HHsearch alignment for GI: 255764506 and conserved domain: PRK13258

>PRK13258 7-cyano-7-deazaguanine reductase; Provisional.
Probab=98.01  E-value=9e-05  Score=50.68  Aligned_cols=99  Identities=19%  Similarity=0.177  Sum_probs=78.4

Q ss_pred             CCCHHHHHHHHCCCCCCCCCCEEEECCEEEEEECCCCEEEEEEEEEEEEECCCCCCCHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             65312344320256655667628961805877211002346557899996388543467799999998315426689999
Q gi|255764506|r   61 QIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTM  140 (205)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~~~~mVvv~~I~f~S~CEHHllPf~G~~~IaYiP~~~viGlSKl~Riv~~~a~RlQ~QErlT~  140 (205)
T Consensus         9 ~~p~~~~Le~f~n~~~~-~~y~i~~~~~EFtslCPvTgQPDfa~i~I~Y~p~~~~vE~KSLk~Yl~sfRn~~~FHE~~~~   87 (127)
T PRK13258          9 FSPEPEVLETFPNPHPG-RDYTIRFTCPEFTSLCPKTGQPDFATIVIDYIPDKKCVESKSLKLYLFSFRNHGIFHEDCTN   87 (127)
T ss_pred             CCCCHHHHCCCCCCCCC-CCEEEEEECCCEEECCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             99798991036899999-77899994575375277879995599999980798634789999999999861447999999


Q ss_pred             HHHHHHHHHCCCCCEEEEEE
Q ss_conf             99999997327384799999
Q gi|255764506|r  141 QIAHAIESSTDSKGVAVLIE  160 (205)
Q Consensus       141 qIa~~l~~~l~~~gv~V~i~  160 (205)
T Consensus        88 ~I~~dl~~~~~P~~l~V~~~  107 (127)
T PRK13258         88 RILDDLVALLDPKWLRVGGD  107 (127)
T ss_pred             HHHHHHHHHCCCCEEEEEEE
T ss_conf             99999997559739999999