BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI
[Candidatus Liberibacter asiaticus str. psy62]
         (101 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 101

 Score =  211 bits (537), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60
           MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG
Sbjct: 1   MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60

Query: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101
           HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI
Sbjct: 61  HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101


>gi|254780901|ref|YP_003065314.1| single-stranded-DNA-specific exonuclease protein [Candidatus
          Liberibacter asiaticus str. psy62]
          Length = 600

 Score = 26.9 bits (58), Expect = 0.080,   Method: Composition-based stats.
 Identities = 10/18 (55%), Positives = 11/18 (61%)

Query: 16 YIIDFLNPSVEFKFPTPL 33
          Y  DFLNPS+    P PL
Sbjct: 56 YAKDFLNPSIRLLMPDPL 73


>gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 199

 Score = 23.5 bits (49), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%)

Query: 6   FGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRK 65
             + + R R  I  F N ++E K P P  +KP +    ++ I  +  I+N     H+ + 
Sbjct: 119 IALLKERLRTDINTFDNTNLETKIPLPNNLKPNVCVKEKKLIPPRKNINNLKDTNHRLKI 178

Query: 66  ENNK 69
           +NN+
Sbjct: 179 KNNQ 182


>gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 223

 Score = 22.7 bits (47), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 18  IDFLNPSVEFKFPTPLGIKPRLGDILEE 45
           I  LN +++      L IKPR GDI+ +
Sbjct: 156 ILILNSAIQVNCGDRLLIKPRTGDIVAK 183


>gi|254780996|ref|YP_003065409.1| hypothetical protein CLIBASIA_04485 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 109

 Score = 21.9 bits (45), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 7/17 (41%), Positives = 10/17 (58%)

Query: 25 VEFKFPTPLGIKPRLGD 41
          V +  P P  I PR+G+
Sbjct: 61 VSYPLPAPQEITPRMGN 77


>gi|254780613|ref|YP_003065026.1| adenylosuccinate synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 432

 Score = 21.6 bits (44), Expect = 3.2,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 16/27 (59%)

Query: 30  PTPLGIKPRLGDILEEHIDDKSTISNK 56
           P P  +K + GD L+E   +  T++N+
Sbjct: 279 PFPTELKNQTGDFLKEVGKEFGTVTNR 305


>gi|254780814|ref|YP_003065227.1| DNA gyrase subunit B [Candidatus Liberibacter asiaticus str. psy62]
          Length = 803

 Score = 21.6 bits (44), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 15/34 (44%)

Query: 5   DFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR 38
           DF     + RL  + FLN SV+         +PR
Sbjct: 186 DFNYDTLQHRLRELSFLNSSVQISLIDKRSPEPR 219


>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 610

 Score = 20.0 bits (40), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 9/19 (47%), Positives = 14/19 (73%)

Query: 44  EEHIDDKSTISNKLWEGHQ 62
           E+ I+D++ ISN+  E HQ
Sbjct: 560 EQQINDQNLISNEGKEIHQ 578


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.318    0.139    0.419 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 73,275
Number of Sequences: 1233
Number of extensions: 2824
Number of successful extensions: 11
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of query: 101
length of database: 328,796
effective HSP length: 61
effective length of query: 40
effective length of database: 253,583
effective search space: 10143320
effective search space used: 10143320
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)
S2: 32 (16.9 bits)