>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.

Probab=98.42 E-value=2.2e-07 Score=74.11 Aligned_cols=58 Identities=29% Similarity=0.371 Sum_probs=53.6 Q ss_pred HHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHCCCCCEEEECCCCCEEEEEEECCCHHHH Q ss_conf 243333321047543055100238888987410466200000043232324123403567 Q gi|255764505|r 216 LFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRN 275 (341) Q Consensus 216 ~Ll~V~DiM~~~~~ip~V~~~~si~eal~~m~~~~~g~v~Vvd~~~~liGIITdgDlrR~ 275 (341) T Consensus 54 ~~~~V~d~m~~--~v~~i~~~~~v~dalr~~~~~~~~~l~VVD~~grlvGiI~~rdlLr~ 111 (111) T cd04603 54 ETLKVCEVYIV--PVPIVYCDSKVTDLLRIFRETEPPVVAVVDKEGKLVGTIYERELLRF 111 (111) T ss_pred HCCCHHHHHCC--CCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEEHHHHHCC T ss_conf 32438775156--77463899768999999874499889999389979999962551239

HHsearch alignment for GI: 255764505 and conserved domain: cd04603