Query: 3 ACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIK-PRLGDILEEHIDDKSTISNKLWEGH 61 A D+GVPQ RER++I+ F +++ + R + E ++ +++L+ Sbjct: 149 AADYGVPQSRERVFIVGFRRDNIDLDPNVLPPLPLGRKKTLKEALKNNDLPETDELYLSR 208 Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 R K K G L TLS RY GS I Sbjct: 209 DLRNHEAKSLPKNKGERLPSLRWGEALTLSRRYKGKGSYI 248 >gnl|CDD|73191 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology. Cytosine-specific DNA methylases are found both in prokaryotes and eukaryotes. DNA methylation, or the covalent addition of a methyl group to cytosine within the context of the CpG dinucleotide, has profound effects on the mammalian genome. These effects include transcriptional repression via inhibition of transcription factor binding or the recruitment of methyl-binding proteins and their associated chromatin remodeling factors, X chromosome inactivation, imprinting and the suppression of parasitic DNA sequences. DNA methylation is also essential for proper embryonic development and is an important player in both DNA repair and genome stability.. Length = 275 Score = 48.7 bits (116), Expect = 4e-07 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEF---KFPTPLGIKPRLGDILEEHIDDKSTIS 54 + A D+GVPQ RER++II + FP P K L DIL D+ + + Sbjct: 143 LNASDYGVPQNRERVFIIGIRKDLILNFFSPFPKPSEKKKTLKDILRIRDPDEPSPT 199 >gnl|CDD|33186 COG3379, COG3379, Uncharacterized conserved protein [Function unknown]. Length = 471 Score = 25.7 bits (56), Expect = 3.1 Identities = 21/97 (21%), Positives = 34/97 (35%), Gaps = 8/97 (8%) Query: 9 PQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDI--------LEEHIDDKSTISNKLWEG 60 P+R + + FL P P +K + + +E H +DK LWE Sbjct: 116 PKRIKGNLVSGFLTPDKSKAKAYPPELKDEIENTTGNEYVFDVEYHDEDKDIFIEDLWEN 175 Query: 61 HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKD 97 + RKE K + F T+ + +K Sbjct: 176 TESRKEVVKEYLSPKEWDCFGFVMIGTDRVHHALWKY 212 >gnl|CDD|147573 pfam05461, ApoL, Apolipoprotein L. Apo L belongs to the high density lipoprotein family that plays a central role in cholesterol transport. The cholesterol content of membranes is important in cellular processes such as modulating gene transcription and signal transduction both in the adult brain and during neurodevelopment. There are six apo L genes located in close proximity to each other on chromosome 22q12 in humans. 22q12 is a confirmed high-susceptibility locus for schizophrenia and close to the region associated with velocardiofacial syndrome that includes symptoms of schizophrenia. Length = 313 Score = 25.4 bits (56), Expect = 3.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Query: 37 PRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAG 72 PRL LEEHI +++++ + H+ +N +A Sbjct: 68 PRLKAELEEHIRKLRALADQVDKVHRGCTISNVVAS 103 >gnl|CDD|37765 KOG2554, KOG2554, KOG2554, Pseudouridylate synthase [Translation, ribosomal structure and biogenesis]. Length = 425 Score = 25.0 bits (54), Expect = 4.4 Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Query: 15 LYIIDFLNPSVEFKFPT-----PLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENN 68 LY DF +VE++ T I + L EH+ + S + N E + +N Sbjct: 315 LYDCDFHRENVEWRHDTESDQIAPKILKITWENLVEHLQNGSAMENIHEEVLGMAEFSN 373 >gnl|CDD|110864 pfam01903, CbiX, CbiX. The function of CbiX is uncertain, however it is found in cobalamin biosynthesis operons and so may have a related function. Some CbiX proteins contain a striking histidine-rich region at their C-terminus, which suggests that it might be involved in metal chelation. Length = 106 Score = 24.5 bits (54), Expect = 6.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 23 PSVEFKFPTPLGIKPRLGDILEE 45 P +E + PLG P L ++L E Sbjct: 84 PGIEVHYGRPLGPHPLLAELLAE 106 >gnl|CDD|133371 cd04171, SelB, SelB subfamily. SelB is an elongation factor needed for the co-translational incorporation of selenocysteine. Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin. In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu). It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons. In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence). The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation. Archaeal and animal mechanisms of selenocysteine incorporation are more complex. Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryotes, they do share a common feature. Unlike in E. coli, these SECIS elements are located in the 3' UTRs. This group contains bacterial SelBs, as well as, one from archaea. Length = 164 Score = 24.4 bits (54), Expect = 6.5 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Query: 3 ACDFGV-PQRRERLYIIDFLN 22 A D G+ PQ RE L I++ L Sbjct: 83 AADEGIMPQTREHLEILELLG 103 >gnl|CDD|146905 pfam04497, Pox_E2, Poxvirus E2 protein. This family of proteins is restricted to Poxviridae. It contains the proteins E2 and O1 which are uncharacterized. Length = 726 Score = 24.3 bits (53), Expect = 7.4 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Query: 8 VPQRRERLYIIDFLNPSV----EFK 28 P + + +ID+LN +V EFK Sbjct: 212 YPSSNDTIRVIDYLNDAVLSSEEFK 236 >gnl|CDD|48387 cd02140, Nitroreductase_4, Nitroreductase-like family 4. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.. Length = 192 Score = 24.4 bits (53), Expect = 7.7 Identities = 16/65 (24%), Positives = 26/65 (40%), Gaps = 11/65 (16%) Query: 37 PRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKGFGYG--LFFENSATTNTLSARY 94 +L DI+++ + + K+ G GYG LFFE+ A L ++ Sbjct: 56 EKLWDIVKDTL-------RAIVPAEAFAATKEKLDGFKAGYGTVLFFEDQAVVKGLQEKF 108 Query: 95 --YKD 97 Y D Sbjct: 109 PLYAD 113 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.139 0.419 Gapped Lambda K H 0.267 0.0710 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,298,968 Number of extensions: 59628 Number of successful extensions: 127 Number of sequences better than 10.0: 1 Number of HSP's gapped: 126 Number of HSP's successfully gapped: 10 Length of query: 101 Length of database: 6,263,737 Length adjustment: 68 Effective length of query: 33 Effective length of database: 4,794,325 Effective search space: 158212725 Effective search space used: 158212725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.5 bits)