RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI
[Candidatus Liberibacter asiaticus str. psy62]
         (101 letters)



>gnl|CDD|182476 PRK10458, PRK10458, DNA cytosine methylase; Provisional.
          Length = 467

 Score = 72.4 bits (178), Expect = 2e-14
 Identities = 41/112 (36%), Positives = 57/112 (50%), Gaps = 29/112 (25%)

Query: 9   PQRRERLYIIDF---LNPSVEFK-------FPTPLGIKPRLGDILEEHIDDKSTISNKLW 58
           PQ RER+ ++ F   LN   +F        +P     +P L ++L+  +D K  ++  LW
Sbjct: 275 PQHRERIVLVGFRRDLNLKADFTLRDISECYPAQ---RPTLAELLDPVVDAKYILTPVLW 331

Query: 59  E-------GHQKRKENNKIAGKGFGYGLFFEN--SATTNTLSARYYKDGSEI 101
           +        HQ +       G GFGYGL + N   + T TLSARYYKDGSEI
Sbjct: 332 KYLYRYAKKHQAK-------GNGFGYGLVYPNNPQSVTRTLSARYYKDGSEI 376


>gnl|CDD|161991 TIGR00675, dcm, DNA-methyltransferase (dcm).  All proteins in this
           family for which functions are known are DNA-cytosine
           methyltransferases. This family is based on the
           phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis,
           Stanford University).
          Length = 315

 Score = 68.9 bits (169), Expect = 2e-13
 Identities = 40/113 (35%), Positives = 59/113 (52%), Gaps = 13/113 (11%)

Query: 2   KACDFGVPQRRERLYIIDF--LNPSVEFKFPTP--LGIKPRLGDILEE--HIDDKSTISN 55
            A DFGVPQ RER+YI+ F   +  + F+FP P  +  K R+GD+L+    +++K  +S 
Sbjct: 141 NAKDFGVPQNRERIYIVGFRDFDDKLNFEFPKPIYVAKKKRIGDLLDLSVDLEEKYYLSE 200

Query: 56  KLWEGHQKRKEN-NKIAGKGFGYGLFFENSATTN---TLSARYY---KDGSEI 101
           +   G     EN  K  G G   G F+   + ++   TLSAR Y   K G  +
Sbjct: 201 EKKNGLLLLLENMRKKEGTGEQIGSFYNRESKSSIIRTLSARGYTFVKGGKSV 253


>gnl|CDD|185192 PRK15292, PRK15292, putative major fimbrial protein SthE;
           Provisional.
          Length = 365

 Score = 26.1 bits (57), Expect = 2.0
 Identities = 9/19 (47%), Positives = 13/19 (68%)

Query: 83  NSATTNTLSARYYKDGSEI 101
           N +TT  +SA YYK G+ +
Sbjct: 331 NMSTTLKISANYYKTGATV 349


>gnl|CDD|165782 PLN00217, PLN00217, predicted protein; Provisional.
          Length = 210

 Score = 25.6 bits (55), Expect = 2.8
 Identities = 13/40 (32%), Positives = 17/40 (42%)

Query: 30  PTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNK 69
           P    ++P   D    H D   T +  L EGHQK   + K
Sbjct: 119 PLNWTLRPEESDYSNTHTDSNRTRAANLREGHQKGSSDGK 158


>gnl|CDD|178334 PLN02733, PLN02733, phosphatidylcholine-sterol O-acyltransferase.
          Length = 440

 Score = 25.4 bits (56), Expect = 3.2
 Identities = 10/18 (55%), Positives = 11/18 (61%)

Query: 8   VPQRRERLYIIDFLNPSV 25
           VP  R  LY ID L+P V
Sbjct: 83  VPDDRYGLYAIDILDPDV 100


>gnl|CDD|132359 TIGR03316, ygeW, probable carbamoyltransferase YgeW.  Members of
          this protein family include the ygeW gene product of
          Escherichia coli. The function is unknown. Members show
          homology to ornithine carbamoyltransferase (TIGR00658)
          and aspartate carbamoyltransferase
          (carbamoyltransferase), and therefore may belong to the
          carbamoyltransferases in function. Members often are
          found in a large, conserved genomic region associated
          with purine catabolism.
          Length = 357

 Score = 25.0 bits (54), Expect = 4.1
 Identities = 9/29 (31%), Positives = 14/29 (48%), Gaps = 3/29 (10%)

Query: 62 QKRKENN---KIAGKGFGYGLFFENSATT 87
          ++ +  N   K+   G G  LF +NS  T
Sbjct: 28 KRLRALNISTKLFESGLGISLFRDNSTRT 56


>gnl|CDD|185636 PTZ00457, PTZ00457, acyl-CoA dehydrogenase; Provisional.
          Length = 520

 Score = 25.2 bits (55), Expect = 4.3
 Identities = 8/17 (47%), Positives = 12/17 (70%)

Query: 77  YGLFFENSATTNTLSAR 93
           YGLFF+ ++T   + AR
Sbjct: 373 YGLFFQRASTLQMMQAR 389


>gnl|CDD|179125 PRK00784, PRK00784, cobyric acid synthase; Provisional.
          Length = 488

 Score = 24.7 bits (55), Expect = 5.6
 Identities = 7/11 (63%), Positives = 10/11 (90%)

Query: 38  RLGDILEEHID 48
           RL D++EEH+D
Sbjct: 470 RLADLVEEHLD 480


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.318    0.139    0.419 

Gapped
Lambda     K      H
   0.267   0.0557    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 1,703,277
Number of extensions: 94919
Number of successful extensions: 169
Number of sequences better than 10.0: 1
Number of HSP's gapped: 164
Number of HSP's successfully gapped: 9
Length of query: 101
Length of database: 5,994,473
Length adjustment: 68
Effective length of query: 33
Effective length of database: 4,525,129
Effective search space: 149329257
Effective search space used: 149329257
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.4 bits)