HHsearch results for GI: 255764506 and protein with PDBid: 3bp1_A

>3bp1_A NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha-beta structure, structural genomics, PSI-2; HET: MSE GUN; 1.53A {Vibrio cholerae o1 biovar eltor str}
Probab=94.05  E-value=0.23  Score=28.18  Aligned_cols=70  Identities=21%  Similarity=0.334  Sum_probs=61.6

Q ss_pred             EEEEECCCCEEEEEEEEEEEEECCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             587721100234655789999638854346779999999831542668999999999997327384799999
Q gi|255764506|r   89 SFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIE  160 (205)
Q Consensus        89 ~f~S~CEHHllPf~G~~~IaYiP~~~viGlSKl~Riv~~~a~RlQ~QErlT~qIa~~l~~~l~~~gv~V~i~  160 (205)
                      -|.|.|.--=+|=+|.+.|-|.|++  +-..-|-+.+--|-..---+|..+.+|...|.+.++|.-..|...
T Consensus       192 lfrS~CPvT~QPD~a~i~I~y~~~~--~~~~sL~~Yl~SfR~~~~FhE~~ve~If~dl~~~~~p~~l~V~~~  261 (290)
T 3bp1_A          192 LLKSNCLITNQPDWGSVEIAYHGAK--MNREALLRYLVSFREHNEFHEQCVERIFTDIMRYCQPQSLTVYAR  261 (290)
T ss_dssp             EEEEC------CEEEEEEEEEEEEE--ECHHHHHHHHHTTTTCCCCHHHHHHHHHHHHHHHHCCSEEEEEEE
T ss_pred             CEECCCCCCCCCCEEEEEEEECCCC--CCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             7132698989986069999981752--489999999999972275799999999999998549758999999