BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764506|ref|YP_003065297.2| GTP cyclohydrolase I
[Candidatus Liberibacter asiaticus str. psy62]
         (205 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764506|ref|YP_003065297.2| GTP cyclohydrolase I [Candidatus Liberibacter asiaticus str. psy62]
 gi|254547857|gb|ACT57357.2| GTP cyclohydrolase I [Candidatus Liberibacter asiaticus str. psy62]
          Length = 205

 Score =  426 bits (1096), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYK 60
           MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYK
Sbjct: 1   MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYK 60

Query: 61  QIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSK 120
           QIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSK
Sbjct: 61  QIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSK 120

Query: 121 LVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVT 180
           LVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVT
Sbjct: 121 LVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVT 180

Query: 181 TAFTGEFSRDKGKTDFFLKMTHNQR 205
           TAFTGEFSRDKGKTDFFLKMTHNQR
Sbjct: 181 TAFTGEFSRDKGKTDFFLKMTHNQR 205


>gi|315122696|ref|YP_004063185.1| GTP cyclohydrolase I [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496098|gb|ADR52697.1| GTP cyclohydrolase I [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 195

 Score =  326 bits (836), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 173/195 (88%)

Query: 11  MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR 70
           MK K PT EEAKEAIRVILRWIGDDP+REGLKDTP+RVIKSYKELF+GY+Q    QDTSR
Sbjct: 1   MKSKNPTSEEAKEAIRVILRWIGDDPEREGLKDTPERVIKSYKELFSGYEQDFIVQDTSR 60

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
           F+FGE S Y DMVLIKDISF SYCEHHILPI+GKIHLAYIPKK VIGLSKL+RILE+YSR
Sbjct: 61  FYFGEVSNYGDMVLIKDISFSSYCEHHILPIFGKIHLAYIPKKRVIGLSKLIRILEIYSR 120

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQIQERLTMQIA+ I +  DSKGVAVLIEGQHMCMSMRGIKR+GLTTVTT+FTGEF+ +
Sbjct: 121 RLQIQERLTMQIANEIGNVADSKGVAVLIEGQHMCMSMRGIKREGLTTVTTSFTGEFNSN 180

Query: 191 KGKTDFFLKMTHNQR 205
           K   D F++M +N+R
Sbjct: 181 KENKDIFIRMINNKR 195


>gi|222086054|ref|YP_002544586.1| GTP cyclohydrolase I [Agrobacterium radiobacter K84]
 gi|221723502|gb|ACM26658.1| GTP cyclohydrolase I [Agrobacterium radiobacter K84]
          Length = 207

 Score =  227 bits (579), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 141/192 (73%), Gaps = 2/192 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           L +P+ +EA++A+RV+LRW GDDP REGL DTP+RV K+Y+ELFAGY   P  +D     
Sbjct: 18  LDRPSQKEAEDAVRVLLRWAGDDPQREGLLDTPERVAKAYRELFAGYDMSP--EDVLGRT 75

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E S Y DMVL++DI FFS+CEHH++PI GK H+AY+P   V+GLSK+ R +E++ RRL
Sbjct: 76  FEEVSGYDDMVLVRDIPFFSHCEHHMVPIIGKAHVAYLPNGRVLGLSKIARTVEIFGRRL 135

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           Q QE +T QIA+AI+ S   +GVAV+IE +HMCM+MRG+++ G +T+TT FTG F  D  
Sbjct: 136 QTQEAMTAQIANAIDDSLRPRGVAVMIEAEHMCMAMRGVQKQGSSTLTTTFTGAFKADPA 195

Query: 193 KTDFFLKMTHNQ 204
           +   F+ M  ++
Sbjct: 196 EQVRFMTMVRSR 207


>gi|83313322|ref|YP_423586.1| GTP cyclohydrolase I [Magnetospirillum magneticum AMB-1]
 gi|82948163|dbj|BAE53027.1| GTP cyclohydrolase I [Magnetospirillum magneticum AMB-1]
          Length = 231

 Score =  222 bits (565), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 135/193 (69%), Gaps = 2/193 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           +L KP+ EEA+EA+R +LRW GDDPDREGL  TPDRV+++Y+E F+GY Q PT  +    
Sbjct: 33  RLDKPSREEAEEAVRTLLRWAGDDPDREGLVGTPDRVVRAYEEFFSGYDQDPT--EILHR 90

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   Y +MVL++DI   S+CEHH++PI GK H+AY+P + V+G+SKL R++E+YSRR
Sbjct: 91  TFEETDGYDEMVLLRDIRLESHCEHHVVPIIGKAHVAYLPNRRVVGISKLARVVEIYSRR 150

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE+LT QIA+ I      KGVAV+IE  H CM+ RGI + G+T VT+   G F  D 
Sbjct: 151 LQIQEKLTAQIANTINDVLQPKGVAVVIEAAHQCMTTRGIHKPGVTMVTSRMLGAFREDP 210

Query: 192 GKTDFFLKMTHNQ 204
                F+ + HNQ
Sbjct: 211 ATRREFMALIHNQ 223


>gi|46201231|ref|ZP_00208021.1| COG0302: GTP cyclohydrolase I [Magnetospirillum magnetotacticum
           MS-1]
          Length = 219

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 134/193 (69%), Gaps = 2/193 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           +L KP+ EEA+EA+R +LRW GDDPDREGL  TPDRV+++Y+E F+GY   PT  +    
Sbjct: 21  RLAKPSREEAEEAVRTLLRWAGDDPDREGLVGTPDRVVRAYEEFFSGYDLDPT--EILHR 78

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   Y +MVL++DI   S+CEHH++PI GK H+AY+P + V+G+SKL R++E+Y+RR
Sbjct: 79  TFEETDGYDEMVLLRDIRLESHCEHHVVPIIGKAHVAYLPNRRVVGISKLARVVEIYARR 138

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE+LT QIA+ I      KGVAV+IE  H CM+ RGI + G+T VT+   G F  D 
Sbjct: 139 LQIQEKLTAQIANTINDVLQPKGVAVVIEAAHQCMTTRGIHKPGVTMVTSRMLGAFRDDP 198

Query: 192 GKTDFFLKMTHNQ 204
                F+ + HNQ
Sbjct: 199 ATRREFMALIHNQ 211


>gi|319405746|emb|CBI79369.1| GTP cyclohydrolase I [Bartonella sp. AR 15-3]
          Length = 204

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 144/203 (70%), Gaps = 4/203 (1%)

Query: 1   MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYK 60
           MK   T +F  K KKP++EE K AI  +L WIG+DP REGL +TP RV K+Y+ELFAGY 
Sbjct: 5   MKGGATNLFLSKQKKPSIEEVKVAIHTLLLWIGEDPKREGLLNTPSRVAKAYRELFAGYT 64

Query: 61  Q-IPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLS 119
           + +    DT    F E S Y + +++K+ISF+S+CEHH+LPI G+ H+AY+P K V+GLS
Sbjct: 65  ESVKEILDTV---FEEVSGYNEPIILKNISFYSHCEHHMLPIIGRAHIAYLPDKKVVGLS 121

Query: 120 KLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTV 179
           K+ R+++V+SRRLQ QE +T QI  A+++    +G+AV+IE +HMCM MRGI++ G TT+
Sbjct: 122 KIARVVDVFSRRLQTQENMTAQIVDALKTHLKPRGIAVMIEAEHMCMGMRGIRKQGATTI 181

Query: 180 TTAFTGEFSRDKGKTDFFLKMTH 202
           TT+F G +  ++   D F+ + H
Sbjct: 182 TTSFHGYYQSNQMAQDSFMSLIH 204


>gi|240850677|ref|YP_002972077.1| GTP cyclohydrolase I [Bartonella grahamii as4aup]
 gi|240267800|gb|ACS51388.1| GTP cyclohydrolase I [Bartonella grahamii as4aup]
          Length = 206

 Score =  214 bits (546), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 93/187 (49%), Positives = 139/187 (74%), Gaps = 2/187 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K+P++EE +EAIR +L WIG++P+REGL DTP R+ K+Y+ELF+GY Q  + ++T    F
Sbjct: 18  KRPSIEEVEEAIRTLLLWIGENPNREGLLDTPRRIAKAYRELFSGYSQ--SVKETLGTVF 75

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E S Y + V++K+I F+S+CEHH++PI GK H+AY+P + ++GLSK+VR+++ +SRRLQ
Sbjct: 76  EEVSGYNEAVIVKNIPFYSHCEHHMIPIIGKAHIAYLPNEKIVGLSKIVRVVDTFSRRLQ 135

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T Q+AHA+++     GVAVLIE +HMCM+MRGI++ G TT+T  F G + +D   
Sbjct: 136 TQEAMTAQVAHALKTYLKPHGVAVLIEAEHMCMAMRGIQKQGSTTITKNFHGYYEKDHVA 195

Query: 194 TDFFLKM 200
              F+ M
Sbjct: 196 QAHFMMM 202


>gi|110633358|ref|YP_673566.1| GTP cyclohydrolase I [Mesorhizobium sp. BNC1]
 gi|123353800|sp|Q11JM4|GCH1_MESSB RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|110284342|gb|ABG62401.1| GTP cyclohydrolase I [Chelativorans sp. BNC1]
          Length = 222

 Score =  214 bits (544), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 135/191 (70%), Gaps = 2/191 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA+ A+R +LRW GD+PDREGLK+TP RV+K+Y+ELF GY   P  +    F   
Sbjct: 32  RPSREEAEAAVRTLLRWAGDNPDREGLKETPARVVKAYQELFGGYDLCPAEELGRTFE-- 89

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y+DMVL+KDI F S+CEHH++PI GK H+ Y+P   V+GLSK+ R++++++RRLQ 
Sbjct: 90  EVAGYEDMVLVKDIPFHSHCEHHMVPIVGKAHVGYLPDGKVVGLSKIARVVDIFARRLQT 149

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA AI++     GVAV++E +HMCM+MRG+++ G +T+TT FTG F       
Sbjct: 150 QEAITAQIAGAIQNVLQPLGVAVMVEAEHMCMAMRGVRKQGASTLTTTFTGAFKTRPEDQ 209

Query: 195 DFFLKMTHNQR 205
             F+ M  + R
Sbjct: 210 ARFITMVRDSR 220


>gi|114706243|ref|ZP_01439145.1| GTP cyclohydrolase I protein [Fulvimarina pelagi HTCC2506]
 gi|114538104|gb|EAU41226.1| GTP cyclohydrolase I protein [Fulvimarina pelagi HTCC2506]
          Length = 245

 Score =  214 bits (544), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 98/186 (52%), Positives = 134/186 (72%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P   EA+EA+R +LRW+G+DP REGL +TP RV+K+Y+ELF GYKQ     D     F 
Sbjct: 57  RPDRVEAEEAVRTLLRWMGEDPSREGLLETPARVVKAYEELFGGYKQ--DAADILGRTFE 114

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           + S Y+DMVL+KDI F S+CEHH++PI GK H+AY+P   V+GLSK+ R++++Y RRLQ 
Sbjct: 115 DVSGYEDMVLVKDIDFHSHCEHHMVPIIGKAHVAYVPNGRVLGLSKIARLVDIYGRRLQT 174

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA A++      GVAV+I+ +H+CMSMRGI+    TT+TTAF GEF  DK  +
Sbjct: 175 QESMTAQIADAMQRLLQPSGVAVMIDAEHLCMSMRGIRSKDATTITTAFNGEFKSDKELS 234

Query: 195 DFFLKM 200
             F+K+
Sbjct: 235 RRFMKL 240


>gi|254719147|ref|ZP_05180958.1| GTP cyclohydrolase I [Brucella sp. 83/13]
 gi|265984141|ref|ZP_06096876.1| GTP cyclohydrolase I [Brucella sp. 83/13]
 gi|306838139|ref|ZP_07470995.1| GTP cyclohydrolase I [Brucella sp. NF 2653]
 gi|264662733|gb|EEZ32994.1| GTP cyclohydrolase I [Brucella sp. 83/13]
 gi|306406729|gb|EFM62952.1| GTP cyclohydrolase I [Brucella sp. NF 2653]
          Length = 213

 Score =  214 bits (544), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 133/174 (76%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+   + +GVAV+IE +HMCM+MRGI++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSIQRILEPRGVAVMIEAEHMCMAMRGIRKQGSSTITTTFTGDF 197


>gi|163868453|ref|YP_001609662.1| GTP cyclohydrolase I [Bartonella tribocorum CIP 105476]
 gi|161018109|emb|CAK01667.1| GTP cyclohydrolase I [Bartonella tribocorum CIP 105476]
          Length = 206

 Score =  213 bits (542), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 91/190 (47%), Positives = 138/190 (72%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K+P++EE +EAIR +L W+G++P REGL +TP R+ K+Y ELF GY+Q  + ++T    F
Sbjct: 18  KRPSIEEVEEAIRTLLLWVGENPRREGLLETPKRIAKAYHELFNGYRQ--SVEETLGTVF 75

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E S Y + V++K+I F+S+CEHH++PI GK H+AY+P   ++GLSK+ R+++++SRRLQ
Sbjct: 76  EEVSGYNESVIVKNIPFYSHCEHHMIPIIGKAHIAYLPDTKIVGLSKIARVVDIFSRRLQ 135

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T Q+AHA+E     +GVAVLIE +HMCM+MRGI++ G TT+T  F G + +D+  
Sbjct: 136 TQEAMTAQVAHALEMHLKPRGVAVLIEAEHMCMAMRGIQKQGSTTITKKFHGYYEKDQAA 195

Query: 194 TDFFLKMTHN 203
              F+ M  +
Sbjct: 196 QAHFMMMVQS 205


>gi|220926914|ref|YP_002502216.1| GTP cyclohydrolase I [Methylobacterium nodulans ORS 2060]
 gi|219951521|gb|ACL61913.1| GTP cyclohydrolase I [Methylobacterium nodulans ORS 2060]
          Length = 219

 Score =  213 bits (541), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 142/192 (73%), Gaps = 2/192 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++PT +EA+ A+R ++RW GDDP+REGL++TP RV ++Y+++F GY+Q PT  +     F
Sbjct: 30  ERPTRQEAEAAVRTLIRWAGDDPEREGLRETPQRVARAYEQIFGGYRQDPT--NILDRVF 87

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y D+VL++DI F S+CEHH++P  GK H+AY P++ V+GLSKL R+++ ++RRLQ
Sbjct: 88  EEVEGYGDIVLVRDIPFHSHCEHHMVPFIGKAHIAYYPRRGVVGLSKLARVVDAFARRLQ 147

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T QIA  I+S  + +GVAV++E +H+CM+MRG+++ G++T+TT FTG F +D  +
Sbjct: 148 TQETMTAQIAETIDSVLNPRGVAVMVEAEHLCMAMRGVQKAGVSTLTTQFTGVFKQDPHE 207

Query: 194 TDFFLKMTHNQR 205
              FL +  +QR
Sbjct: 208 QVRFLTLVRDQR 219


>gi|256369502|ref|YP_003107010.1| GTP cyclohydrolase I [Brucella microti CCM 4915]
 gi|255999662|gb|ACU48061.1| GTP cyclohydrolase I [Brucella microti CCM 4915]
          Length = 213

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 132/174 (75%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+     +GVAV+IE +HMCM+MRGI++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRGIRKQGSSTITTTFTGDF 197


>gi|256061161|ref|ZP_05451314.1| GTP cyclohydrolase I [Brucella neotomae 5K33]
 gi|261325166|ref|ZP_05964363.1| GTP cyclohydrolase I [Brucella neotomae 5K33]
 gi|261301146|gb|EEY04643.1| GTP cyclohydrolase I [Brucella neotomae 5K33]
          Length = 213

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 132/174 (75%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W+G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWVGEDPDREGLLETPKRVTKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+     +GVAV+IE +HMCM+MR I++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF 197


>gi|319404304|emb|CBI77897.1| GTP cyclohydrolase I [Bartonella rochalimae ATCC BAA-1498]
          Length = 204

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 141/195 (72%), Gaps = 2/195 (1%)

Query: 6   TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT 65
           T  F  + KKP+VEE + AI  +L WIG++P+REGL DTP RV K+Y+ELF+GY +  + 
Sbjct: 10  TNSFFSEQKKPSVEEVEMAIHTLLLWIGENPNREGLLDTPSRVAKAYRELFSGYNE--SV 67

Query: 66  QDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRIL 125
           ++     F E S Y + V++K+ISF+S+CEHH+LPI GK H+AY+P K V+GLSK+ RI+
Sbjct: 68  KEILATVFEEVSGYSEPVILKNISFYSHCEHHMLPIIGKAHVAYLPDKKVVGLSKIARIV 127

Query: 126 EVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           +V+SRRLQ QE +T QI  A+++    +G+AV+IE +HMCM MRGI++ G TT+TT+F G
Sbjct: 128 DVFSRRLQTQETMTAQIVDALKTHLKPRGIAVVIEAEHMCMGMRGIRKQGATTITTSFHG 187

Query: 186 EFSRDKGKTDFFLKM 200
            +  ++   D F+ +
Sbjct: 188 YYQTNQMAQDSFMSL 202


>gi|306841802|ref|ZP_07474486.1| GTP cyclohydrolase I [Brucella sp. BO2]
 gi|306843947|ref|ZP_07476542.1| GTP cyclohydrolase I [Brucella sp. BO1]
 gi|306275702|gb|EFM57426.1| GTP cyclohydrolase I [Brucella sp. BO1]
 gi|306288116|gb|EFM59508.1| GTP cyclohydrolase I [Brucella sp. BO2]
          Length = 213

 Score =  211 bits (538), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 132/174 (75%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+     +GVAV+IE +HMCM+MRGI++ G +T+TT F+G+F
Sbjct: 144 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRGIRKQGSSTITTTFSGDF 197


>gi|323138245|ref|ZP_08073317.1| GTP cyclohydrolase I [Methylocystis sp. ATCC 49242]
 gi|322396497|gb|EFX99026.1| GTP cyclohydrolase I [Methylocystis sp. ATCC 49242]
          Length = 233

 Score =  211 bits (536), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 135/192 (70%), Gaps = 2/192 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++PT EEA+ A+R +LRW GDDP+REGL +TP RV+K+Y+E F GY++    +  SR  F
Sbjct: 44  ERPTREEAEAAVRTLLRWAGDDPNREGLLETPRRVVKAYEEFFKGYQES-ADEVLSRI-F 101

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y+D+VL++DI F S+CEHH++P  GK H+AY P   V+GLSKL R+++V++RRLQ
Sbjct: 102 EEVEGYEDLVLVRDIPFTSHCEHHVVPFVGKAHIAYYPTGGVVGLSKLARLVDVFARRLQ 161

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T QIA AIE   + +GVAVLIE +HMCMSMRG+ + G +TVT  F+G F  D G+
Sbjct: 162 TQEAMTAQIATAIEEHLNPRGVAVLIEAEHMCMSMRGVLKQGSSTVTVQFSGVFRDDPGQ 221

Query: 194 TDFFLKMTHNQR 205
              F  +    R
Sbjct: 222 QAHFYTLLRGAR 233


>gi|17987193|ref|NP_539827.1| GTP cyclohydrolase I [Brucella melitensis bv. 1 str. 16M]
 gi|62289991|ref|YP_221784.1| GTP cyclohydrolase I [Brucella abortus bv. 1 str. 9-941]
 gi|82699919|ref|YP_414493.1| GTP cyclohydrolase I [Brucella melitensis biovar Abortus 2308]
 gi|189024233|ref|YP_001935001.1| GTP cyclohydrolase I [Brucella abortus S19]
 gi|225852576|ref|YP_002732809.1| GTP cyclohydrolase I [Brucella melitensis ATCC 23457]
 gi|254689299|ref|ZP_05152553.1| GTP cyclohydrolase I [Brucella abortus bv. 6 str. 870]
 gi|254693783|ref|ZP_05155611.1| GTP cyclohydrolase I [Brucella abortus bv. 3 str. Tulya]
 gi|254697435|ref|ZP_05159263.1| GTP cyclohydrolase I [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730333|ref|ZP_05188911.1| GTP cyclohydrolase I [Brucella abortus bv. 4 str. 292]
 gi|256044734|ref|ZP_05447638.1| GTP cyclohydrolase I [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113624|ref|ZP_05454444.1| GTP cyclohydrolase I [Brucella melitensis bv. 3 str. Ether]
 gi|256257549|ref|ZP_05463085.1| GTP cyclohydrolase I [Brucella abortus bv. 9 str. C68]
 gi|256263933|ref|ZP_05466465.1| GTP cyclohydrolase I [Brucella melitensis bv. 2 str. 63/9]
 gi|260545259|ref|ZP_05821000.1| GTP cyclohydrolase I [Brucella abortus NCTC 8038]
 gi|260564077|ref|ZP_05834563.1| GTP cyclohydrolase I [Brucella melitensis bv. 1 str. 16M]
 gi|260754811|ref|ZP_05867159.1| GTP cyclohydrolase I [Brucella abortus bv. 6 str. 870]
 gi|260758033|ref|ZP_05870381.1| GTP cyclohydrolase I [Brucella abortus bv. 4 str. 292]
 gi|260761856|ref|ZP_05874199.1| GTP cyclohydrolase I [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883829|ref|ZP_05895443.1| GTP cyclohydrolase I [Brucella abortus bv. 9 str. C68]
 gi|261214062|ref|ZP_05928343.1| GTP cyclohydrolase I [Brucella abortus bv. 3 str. Tulya]
 gi|265991156|ref|ZP_06103713.1| GTP cyclohydrolase I [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994992|ref|ZP_06107549.1| GTP cyclohydrolase I [Brucella melitensis bv. 3 str. Ether]
 gi|297248391|ref|ZP_06932109.1| GTP cyclohydrolase I [Brucella abortus bv. 5 str. B3196]
 gi|23821611|sp|Q8YH94|GCH1_BRUME RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|75496788|sp|Q57D61|GCH1_BRUAB RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|123547047|sp|Q2YQ03|GCH1_BRUA2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|229487625|sp|B2S5T0|GCH1_BRUA1 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|254791035|sp|C0RJ47|GCH1_BRUMB RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|17982862|gb|AAL52091.1| gtp cyclohydrolase i [Brucella melitensis bv. 1 str. 16M]
 gi|62196123|gb|AAX74423.1| FolE, GTP cyclohydrolase I [Brucella abortus bv. 1 str. 9-941]
 gi|82616020|emb|CAJ11053.1| GTP cyclohydrolase I [Brucella melitensis biovar Abortus 2308]
 gi|189019805|gb|ACD72527.1| GTP cyclohydrolase I [Brucella abortus S19]
 gi|225640941|gb|ACO00855.1| GTP cyclohydrolase I [Brucella melitensis ATCC 23457]
 gi|260096666|gb|EEW80541.1| GTP cyclohydrolase I [Brucella abortus NCTC 8038]
 gi|260154093|gb|EEW89185.1| GTP cyclohydrolase I [Brucella melitensis bv. 1 str. 16M]
 gi|260668351|gb|EEX55291.1| GTP cyclohydrolase I [Brucella abortus bv. 4 str. 292]
 gi|260672288|gb|EEX59109.1| GTP cyclohydrolase I [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674919|gb|EEX61740.1| GTP cyclohydrolase I [Brucella abortus bv. 6 str. 870]
 gi|260873357|gb|EEX80426.1| GTP cyclohydrolase I [Brucella abortus bv. 9 str. C68]
 gi|260915669|gb|EEX82530.1| GTP cyclohydrolase I [Brucella abortus bv. 3 str. Tulya]
 gi|262766105|gb|EEZ11894.1| GTP cyclohydrolase I [Brucella melitensis bv. 3 str. Ether]
 gi|263001940|gb|EEZ14515.1| GTP cyclohydrolase I [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094075|gb|EEZ17997.1| GTP cyclohydrolase I [Brucella melitensis bv. 2 str. 63/9]
 gi|297175560|gb|EFH34907.1| GTP cyclohydrolase I [Brucella abortus bv. 5 str. B3196]
 gi|326409098|gb|ADZ66163.1| GTP cyclohydrolase I [Brucella melitensis M28]
 gi|326538802|gb|ADZ87017.1| GTP cyclohydrolase I [Brucella melitensis M5-90]
          Length = 213

 Score =  210 bits (535), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 131/174 (75%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+     +GVAV+IE +HMCM+MR I++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF 197


>gi|148560087|ref|YP_001259007.1| GTP cyclohydrolase I [Brucella ovis ATCC 25840]
 gi|166218212|sp|A5VQL0|GCH1_BRUO2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|148371344|gb|ABQ61323.1| GTP cyclohydrolase I [Brucella ovis ATCC 25840]
          Length = 213

 Score =  210 bits (535), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 131/174 (75%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W+G+DPDREGL +TP RV K+Y+ELF GY   P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWVGEDPDREGLLETPKRVAKAYQELFGGYSGSP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+     +GVAV+IE +HMCM+MR I++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF 197


>gi|254701822|ref|ZP_05163650.1| GTP cyclohydrolase I [Brucella suis bv. 5 str. 513]
 gi|261752379|ref|ZP_05996088.1| GTP cyclohydrolase I [Brucella suis bv. 5 str. 513]
 gi|261742132|gb|EEY30058.1| GTP cyclohydrolase I [Brucella suis bv. 5 str. 513]
          Length = 213

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 131/174 (75%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+     +GVAV+IE +HMCM+MR I++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF 197


>gi|163843341|ref|YP_001627745.1| GTP cyclohydrolase I [Brucella suis ATCC 23445]
 gi|189045184|sp|B0CGM4|GCH1_BRUSI RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|163674064|gb|ABY38175.1| GTP cyclohydrolase I [Brucella suis ATCC 23445]
          Length = 213

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 131/174 (75%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKPEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+     +GVAV+IE +HMCM+MR I++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF 197


>gi|170744364|ref|YP_001773019.1| GTP cyclohydrolase I [Methylobacterium sp. 4-46]
 gi|229487976|sp|B0U881|GCH1_METS4 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|168198638|gb|ACA20585.1| GTP cyclohydrolase I [Methylobacterium sp. 4-46]
          Length = 219

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 144/200 (72%), Gaps = 2/200 (1%)

Query: 6   TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT 65
           TG      ++PT +EA+ A+R ++RW GDDP+REGL++TP RV ++Y+++F GY+Q PT 
Sbjct: 22  TGRPERVTERPTRQEAEAAVRTLIRWAGDDPEREGLRETPQRVARAYEQIFGGYRQEPT- 80

Query: 66  QDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRIL 125
               R  F E   Y D+VL++DI F S+CEHH++P  G+ H+AY P++ V+GLSKL R++
Sbjct: 81  HILDRV-FEEVEGYGDIVLVRDIPFHSHCEHHMVPFIGRAHIAYYPRRGVVGLSKLARVV 139

Query: 126 EVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           + ++RRLQ QE +T QIA  I++  + +GVAV++E +H+CM+MRG+++ G++T+TT FTG
Sbjct: 140 DAFARRLQTQETMTAQIADTIDAVLNPRGVAVMVEAEHLCMAMRGVQKAGVSTLTTQFTG 199

Query: 186 EFSRDKGKTDFFLKMTHNQR 205
            F +D  +   FL +  +QR
Sbjct: 200 VFKQDPHEQVRFLTLVRDQR 219


>gi|254710155|ref|ZP_05171966.1| GTP cyclohydrolase I [Brucella pinnipedialis B2/94]
 gi|256031650|ref|ZP_05445264.1| GTP cyclohydrolase I [Brucella pinnipedialis M292/94/1]
 gi|256159794|ref|ZP_05457537.1| GTP cyclohydrolase I [Brucella ceti M490/95/1]
 gi|256255052|ref|ZP_05460588.1| GTP cyclohydrolase I [Brucella ceti B1/94]
 gi|260168780|ref|ZP_05755591.1| GTP cyclohydrolase I [Brucella sp. F5/99]
 gi|261222243|ref|ZP_05936524.1| GTP cyclohydrolase I [Brucella ceti B1/94]
 gi|261317709|ref|ZP_05956906.1| GTP cyclohydrolase I [Brucella pinnipedialis B2/94]
 gi|261758261|ref|ZP_06001970.1| GTP cyclohydrolase I [Brucella sp. F5/99]
 gi|265988742|ref|ZP_06101299.1| GTP cyclohydrolase I [Brucella pinnipedialis M292/94/1]
 gi|265998207|ref|ZP_06110764.1| GTP cyclohydrolase I [Brucella ceti M490/95/1]
 gi|260920827|gb|EEX87480.1| GTP cyclohydrolase I [Brucella ceti B1/94]
 gi|261296932|gb|EEY00429.1| GTP cyclohydrolase I [Brucella pinnipedialis B2/94]
 gi|261738245|gb|EEY26241.1| GTP cyclohydrolase I [Brucella sp. F5/99]
 gi|262552675|gb|EEZ08665.1| GTP cyclohydrolase I [Brucella ceti M490/95/1]
 gi|264660939|gb|EEZ31200.1| GTP cyclohydrolase I [Brucella pinnipedialis M292/94/1]
          Length = 213

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 131/174 (75%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+     +GVAV+IE +HMCM+MR I++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKRGSSTITTTFTGDF 197


>gi|237815495|ref|ZP_04594493.1| GTP cyclohydrolase I [Brucella abortus str. 2308 A]
 gi|237790332|gb|EEP64542.1| GTP cyclohydrolase I [Brucella abortus str. 2308 A]
          Length = 248

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 135/187 (72%), Gaps = 2/187 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 61  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 118

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 119 EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 178

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T QIA +I+     +GVAV+IE +HMCM+MR I++ G +T+TT FTG+F     +
Sbjct: 179 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQ 238

Query: 194 TDFFLKM 200
              F+ +
Sbjct: 239 QVRFMTL 245


>gi|319407309|emb|CBI80950.1| GTP cyclohydrolase I [Bartonella sp. 1-1C]
          Length = 204

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 140/195 (71%), Gaps = 2/195 (1%)

Query: 6   TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT 65
           T  F  + KKP+VEE + AI  +L WIG+DP+REGL DTP RV K+Y ELF+GY +  + 
Sbjct: 10  TNSFFSEKKKPSVEEVEMAIHTLLLWIGEDPNREGLLDTPSRVAKAYHELFSGYNE--SV 67

Query: 66  QDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRIL 125
           ++     F E S Y + V++K+ISF+S+CEHH+LPI G+ H+AY+P K V+GLSK+ RI+
Sbjct: 68  KEILATVFEEVSGYSEPVILKNISFYSHCEHHMLPIIGRAHVAYLPDKKVVGLSKIARIV 127

Query: 126 EVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           +V+SRRLQ QE +T QI  A+++    +G+AV+IE +HMCM MRGI++ G TT+TT+F G
Sbjct: 128 DVFSRRLQTQEIMTAQIVDALKTHLKPRGIAVVIEAEHMCMGMRGIRKQGATTITTSFHG 187

Query: 186 EFSRDKGKTDFFLKM 200
            +  ++   D F+ +
Sbjct: 188 YYQTNQMAQDSFMSL 202


>gi|23501953|ref|NP_698080.1| GTP cyclohydrolase I [Brucella suis 1330]
 gi|161619025|ref|YP_001592912.1| GTP cyclohydrolase I [Brucella canis ATCC 23365]
 gi|254704365|ref|ZP_05166193.1| GTP cyclohydrolase I [Brucella suis bv. 3 str. 686]
 gi|260566389|ref|ZP_05836859.1| GTP cyclohydrolase 1 [Brucella suis bv. 4 str. 40]
 gi|261755037|ref|ZP_05998746.1| GTP cyclohydrolase 1 [Brucella suis bv. 3 str. 686]
 gi|38257638|sp|Q8G0L4|GCH1_BRUSU RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|189045183|sp|A9M586|GCH1_BRUC2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|23347899|gb|AAN29995.1| GTP cyclohydrolase I [Brucella suis 1330]
 gi|161335836|gb|ABX62141.1| GTP cyclohydrolase I [Brucella canis ATCC 23365]
 gi|260155907|gb|EEW90987.1| GTP cyclohydrolase 1 [Brucella suis bv. 4 str. 40]
 gi|261744790|gb|EEY32716.1| GTP cyclohydrolase 1 [Brucella suis bv. 3 str. 686]
          Length = 213

 Score =  209 bits (532), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 92/174 (52%), Positives = 131/174 (75%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +++     +GVAV+IE +HMCM+MR I++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSMQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF 197


>gi|294852339|ref|ZP_06793012.1| GTP cyclohydrolase I [Brucella sp. NVSL 07-0026]
 gi|294820928|gb|EFG37927.1| GTP cyclohydrolase I [Brucella sp. NVSL 07-0026]
          Length = 213

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 130/174 (74%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY   P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSGSP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+     +GVAV+IE +HMCM+MR I++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKQGSSTITTTFTGDF 197


>gi|225627548|ref|ZP_03785585.1| GTP cyclohydrolase I [Brucella ceti str. Cudo]
 gi|225617553|gb|EEH14598.1| GTP cyclohydrolase I [Brucella ceti str. Cudo]
          Length = 248

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 135/187 (72%), Gaps = 2/187 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 61  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 118

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 119 EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 178

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T QIA +I+     +GVAV+IE +HMCM+MR I++ G +T+TT FTG+F     +
Sbjct: 179 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRKRGSSTITTTFTGDFKEKADQ 238

Query: 194 TDFFLKM 200
              F+ +
Sbjct: 239 QVRFMTL 245


>gi|116249235|ref|YP_765076.1| putative GTP cyclohydrolase I [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115253885|emb|CAK12280.1| putative GTP cyclohydrolase I [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 202

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 128/174 (73%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++PT  +A+EA+R ++RW GDDP REGL DTP RV K+Y+ELF+GY   P  QD     F
Sbjct: 15  ERPTQHQAEEAVRKLIRWAGDDPSREGLLDTPKRVAKAYRELFSGYATEP--QDVLSKTF 72

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +MVL++ I F S+CEHH++P  G  H+AYIP++ V+GLSK+ R++++Y+RRLQ
Sbjct: 73  SEVGGYNEMVLVRGIEFHSHCEHHMVPFHGIAHIAYIPEQCVLGLSKMARLVDLYARRLQ 132

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA A+E S   KGVAV+IE +HMCM+MRGI++ G  T+TTAF G F
Sbjct: 133 TQETMTAQIARALEESLRPKGVAVMIEAEHMCMAMRGIRKQGAKTLTTAFAGLF 186


>gi|254714154|ref|ZP_05175965.1| GTP cyclohydrolase I [Brucella ceti M644/93/1]
 gi|254716788|ref|ZP_05178599.1| GTP cyclohydrolase I [Brucella ceti M13/05/1]
 gi|261218586|ref|ZP_05932867.1| GTP cyclohydrolase I [Brucella ceti M13/05/1]
 gi|261321917|ref|ZP_05961114.1| GTP cyclohydrolase I [Brucella ceti M644/93/1]
 gi|260923675|gb|EEX90243.1| GTP cyclohydrolase I [Brucella ceti M13/05/1]
 gi|261294607|gb|EEX98103.1| GTP cyclohydrolase I [Brucella ceti M644/93/1]
          Length = 213

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 130/174 (74%), Gaps = 2/174 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QE +T QIA +I+      GVAV+IE +HMCM+MR I++ G +T+TT FTG+F
Sbjct: 144 TQESITAQIADSIQRILKPHGVAVMIEAEHMCMAMRSIRKRGSSTITTTFTGDF 197


>gi|319898978|ref|YP_004159071.1| GTP cyclohydrolase I [Bartonella clarridgeiae 73]
 gi|319402942|emb|CBI76493.1| GTP cyclohydrolase I [Bartonella clarridgeiae 73]
          Length = 204

 Score =  208 bits (529), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 138/195 (70%), Gaps = 2/195 (1%)

Query: 6   TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT 65
           T  F  + KKP+VEE + AI  +L WIG++P+REGL +TP RV K+Y+ELF GY +  + 
Sbjct: 10  TNSFLSEQKKPSVEEIEMAIHTLLLWIGENPNREGLLNTPSRVAKAYRELFTGYNE--SV 67

Query: 66  QDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRIL 125
           ++     F E S Y + V++K+ISF+S+CEHH+LPI GK H+AY+P K V+GLSK+ R++
Sbjct: 68  EEILGTVFEEVSGYNEPVIMKNISFYSHCEHHMLPIIGKAHIAYLPDKKVVGLSKIARVV 127

Query: 126 EVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           + +SRRLQ QE +T QI  A+E+     GVAV++E +HMCM+MRGI++ G TT+TT+F G
Sbjct: 128 DAFSRRLQTQETMTAQIVDALETHLKPHGVAVVVEAEHMCMNMRGIRKQGTTTITTSFHG 187

Query: 186 EFSRDKGKTDFFLKM 200
            +  D+     F+ +
Sbjct: 188 YYQSDQVAQASFMSL 202


>gi|49474174|ref|YP_032216.1| GTP cyclohydrolase I [Bartonella quintana str. Toulouse]
 gi|81647093|sp|Q6FZZ4|GCH1_BARQU RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|49239678|emb|CAF26049.1| GTP cyclohydrolase I [Bartonella quintana str. Toulouse]
          Length = 206

 Score =  207 bits (528), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 94/186 (50%), Positives = 138/186 (74%), Gaps = 3/186 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K+P  EE + AIR +L WIG++P+REGL DTP RV K+Y++LF GY +  + ++     F
Sbjct: 17  KRPHFEEVEAAIRTLLLWIGENPNREGLLDTPRRVAKAYRDLFIGYGE--SVEEILGTVF 74

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E S Y + V++KDISF+S+CEHH++PI GK H+AY+P + V+GLSK+ RI++V+SRRLQ
Sbjct: 75  EEVSGYNEPVIVKDISFYSHCEHHMIPIVGKAHIAYLPDEKVVGLSKIARIVDVFSRRLQ 134

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK-G 192
            QE +T QIA A+E      G+AVLIE +HMCM+MRG+++ G TT+TT+F G + +D+  
Sbjct: 135 TQETMTAQIADALEEYLKPCGIAVLIEAEHMCMTMRGVQKQGATTITTSFHGSYEKDQVA 194

Query: 193 KTDFFL 198
           +T+F +
Sbjct: 195 QTNFMM 200


>gi|209549443|ref|YP_002281360.1| GTP cyclohydrolase I [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535199|gb|ACI55134.1| GTP cyclohydrolase I [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 204

 Score =  207 bits (528), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 91/166 (54%), Positives = 126/166 (75%), Gaps = 2/166 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+ +EA+EA+RV+LRW G++P REGL +TP RV+KSY+ELFAGY   P  +D  
Sbjct: 12  NRDSDRPSQQEAEEAVRVLLRWAGENPTREGLIETPARVVKSYRELFAGYDMAP--EDVL 69

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E + Y DMVL+KDI FFS+CEHH++PI GK H+AY+P   V+GLSK+ R++E+Y 
Sbjct: 70  GRTFEEVAGYDDMVLVKDIPFFSHCEHHVVPIIGKAHVAYMPDGRVLGLSKIARVVEIYG 129

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDG 175
           RRLQ QE +T QIA AI+ + + +GVAV+IE +HMCM+MRG+++ G
Sbjct: 130 RRLQTQETMTAQIARAIDDTLNPRGVAVMIEAEHMCMAMRGVQKQG 175


>gi|71083933|ref|YP_266653.1| GTP cyclohydrolase I [Candidatus Pelagibacter ubique HTCC1062]
 gi|123646270|sp|Q4FL89|GCH1_PELUB RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|71063046|gb|AAZ22049.1| GTP cyclohydrolase I [Candidatus Pelagibacter ubique HTCC1062]
          Length = 202

 Score =  207 bits (527), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 98/189 (51%), Positives = 134/189 (70%), Gaps = 8/189 (4%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF-- 71
           KK + +EA+EA + IL W+G+DP REGL +TP RV+K++KE F GY     T+D  +   
Sbjct: 15  KKVSDKEAEEAFKTILTWMGEDPSREGLLETPKRVVKAFKEYFGGY-----TEDAEKILE 69

Query: 72  -HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
             FG+   Y DMV+ K+IS  S+CEHH+ PI G  H+AYIP + V+GLSKL R++EV+S+
Sbjct: 70  KTFGDVEGYDDMVVEKNISVSSHCEHHMAPIVGTAHVAYIPNERVVGLSKLARVVEVFSK 129

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ QERLTMQ+A A+ +S D+KGVAV I+  H CM+MRGIK++  TTVT  F GEF +D
Sbjct: 130 RLQTQERLTMQVAQALMTSLDAKGVAVTIDAAHQCMTMRGIKKENATTVTNYFLGEFKKD 189

Query: 191 KGKTDFFLK 199
               + +L+
Sbjct: 190 LSVQNRYLR 198


>gi|91762999|ref|ZP_01264963.1| GTP cyclohydrolase I [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717412|gb|EAS84063.1| GTP cyclohydrolase I [Candidatus Pelagibacter ubique HTCC1002]
          Length = 202

 Score =  207 bits (527), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 98/189 (51%), Positives = 134/189 (70%), Gaps = 8/189 (4%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF-- 71
           KK + +EA+EA + IL W+G+DP REGL +TP RV+K++KE F GY     T+D  +   
Sbjct: 15  KKVSDKEAEEAFKTILTWMGEDPSREGLLETPKRVVKAFKEYFGGY-----TEDAEKILE 69

Query: 72  -HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
             FG+   Y DMV+ K+IS  S+CEHH+ PI G  H+AYIP + V+GLSKL R++EV+S+
Sbjct: 70  KTFGDVEGYDDMVVEKNISVSSHCEHHMAPIVGTAHVAYIPNERVVGLSKLARVVEVFSK 129

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ QERLTMQ+A A+ +S D+KGVAV I+  H CM+MRGIK++  TTVT  F GEF +D
Sbjct: 130 RLQTQERLTMQVAQALMNSLDAKGVAVTIDAAHQCMTMRGIKKENATTVTNYFLGEFKKD 189

Query: 191 KGKTDFFLK 199
               + +L+
Sbjct: 190 LSIQNRYLR 198


>gi|298291996|ref|YP_003693935.1| GTP cyclohydrolase I [Starkeya novella DSM 506]
 gi|296928507|gb|ADH89316.1| GTP cyclohydrolase I [Starkeya novella DSM 506]
          Length = 212

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 139/205 (67%), Gaps = 2/205 (0%)

Query: 1   MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYK 60
           M+  +  V     ++P+ EEA+ A+R ++ W GDDP REGL DTP RV+++Y+EL++GY+
Sbjct: 9   MRSAQNEVEASAARRPSREEAEAAVRTLIAWAGDDPSREGLLDTPKRVVRAYEELYSGYR 68

Query: 61  QIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSK 120
             P  +      FGE   + DMVL++DI F+S+CEHH++P  GK H+AY P + V+GLSK
Sbjct: 69  ANP--EKILDRTFGEIGNFDDMVLVRDIEFYSHCEHHMVPFVGKAHVAYFPVERVVGLSK 126

Query: 121 LVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVT 180
           + RI+++++RRLQ QE LT QI  A++     +GVAVL+E +HMCM+MRG+++ G +TVT
Sbjct: 127 IARIVDLFARRLQTQEHLTSQIVTAMDEILKPRGVAVLLEAEHMCMAMRGVRKQGASTVT 186

Query: 181 TAFTGEFSRDKGKTDFFLKMTHNQR 205
           + FTG F  D  +   F+ +    R
Sbjct: 187 SQFTGVFRDDPQEQVRFMSLLRGMR 211


>gi|218680127|ref|ZP_03528024.1| GTP cyclohydrolase I [Rhizobium etli CIAT 894]
          Length = 201

 Score =  206 bits (524), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 126/166 (75%), Gaps = 2/166 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+ +EA+EA+RV+LRW GD+P REGL +TP RV+KSY+ELF+GY   P  +D  
Sbjct: 9   NRDSDRPSQQEAEEAVRVLLRWAGDNPAREGLIETPARVVKSYRELFSGYDMAP--EDVL 66

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E + Y DMVL++DI FFS+CEHH++PI GK H+AY+P   V+GLSK+ R++E+Y 
Sbjct: 67  GRTFEEVAGYDDMVLVRDIPFFSHCEHHMVPIIGKAHVAYMPDGRVLGLSKIARVVEIYG 126

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDG 175
           RRLQ QE +T QIA AI+ + + +GVAV+IE +HMCM+MRG+++ G
Sbjct: 127 RRLQTQETMTAQIARAIDDTLNPRGVAVMIEAEHMCMAMRGVQKQG 172


>gi|319408461|emb|CBI82116.1| GTP cyclohydrolase I [Bartonella schoenbuchensis R1]
          Length = 206

 Score =  206 bits (524), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 87/178 (48%), Positives = 134/178 (75%), Gaps = 2/178 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K+P+ +E + A+R +L W+G++PDREGL +TP RV K Y ELF+GY +  + ++     F
Sbjct: 18  KRPSFKEVEAAVRTLLLWVGENPDREGLLNTPKRVAKVYSELFSGYDE--SVEEILGTVF 75

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E S Y + +++KDISF+S+CEHH+LPI GK H+AY+P   ++GLSK+ R+++V+SRRLQ
Sbjct: 76  EEVSGYNEPIIMKDISFYSHCEHHVLPIVGKAHIAYLPDTKIVGLSKIARVIDVFSRRLQ 135

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
            QE +T Q+A+A+++    +GVAV+IE +HMCM+MRGI++ G TT+TT+F G +  D+
Sbjct: 136 TQEAMTAQVANALKTHLKPRGVAVVIEAEHMCMAMRGIRKQGATTITTSFHGSYKEDQ 193


>gi|86357817|ref|YP_469709.1| GTP cyclohydrolase I [Rhizobium etli CFN 42]
 gi|86281919|gb|ABC90982.1| GTP cyclohydrolase I protein [Rhizobium etli CFN 42]
          Length = 204

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 91/166 (54%), Positives = 125/166 (75%), Gaps = 2/166 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+ +EA+EA+RV+LRW GDDP REGL +TP RV K+Y+ELFAGY   P  +D  
Sbjct: 12  NRDSDRPSQQEAEEAVRVLLRWAGDDPTREGLIETPARVAKAYRELFAGYDMAP--EDVL 69

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E + Y DMVL+KDI F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++E+Y 
Sbjct: 70  GRTFEEVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSKIARVVEIYG 129

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDG 175
           RRLQ QE +T QIA AI+ + + +GVAV+IE +HMCM+MRG+++ G
Sbjct: 130 RRLQTQETMTAQIARAIDDTLNPRGVAVMIEAEHMCMAMRGVQKQG 175


>gi|49475540|ref|YP_033581.1| GTP cyclohydrolase I [Bartonella henselae str. Houston-1]
 gi|81647939|sp|Q6G3J8|GCH1_BARHE RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|49238346|emb|CAF27570.1| GTP cyclohydrolase I [Bartonella henselae str. Houston-1]
          Length = 206

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 94/201 (46%), Positives = 140/201 (69%), Gaps = 5/201 (2%)

Query: 1   MKCLRTGVFNMKL---KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFA 57
           M  ++ G  N  L   K+P  EE + AIR  L WIG++P+REGL DTP RV K+Y++LF 
Sbjct: 1   MHNIKVGTKNPFLSGRKRPPFEEVEAAIRTFLLWIGENPNREGLLDTPGRVAKAYRDLFT 60

Query: 58  GYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIG 117
           GY +  + ++     F E S Y + V++KD+SF+S+CEHH++PI GK H+AY P + ++G
Sbjct: 61  GYDE--SVEEILGTVFEEVSGYNEPVIMKDLSFYSHCEHHMIPIVGKAHIAYFPDEKIVG 118

Query: 118 LSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLT 177
           LSK+ R++ V+SRRLQ QE +T QIA+A+E+    +GVAVLIE +HMCM+MRG+++ G  
Sbjct: 119 LSKIARVVNVFSRRLQTQEAMTAQIANALETHLKPRGVAVLIEAEHMCMTMRGVQKQGAK 178

Query: 178 TVTTAFTGEFSRDKGKTDFFL 198
           T+TT+F G + +D+     F+
Sbjct: 179 TITTSFHGSYEKDQVAQAHFM 199


>gi|150396270|ref|YP_001326737.1| GTP cyclohydrolase I [Sinorhizobium medicae WSM419]
 gi|166220291|sp|A6U8C2|GCH1_SINMW RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|150027785|gb|ABR59902.1| GTP cyclohydrolase I [Sinorhizobium medicae WSM419]
          Length = 205

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 100/186 (53%), Positives = 137/186 (73%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT +EA+EA+RV+LRW G+DP REGLKDTP RV K+Y+E+F GY      +D     F 
Sbjct: 17  RPTQKEAEEAVRVLLRWAGEDPAREGLKDTPARVAKAYREIFGGYDL--AAEDVLGRTFE 74

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E S Y D+VL KDI F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++++Y+RRLQ 
Sbjct: 75  EVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLPNGRVLGLSKIARVVDIYARRLQT 134

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA AI+ +   +GVAV+IE +H+CM+MRGIK+ G TT+TT FTGEF  +  + 
Sbjct: 135 QEAMTAQIARAIDETLVPRGVAVMIEAEHLCMAMRGIKKQGATTMTTTFTGEFKSEPAEQ 194

Query: 195 DFFLKM 200
             F+ M
Sbjct: 195 VRFMTM 200


>gi|116252277|ref|YP_768115.1| GTP cyclohydrolase I [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256925|emb|CAK08019.1| putative GTP cyclohydrolase I [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 204

 Score =  206 bits (523), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 90/161 (55%), Positives = 124/161 (77%), Gaps = 2/161 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ +EA+EA+RV+LRW GDDP REGL +TP RV+KSY+ELF+GY      +D     F 
Sbjct: 17  RPSQQEAEEAVRVLLRWAGDDPTREGLLETPARVVKSYRELFSGYDM--AAEDVLGRTFE 74

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y DMVL+KDI F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++E+Y RRLQ 
Sbjct: 75  EVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSKIARVVEIYGRRLQT 134

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDG 175
           QE +T QIA AI+ + + +GVAVLIE +HMCM+MRG+++ G
Sbjct: 135 QETMTAQIARAIDDTLNPRGVAVLIEAEHMCMAMRGVQKQG 175


>gi|190891880|ref|YP_001978422.1| GTP cyclohydrolase I protein [Rhizobium etli CIAT 652]
 gi|218514686|ref|ZP_03511526.1| GTP cyclohydrolase I [Rhizobium etli 8C-3]
 gi|190697159|gb|ACE91244.1| GTP cyclohydrolase I protein [Rhizobium etli CIAT 652]
          Length = 204

 Score =  205 bits (522), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 91/166 (54%), Positives = 124/166 (74%), Gaps = 2/166 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+ +EA+EA+RV+LRW GDDP REGL +TP RV K+Y+ELFAGY   P  +D  
Sbjct: 12  NRDSDRPSQQEAEEAVRVLLRWAGDDPTREGLIETPSRVAKAYRELFAGYDMAP--EDVL 69

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E + Y DMVL+KDI F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++E+Y 
Sbjct: 70  GRTFEEVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSKIARVVEIYG 129

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDG 175
           RRLQ QE +T QIA AI+ +   +GVAV+IE +HMCM+MRG+++ G
Sbjct: 130 RRLQTQETMTAQIARAIDDTLQPRGVAVMIEAEHMCMAMRGVQKQG 175


>gi|327188325|gb|EGE55543.1| GTP cyclohydrolase I protein [Rhizobium etli CNPAF512]
          Length = 204

 Score =  205 bits (521), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 91/166 (54%), Positives = 124/166 (74%), Gaps = 2/166 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+ +EA+EA+RV+LRW GDDP REGL +TP RV K+Y+ELFAGY   P  +D  
Sbjct: 12  NRDSDRPSQQEAEEAVRVLLRWAGDDPTREGLIETPARVAKAYRELFAGYDMAP--EDVL 69

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E + Y DMVL+KDI F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++E+Y 
Sbjct: 70  GRTFEEVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSKIARVVEIYG 129

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDG 175
           RRLQ QE +T QIA AI+ +   +GVAV+IE +HMCM+MRG+++ G
Sbjct: 130 RRLQTQETMTAQIARAIDDTLQPRGVAVMIEAEHMCMAMRGVQKQG 175


>gi|227821821|ref|YP_002825791.1| GTP cyclohydrolase I [Sinorhizobium fredii NGR234]
 gi|254791049|sp|C3MB45|GCH1_RHISN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|227340820|gb|ACP25038.1| GTP cyclohydrolase I [Sinorhizobium fredii NGR234]
          Length = 205

 Score =  205 bits (521), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 138/186 (74%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT +EA+EA+RV+LRW G+DP REGLKDTP RVIKSY+E+F GY  +   +D     F 
Sbjct: 17  RPTQKEAEEAVRVLLRWAGEDPTREGLKDTPARVIKSYREIFGGYDLV--AEDVLGRTFE 74

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E S Y D+VL KD+ F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++++Y+RRLQ 
Sbjct: 75  EVSGYDDIVLEKDVPFYSHCEHHMVPIIGKAHVAYLPNGRVLGLSKIARVVDIYARRLQT 134

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA AI+ +   +GVAV+IE +H+CM+MRGIK+ G TT+TT FTG F  +  + 
Sbjct: 135 QEAMTAQIARAIDETLAPRGVAVMIEAEHLCMAMRGIKKHGSTTLTTTFTGAFKTEPAEQ 194

Query: 195 DFFLKM 200
             F+ +
Sbjct: 195 ARFMTL 200


>gi|218508649|ref|ZP_03506527.1| GTP cyclohydrolase I [Rhizobium etli Brasil 5]
 gi|218672341|ref|ZP_03522010.1| GTP cyclohydrolase I [Rhizobium etli GR56]
          Length = 204

 Score =  205 bits (521), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 91/166 (54%), Positives = 124/166 (74%), Gaps = 2/166 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+ +EA+EA+RV+LRW GDDP REGL +TP RV K+Y+ELFAGY   P  +D  
Sbjct: 12  NRDSDRPSQQEAEEAVRVLLRWAGDDPTREGLIETPARVAKAYRELFAGYDMAP--EDVL 69

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E + Y DMVL+KDI F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++E+Y 
Sbjct: 70  GRTFEEVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSKIARVVEIYG 129

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDG 175
           RRLQ QE +T QIA AI+ +   +GVAV+IE +HMCM+MRG+++ G
Sbjct: 130 RRLQTQETMTAQIARAIDDTLQPRGVAVMIEAEHMCMAMRGVQKQG 175


>gi|90417795|ref|ZP_01225707.1| GTP cyclohydrolase I [Aurantimonas manganoxydans SI85-9A1]
 gi|90337467|gb|EAS51118.1| GTP cyclohydrolase I [Aurantimonas manganoxydans SI85-9A1]
          Length = 207

 Score =  205 bits (521), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 2/190 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+ A++ +LRWIG+DP REGL +TP RV+K+Y+ELF GYK      D     F 
Sbjct: 19  RPSRAEAEAAVKTLLRWIGEDPSREGLLETPARVVKAYEELFGGYKL--EAGDVLGRTFQ 76

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           + S Y DMVL++DI F S+CEHH++PI GK H+AY+P   V+GLSK+ R++++Y RRLQ 
Sbjct: 77  DVSGYDDMVLVRDIDFHSHCEHHMVPIIGKAHVAYVPDGRVLGLSKIARVVDIYGRRLQT 136

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA AI      KG+AV+IE +HMCMSMRGI+  G  T+T+AF G F+ D    
Sbjct: 137 QESMTAQIASAIAGMLVPKGIAVMIEAEHMCMSMRGIRSKGSMTITSAFQGVFAEDGEFK 196

Query: 195 DFFLKMTHNQ 204
             FL    ++
Sbjct: 197 SRFLAQASSR 206


>gi|75675521|ref|YP_317942.1| GTP cyclohydrolase I [Nitrobacter winogradskyi Nb-255]
 gi|74420391|gb|ABA04590.1| GTP cyclohydrolase I [Nitrobacter winogradskyi Nb-255]
          Length = 241

 Score =  205 bits (521), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 131/191 (68%), Gaps = 2/191 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++P+  EA++A+R +L +IG++PDREGL DTP RVI+SY E++ GY Q P   +     F
Sbjct: 51  QRPSRHEAEDAVRTLLAYIGENPDREGLLDTPRRVIESYDEIYQGYHQCPA--EVLNRTF 108

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
           GE + Y D VL++DI F S CEHH++P +GK H+AY P + V+GLSKL R+ ++++RRLQ
Sbjct: 109 GETAGYDDFVLVRDIQFTSQCEHHMMPFYGKAHIAYTPVERVVGLSKLARLTDIFARRLQ 168

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T QIA A++     +GVAV+IE +H CMS+RG+ + G  TVT+ FTG F  D  +
Sbjct: 169 TQEHMTAQIAAAVDEVLKPRGVAVMIEAEHTCMSVRGVAKHGAMTVTSRFTGVFRDDPAE 228

Query: 194 TDFFLKMTHNQ 204
              FL M   Q
Sbjct: 229 QARFLSMVRGQ 239


>gi|241204770|ref|YP_002975866.1| GTP cyclohydrolase I [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858660|gb|ACS56327.1| GTP cyclohydrolase I [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 204

 Score =  204 bits (520), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 125/166 (75%), Gaps = 2/166 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+ +EA+EA+RV+LRW GD+P REGL +TP RV+KSY+ELF+GY      +D  
Sbjct: 12  NRDSDRPSQQEAEEAVRVLLRWAGDNPAREGLLETPARVVKSYRELFSGYDM--AAEDVL 69

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E + Y DMVL+KDI F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++E+Y 
Sbjct: 70  GRTFEEVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSKIARVVEIYG 129

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDG 175
           RRLQ QE +T QIA AI+ + + +GVAVLIE +HMCM+MRG+++ G
Sbjct: 130 RRLQTQETMTAQIARAIDDTLNPRGVAVLIEAEHMCMAMRGVQKQG 175


>gi|296445111|ref|ZP_06887071.1| GTP cyclohydrolase I [Methylosinus trichosporium OB3b]
 gi|296257285|gb|EFH04352.1| GTP cyclohydrolase I [Methylosinus trichosporium OB3b]
          Length = 209

 Score =  204 bits (519), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 94/193 (48%), Positives = 134/193 (69%), Gaps = 2/193 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +++P+ EEA+ A+RV+LRW GD+PDREGLK+TP RV+K+Y+E F GY++    +  +R  
Sbjct: 19  VERPSREEAEAAVRVLLRWAGDNPDREGLKETPRRVVKAYEEFFRGYQE-DAGESLARI- 76

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y D+VL++DI F S+CEHHI+P  GK H+AY P   V+GLSKL R+++ Y++RL
Sbjct: 77  FEEVEGYDDLVLVRDIPFVSHCEHHIVPFVGKAHIAYYPTGGVVGLSKLARLVDTYAKRL 136

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           Q QE +T QIA AI+     +GVAVL+E +HMCMSMRG+ + G +TVT  F+G F  +  
Sbjct: 137 QTQEAMTAQIATAIDQHLAPRGVAVLVEAEHMCMSMRGVLKQGSSTVTVQFSGVFRDEPA 196

Query: 193 KTDFFLKMTHNQR 205
           +   F  +    R
Sbjct: 197 EQVHFYTLLRGGR 209


>gi|254470319|ref|ZP_05083723.1| GTP cyclohydrolase I [Pseudovibrio sp. JE062]
 gi|211960630|gb|EEA95826.1| GTP cyclohydrolase I [Pseudovibrio sp. JE062]
          Length = 210

 Score =  203 bits (517), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 97/191 (50%), Positives = 137/191 (71%), Gaps = 2/191 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+  EA+ A RV+L+WIGDDP+REGL DTP RV+K+Y++LF+GYK+ P  ++  
Sbjct: 19  NKLPNRPSRAEAEAAARVLLQWIGDDPEREGLLDTPKRVVKAYEDLFSGYKEDP--REHL 76

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E   Y D+VL+KDI+F S+CEHH+LP  GK H+AY P   V+GLSK+ R++E+Y+
Sbjct: 77  ERTFEEVGGYNDIVLLKDITFTSFCEHHVLPFTGKAHIAYYPNHAVVGLSKIARVVEIYA 136

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQ QE LT+QIA A+E     +GVAV+IE +H CMSMRGI++ G++T+T  F+G F  
Sbjct: 137 RRLQTQEHLTVQIATALEEYLAPRGVAVMIEAEHQCMSMRGIQKQGVSTLTNRFSGVFED 196

Query: 190 DKGKTDFFLKM 200
           +  +   F+ M
Sbjct: 197 NASEQVRFMTM 207


>gi|218663335|ref|ZP_03519265.1| GTP cyclohydrolase I [Rhizobium etli IE4771]
          Length = 204

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 123/166 (74%), Gaps = 2/166 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+ +EA+EA+RV+LRW GDDP REGL +TP RV K+Y+ELFAGY      +D  
Sbjct: 12  NRDSDRPSQQEAEEAVRVLLRWAGDDPAREGLIETPARVAKAYRELFAGYDM--AAEDVL 69

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E + Y DMVL+KDI F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++E+Y 
Sbjct: 70  GRTFEEVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSKIARVVEIYG 129

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDG 175
           RRLQ QE +T QIA AI+ +   +GVAV+IE +HMCM+MRG+++ G
Sbjct: 130 RRLQTQETMTAQIARAIDDTLQPRGVAVMIEAEHMCMAMRGVQKQG 175


>gi|218459287|ref|ZP_03499378.1| GTP cyclohydrolase I [Rhizobium etli Kim 5]
          Length = 204

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 123/166 (74%), Gaps = 2/166 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+ +EA+EA+RV+LRW GDDP REGL +TP RV K+Y+ELFAGY      +D  
Sbjct: 12  NRDSDRPSQQEAEEAVRVLLRWAGDDPTREGLIETPARVAKAYRELFAGYDM--AAEDVL 69

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E + Y DMVL+KDI F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++E+Y 
Sbjct: 70  GRTFEEVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSKIARVVEIYG 129

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDG 175
           RRLQ QE +T QIA AI+ +   +GVAV+IE +HMCM+MRG+++ G
Sbjct: 130 RRLQTQETMTAQIARAIDDTLQPRGVAVMIEAEHMCMAMRGVQKQG 175


>gi|254455774|ref|ZP_05069203.1| GTP cyclohydrolase I [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082776|gb|EDZ60202.1| GTP cyclohydrolase I [Candidatus Pelagibacter sp. HTCC7211]
          Length = 205

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 131/182 (71%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPT-TQDTSRFHFGEAS 77
           +EA++A R IL W+G+DP REGL +TP RV+K+YKE FAGYK  P    D +   FG+  
Sbjct: 20  KEAEDAFRTILSWLGEDPTREGLLETPKRVMKAYKEYFAGYKVDPNKILDKT---FGDVD 76

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
            Y DMV+ K+IS  S+CEHH+ PI GK H+AYIPK+ V+GLSKL R++EV+S+RLQ QER
Sbjct: 77  GYDDMVIQKNISIQSHCEHHMAPIIGKAHVAYIPKERVVGLSKLARVVEVFSKRLQTQER 136

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LTMQ+A  +  S D+KGVAV I+  H CM+MRGIK++  +TVT  + G+F  D    + +
Sbjct: 137 LTMQVAKTLMESLDAKGVAVTIDSTHQCMTMRGIKKEQASTVTNYYLGQFKEDLSYQNRY 196

Query: 198 LK 199
           L+
Sbjct: 197 LR 198


>gi|188581474|ref|YP_001924919.1| GTP cyclohydrolase I [Methylobacterium populi BJ001]
 gi|179344972|gb|ACB80384.1| GTP cyclohydrolase I [Methylobacterium populi BJ001]
          Length = 269

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 131/196 (66%), Gaps = 2/196 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
            + L +P+ +EA+ A+R +LRW GDDP REGL DTP RV+K+Y+++F GY+         
Sbjct: 75  EVALGRPSRQEAEAAVRTLLRWAGDDPTREGLLDTPARVVKAYEQIFGGYRA--DADALL 132

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E   Y D VL++DI F+S+CEHH++P  G  H+AY P K V+GLSKL R+++ ++
Sbjct: 133 ERVFEEVEGYSDAVLVRDIPFYSHCEHHMVPFMGLAHIAYYPTKGVVGLSKLARVVDAFA 192

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQ QE +T QIA  IES    +G AV++E +H+CM+MRG+++ G++T+TT F G +  
Sbjct: 193 RRLQTQETMTAQIADTIESILQPRGCAVMVEAEHLCMAMRGVQKAGVSTITTQFRGVYRT 252

Query: 190 DKGKTDFFLKMTHNQR 205
           D  +   FL    NQ+
Sbjct: 253 DPSEQVRFLTFVRNQK 268


>gi|209965658|ref|YP_002298573.1| GTP cyclohydrolase I [Rhodospirillum centenum SW]
 gi|209959124|gb|ACI99760.1| GTP cyclohydrolase I [Rhodospirillum centenum SW]
          Length = 220

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 134/191 (70%), Gaps = 2/191 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +++PT  EA+ A+R ++RW GDDP REGL  TPDRV++SY+E FAGY + P  +  SR  
Sbjct: 25  VERPTRAEAEAAVRTLIRWAGDDPGREGLLGTPDRVVRSYEEFFAGYHEDPV-ELLSRT- 82

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y +MV+++DI F S+CEHH++PI GK H+AY+P+K V+G+SKL R++EVY++RL
Sbjct: 83  FEETDGYDEMVVLRDIRFESHCEHHMVPIIGKAHVAYLPRKRVVGISKLARVIEVYAKRL 142

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T QIA++I+      GVAV++E  H CM+ RG+ + G++ VT+   G F  D  
Sbjct: 143 QIQEKMTSQIANSIDEVLQPLGVAVVVEASHQCMTTRGVHKPGVSMVTSRMLGAFRDDPT 202

Query: 193 KTDFFLKMTHN 203
               FL M  N
Sbjct: 203 TRREFLAMIGN 213


>gi|217976550|ref|YP_002360697.1| GTP cyclohydrolase I [Methylocella silvestris BL2]
 gi|217501926|gb|ACK49335.1| GTP cyclohydrolase I [Methylocella silvestris BL2]
          Length = 213

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 97/187 (51%), Positives = 132/187 (70%), Gaps = 3/187 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT EEA+ A+RV+LRW GDDP+REGL DTP RV+K+Y ELF+GY +   T+  SR  F 
Sbjct: 24  RPTREEAEAAVRVLLRWAGDDPNREGLVDTPARVVKAYGELFSGYGE-DATEVLSRV-FE 81

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQ 133
           E   Y D++L++DI F S+CEHH++P  G  H+AY P +  V+GLSKL R+++V++RRLQ
Sbjct: 82  EVHGYDDLILVRDIEFSSHCEHHMVPFIGVAHIAYYPSEEGVVGLSKLARLVDVFARRLQ 141

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE LT QI  AI+     +G AV+IE +HMCMSMRG+++ G  T+TT FTG F  D  +
Sbjct: 142 TQEALTAQIVGAIDLHLRPRGCAVMIEAEHMCMSMRGVRKHGAQTITTQFTGVFRDDPAE 201

Query: 194 TDFFLKM 200
              FL +
Sbjct: 202 QVRFLTL 208


>gi|163760294|ref|ZP_02167377.1| GTP cyclohydrolase I protein [Hoeflea phototrophica DFL-43]
 gi|162282693|gb|EDQ32981.1| GTP cyclohydrolase I protein [Hoeflea phototrophica DFL-43]
          Length = 213

 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 132/173 (76%), Gaps = 2/173 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT  EA+EA+R +LRW GDD  REGL DTP RV K+YKELFAGY+Q    ++  R  F 
Sbjct: 25  RPTQAEAEEAVRTLLRWAGDDVTREGLIDTPKRVAKAYKELFAGYEQ-DAEEELGRT-FE 82

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D+VL+KDI FFS+CEHH++PI GK H+AY+P   V+GLSK+ R++E++ RRLQ 
Sbjct: 83  EVAGYDDIVLVKDIPFFSHCEHHMVPIIGKAHVAYLPDGKVLGLSKIARVVEIFGRRLQT 142

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           QE +T Q+AH+I+ +   +GVAV+IE +HMCM+MRGIK+ G TT+TT FTG F
Sbjct: 143 QETMTAQVAHSIDDTLHPRGVAVMIEAEHMCMAMRGIKKQGSTTITTTFTGAF 195


>gi|163851688|ref|YP_001639731.1| GTP cyclohydrolase I [Methylobacterium extorquens PA1]
 gi|218530494|ref|YP_002421310.1| GTP cyclohydrolase I [Methylobacterium chloromethanicum CM4]
 gi|240138853|ref|YP_002963328.1| GTP cyclohydrolase I [Methylobacterium extorquens AM1]
 gi|254561460|ref|YP_003068555.1| GTP cyclohydrolase I [Methylobacterium extorquens DM4]
 gi|28207560|gb|AAO32149.1| GTP synthase [Methylobacterium extorquens AM1]
 gi|163663293|gb|ABY30660.1| GTP cyclohydrolase I [Methylobacterium extorquens PA1]
 gi|218522797|gb|ACK83382.1| GTP cyclohydrolase I [Methylobacterium chloromethanicum CM4]
 gi|240008825|gb|ACS40051.1| GTP cyclohydrolase I [Methylobacterium extorquens AM1]
 gi|254268738|emb|CAX24699.1| GTP cyclohydrolase I [Methylobacterium extorquens DM4]
          Length = 269

 Score =  201 bits (511), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 131/196 (66%), Gaps = 2/196 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
            + L +P+ +EA+ A+R +LRW GDDP REGL +TP RV+K+Y+++F GY+         
Sbjct: 75  EVALGRPSRQEAEAAVRTLLRWAGDDPTREGLIETPARVVKAYEQIFGGYRA--DADALL 132

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E   Y D VL++DI F+S+CEHH++P  G  H+AY P K V+GLSKL R+++ ++
Sbjct: 133 ERVFEEVEGYSDAVLVRDIPFYSHCEHHMVPFMGLAHIAYYPTKGVVGLSKLARVVDAFA 192

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQ QE +T QIA  IES    +G AV+IE +H+CM+MRG+++ G++T+TT F G +  
Sbjct: 193 RRLQTQETMTAQIADTIESILQPRGCAVMIEAEHLCMAMRGVQKAGVSTITTQFRGVYKN 252

Query: 190 DKGKTDFFLKMTHNQR 205
           D  +   FL    NQ+
Sbjct: 253 DASEQVRFLTFVRNQK 268


>gi|163797279|ref|ZP_02191232.1| GTP cyclohydrolase I [alpha proteobacterium BAL199]
 gi|159177370|gb|EDP61926.1| GTP cyclohydrolase I [alpha proteobacterium BAL199]
          Length = 210

 Score =  201 bits (511), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 91/187 (48%), Positives = 131/187 (70%), Gaps = 2/187 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           +KPT E+A+ A+R ++ WIG+DP+REGL DTP RV++SY+ELF GY   P       F  
Sbjct: 21  RKPTREQAERAVRTLIEWIGEDPEREGLTDTPARVVRSYEELFGGYLHDPAELLARTFE- 79

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y ++VL+K + F S+CEHH+LPI G  H+AY P+  V+G+SKL R+++ Y++R+Q
Sbjct: 80  -EVASYDEIVLLKGVRFESFCEHHMLPIVGVAHVAYFPRGRVVGISKLARVIDAYAKRMQ 138

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQERLT QIA +I+S+ D  GVAV+IE +H CMS RG+ + G++ VTT   G F  D  +
Sbjct: 139 IQERLTAQIAESIQSALDPIGVAVMIESEHQCMSARGVHKQGVSMVTTRMLGCFKDDPER 198

Query: 194 TDFFLKM 200
              FL++
Sbjct: 199 RREFLQL 205


>gi|158422566|ref|YP_001523858.1| GTP cyclohydrolase I [Azorhizobium caulinodans ORS 571]
 gi|172047839|sp|A8HUG2|GCH1_AZOC5 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|158329455|dbj|BAF86940.1| GTP cyclohydrolase I [Azorhizobium caulinodans ORS 571]
          Length = 218

 Score =  201 bits (510), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 131/191 (68%), Gaps = 2/191 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+ A+R +L +IG+DP REGL++TP RVI+SY E++ GY   P   D     FG
Sbjct: 30  RPSRAEAEAAVRTLLAYIGEDPHREGLQETPARVIRSYDEIYGGYALSP--DDVLDRTFG 87

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   + D VL+KDI F S+CEHH++P  GK H+AY P + V+GLSK+ R++++Y+RRLQ 
Sbjct: 88  EIGSFDDFVLLKDIPFTSHCEHHMVPFMGKAHVAYFPVERVVGLSKIARLVDLYARRLQT 147

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QI  A++ +   +GVAV+IE +HMCMSMRGI + G+TT+T+ FTG F  D  + 
Sbjct: 148 QEHLTSQITTALDEALKPRGVAVMIEAEHMCMSMRGILKPGVTTLTSQFTGAFRDDPAEQ 207

Query: 195 DFFLKMTHNQR 205
             F+ M    R
Sbjct: 208 VRFITMLRGLR 218


>gi|154253105|ref|YP_001413929.1| GTP cyclohydrolase I [Parvibaculum lavamentivorans DS-1]
 gi|154157055|gb|ABS64272.1| GTP cyclohydrolase I [Parvibaculum lavamentivorans DS-1]
          Length = 222

 Score =  201 bits (510), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 131/189 (69%), Gaps = 2/189 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           +++KP+ E A+ A+R ++ W GD+P REGL DTP RV+++Y+E F GY + P  + T  F
Sbjct: 32  QVEKPSREAAEAAVRTLIAWAGDNPQREGLIDTPGRVVRAYEEFFEGYNEDPYKELTRTF 91

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
              E   Y DMV+++DI+  S+CEHH++ I GK H+AY+P K V+G+SKL R++E+YS+R
Sbjct: 92  E--EVEGYNDMVMLRDINIESHCEHHMVAILGKAHVAYVPTKKVVGISKLARVIEIYSKR 149

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ QE +T QIA  I ++   +GVA+LIE +H CM+ RGIK+  + T+TT FTG F  D 
Sbjct: 150 LQTQETMTAQIAETINAALQPQGVAILIEAKHQCMTTRGIKKPDVATITTQFTGVFRDDP 209

Query: 192 GKTDFFLKM 200
                F++M
Sbjct: 210 RMESRFMQM 218


>gi|170735312|ref|YP_001774426.1| GTP cyclohydrolase I [Burkholderia cenocepacia MC0-3]
 gi|169821350|gb|ACA95931.1| GTP cyclohydrolase I [Burkholderia cenocepacia MC0-3]
          Length = 211

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 129/186 (69%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT++EA+EA+R ++RW GDDP REGL  TP RV ++Y+E FAGY+  P     + F   
Sbjct: 16  RPTLDEAEEAVRTLIRWAGDDPGREGLVQTPARVARAYREFFAGYETDPIQILATTF--S 73

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MV++KDI F SYCEHH++PI G+ H+AY+P  HV+G+SKL R+++VY++RLQI
Sbjct: 74  EVDGYDEMVVLKDIRFESYCEHHMVPIIGRAHVAYLPDHHVVGISKLARLVDVYAKRLQI 133

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA A+ +    KGVAV++E  H CMS RG+ + G + VT+   G F  D    
Sbjct: 134 QEKMTVQIADALNTVLKPKGVAVILEAAHQCMSTRGVHKPGASLVTSRMLGAFRDDPATR 193

Query: 195 DFFLKM 200
             FL +
Sbjct: 194 REFLSI 199


>gi|288959685|ref|YP_003450026.1| GTP cyclohydrolase I [Azospirillum sp. B510]
 gi|288911993|dbj|BAI73482.1| GTP cyclohydrolase I [Azospirillum sp. B510]
          Length = 211

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 94/189 (49%), Positives = 129/189 (68%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+EA+R ++RW GDDP REGL  TPDRV++SY E FAGY   P  +  SR  F 
Sbjct: 18  RPSRAEAEEAVRTLIRWAGDDPTREGLVGTPDRVVRSYDEFFAGYGIDPV-EILSRT-FE 75

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MV+++DI   SYCEHH++PI GK H+AY+P++ V+G+SKL R++E Y +RLQI
Sbjct: 76  ETDGYDEMVVLRDIRVESYCEHHMVPIIGKAHVAYLPRRRVVGISKLARLVEAYGKRLQI 135

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T QIA+ I+     +GVAV+IE QH CM+ RG+ + G+T VT+   G F  D    
Sbjct: 136 QEKMTAQIANTIDEVLQPEGVAVVIEAQHQCMTTRGVHKTGVTMVTSRMLGAFRSDPSTR 195

Query: 195 DFFLKMTHN 203
             FL M  N
Sbjct: 196 REFLTMIGN 204


>gi|296536730|ref|ZP_06898789.1| GTP cyclohydrolase I [Roseomonas cervicalis ATCC 49957]
 gi|296262943|gb|EFH09509.1| GTP cyclohydrolase I [Roseomonas cervicalis ATCC 49957]
          Length = 219

 Score =  201 bits (510), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 87/187 (46%), Positives = 130/187 (69%), Gaps = 2/187 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ E+A+EA+R +L W GDDP REGL+DTP RV ++Y+E F+GY++ P       F   
Sbjct: 27  RPSREQAEEAVRTLLLWAGDDPGREGLRDTPARVARAYEEFFSGYQEDPVALLARSFE-- 84

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MV+++DI   S+CEHH++PI G+ H+AY+P+  V+G+SKL R++E Y+RRLQI
Sbjct: 85  ETEGYDEMVVLRDIRVESHCEHHMVPIIGRAHVAYLPEGRVVGISKLARVVEAYARRLQI 144

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE+LT Q+A++I+     +GVAV+IE  H CM+ RG+ + G++ +T+   G F  D G  
Sbjct: 145 QEKLTAQVANSIQEVLRPRGVAVVIEASHQCMTTRGVHKPGVSMITSRMLGAFREDAGLR 204

Query: 195 DFFLKMT 201
             FL MT
Sbjct: 205 REFLAMT 211


>gi|260459846|ref|ZP_05808100.1| GTP cyclohydrolase I [Mesorhizobium opportunistum WSM2075]
 gi|259034648|gb|EEW35905.1| GTP cyclohydrolase I [Mesorhizobium opportunistum WSM2075]
          Length = 211

 Score =  200 bits (509), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 124/173 (71%), Gaps = 2/173 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  E + A+R +LRW GD+PDREGL DTP RV K+Y+E+F GY   P  +    F   
Sbjct: 22  RPSEAEVEAAVRTLLRWTGDNPDREGLVDTPKRVAKAYREMFGGYDMCPAEELGRTFE-- 79

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D+V++KDI F S+CEHH++PI GK H+ Y+P   V+GLSK+ R++++++ RLQ 
Sbjct: 80  EVAGYDDLVIVKDIQFHSHCEHHMVPIIGKAHVGYLPDGKVVGLSKIARVVDIFAHRLQT 139

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           QE LT QIA  I+   + +GVAV+IE +HMCM+MRGI++ G TT+T+ FTG F
Sbjct: 140 QEALTAQIAGVIQDVLNPRGVAVMIEAEHMCMAMRGIRKQGSTTLTSTFTGVF 192


>gi|297172476|gb|ADI23448.1| GTP cyclohydrolase I [uncultured nuHF1 cluster bacterium
           HF0770_35I22]
          Length = 214

 Score =  200 bits (509), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 128/187 (68%), Gaps = 2/187 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +PT  EA+EA+RV++RW GDDP REGL +TP RV++SY+E F+GY   P +     F  
Sbjct: 18  NRPTRSEAEEAVRVLIRWAGDDPSREGLIETPARVVRSYEEFFSGYSLCPKSFLERTFE- 76

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y ++VL++DI F S+CEHH+ PI G++H+AY+P K V+G+SKL R++E Y++RLQ
Sbjct: 77  -ETGGYDEIVLLRDIRFESHCEHHMAPIIGRVHVAYLPDKRVVGISKLARLVETYAKRLQ 135

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T  IA  I +    KGVAV+IEG H CM+ RG+++ G+T VT+   G F  +   
Sbjct: 136 IQEKMTADIASTINNVLAPKGVAVVIEGAHQCMTTRGVQKSGVTMVTSQMLGAFRTNSST 195

Query: 194 TDFFLKM 200
              FL M
Sbjct: 196 RREFLSM 202


>gi|86749305|ref|YP_485801.1| GTP cyclohydrolase I [Rhodopseudomonas palustris HaA2]
 gi|123004255|sp|Q2IY20|GCH1_RHOP2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|86572333|gb|ABD06890.1| GTP cyclohydrolase [Rhodopseudomonas palustris HaA2]
          Length = 229

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 132/190 (69%), Gaps = 2/190 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+ A++ +L +IG++ +REGL DTP RV+++Y ELF GY Q P   +     FG
Sbjct: 41  RPSRAEAEAAVKTLLSYIGENTEREGLLDTPRRVVEAYDELFQGYHQCPA--EVLDRTFG 98

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VL++DISF S+CEHH++P +GK H+AY P + V+GLSKL R++E+++RRLQ 
Sbjct: 99  ETAGYDDFVLVRDISFTSHCEHHVMPFYGKAHIAYTPVERVVGLSKLARLVEIFARRLQT 158

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QIA AI+     +GVAV+IE +H CMS+RGI + G +T T+ +TG F  +  + 
Sbjct: 159 QEHLTAQIAAAIDEVLKPRGVAVMIEAEHTCMSVRGIGKQGASTFTSRYTGMFRDNPAEQ 218

Query: 195 DFFLKMTHNQ 204
             F+ M  N+
Sbjct: 219 ARFMSMIRNR 228


>gi|222148630|ref|YP_002549587.1| GTP cyclohydrolase I [Agrobacterium vitis S4]
 gi|254791029|sp|B9JWF1|GCH1_AGRVS RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|221735616|gb|ACM36579.1| GTP cyclohydrolase I [Agrobacterium vitis S4]
          Length = 201

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 133/190 (70%), Gaps = 2/190 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA+ A+R +LRW GDDP REGL DTP RV K+Y ELF GY      +D     F 
Sbjct: 14  RPSREEAENAVRTLLRWAGDDPSREGLLDTPKRVAKAYGELFGGYNV--NVEDVLGTTFE 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y D+VL++DI FFS+CEHH+LP+ GK H+AY+P   V+GLSK+ R++++++RRLQ 
Sbjct: 72  EVGGYNDIVLVRDIPFFSHCEHHMLPVIGKAHVAYLPNGRVLGLSKIARVVDLFARRLQT 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA ++      +GVAV+++ +HMCM+MRGI++ G TT+TT FTGEF  D  + 
Sbjct: 132 QETMTAQIADSLVQYLQPRGVAVMVDAEHMCMAMRGIQKSGSTTLTTTFTGEFKTDVPQQ 191

Query: 195 DFFLKMTHNQ 204
             F+ M  N+
Sbjct: 192 VRFMTMVQNR 201


>gi|167042086|gb|ABZ06821.1| putative GTP cyclohydrolase I [uncultured marine microorganism
           HF4000_141I21]
          Length = 203

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 132/200 (66%), Gaps = 3/200 (1%)

Query: 1   MKCLR-TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY 59
           MK ++ T   + K +K + E+A+EAI+ I+ W+G+DP+REGLK TP RVIK+YKE F GY
Sbjct: 1   MKLVKDTDQLHGKNQKISDEKAEEAIKTIIEWVGEDPEREGLKSTPRRVIKAYKEYFQGY 60

Query: 60  KQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLS 119
           KQ P    T  F   E   Y DMV+ K+IS  S+CEHHI PI G  H+AYIP K V+GLS
Sbjct: 61  KQDPAEYLTKTF--TEVEGYDDMVIEKNISIRSHCEHHIAPIIGVAHVAYIPSKKVVGLS 118

Query: 120 KLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTV 179
           KL R++E +S+RLQ QERLTMQIA  I      +GVAV I   H CM+ RGIK++  TT+
Sbjct: 119 KLARVVEAFSKRLQTQERLTMQIAKTIMDVLQPRGVAVTINAAHQCMTNRGIKKENTTTI 178

Query: 180 TTAFTGEFSRDKGKTDFFLK 199
           T  F G F  D    + +L+
Sbjct: 179 TNNFLGVFKDDLSYQNRYLR 198


>gi|83591611|ref|YP_425363.1| GTP cyclohydrolase I [Rhodospirillum rubrum ATCC 11170]
 gi|83574525|gb|ABC21076.1| GTP cyclohydrolase [Rhodospirillum rubrum ATCC 11170]
          Length = 234

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 131/191 (68%), Gaps = 2/191 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           KP+  EA+ A+R ++RW GDDP+REGL DTP RV +SY+ELF+GY   P  +D  R  F 
Sbjct: 40  KPSRAEAEAAVRTLIRWAGDDPNREGLIDTPARVARSYEELFSGYGADP--EDLLRRTFE 97

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y ++VL++DI   S+CEHH++PI GK+H+ Y+P + V+G+SKL R+ EVY++RLQI
Sbjct: 98  EVEGYDEVVLLRDIRIESHCEHHMVPIIGKVHIGYLPNRRVVGISKLARVAEVYAKRLQI 157

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T QIA+AI +  + +GVAV++E  H CM+ RG+ + G+T VT+   G F  +    
Sbjct: 158 QEKMTAQIANAINAVLEPRGVAVVVEAAHQCMTTRGVHKPGVTMVTSRMLGAFRTNSDTR 217

Query: 195 DFFLKMTHNQR 205
             FL +    R
Sbjct: 218 REFLHLIGQTR 228


>gi|144898676|emb|CAM75540.1| GTP cyclohydrolase I [Magnetospirillum gryphiswaldense MSR-1]
          Length = 203

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 129/186 (69%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+ A+R +++W GDDPDREGL  TPDRV++SY+E FAGY Q P   +  +  F 
Sbjct: 18  RPSRSEAESAVRTLIQWAGDDPDREGLVATPDRVVRSYEEFFAGYDQDPV--EMLQRTFE 75

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MV+++DI+  S+CEHH++PI GK H+AY+P + V+G+SKL R++EV+S+RLQI
Sbjct: 76  ETDGYDEMVILRDITLESHCEHHMVPIVGKAHVAYLPDRRVVGISKLARVVEVFSKRLQI 135

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE+LT QIA+ I      KGVAV+IE  H CM+ RG+ + G+T VT+   G F  +    
Sbjct: 136 QEKLTAQIANTINEVLQPKGVAVIIEAAHQCMTTRGVHKPGVTMVTSRMLGVFRENAATR 195

Query: 195 DFFLKM 200
             F+ +
Sbjct: 196 KEFMSL 201


>gi|15889053|ref|NP_354734.1| GTP cyclohydrolase I [Agrobacterium tumefaciens str. C58]
 gi|23821602|sp|Q8UEK8|GCH1_AGRT5 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|15156850|gb|AAK87519.1| GTP cyclohydrolase I [Agrobacterium tumefaciens str. C58]
          Length = 208

 Score =  200 bits (508), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 137/190 (72%), Gaps = 2/190 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+EA+RV+LRW G++P REGL DTP RV K+Y+ELFAGY+     QD     F 
Sbjct: 21  RPSQAEAEEAVRVLLRWAGENPAREGLLDTPKRVAKAYRELFAGYEL--NVQDVLGTTFE 78

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y D+VL++DI FFS+CEHH++PI GK H+AY+P   V+GLSK+ R++E++ RRLQ 
Sbjct: 79  EVGGYDDVVLVRDIPFFSHCEHHMVPIVGKAHVAYLPAGRVLGLSKIARVVEIFGRRLQT 138

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA +IE +   +GVAV+I+ +HMCMSMRG+ + G TT+TT+FTG F  D  + 
Sbjct: 139 QENMTAQIARSIEETLKPRGVAVMIDAEHMCMSMRGVNKQGSTTLTTSFTGTFKNDPAEQ 198

Query: 195 DFFLKMTHNQ 204
             F+ M  N+
Sbjct: 199 VRFMTMVRNR 208


>gi|319783893|ref|YP_004143369.1| GTP cyclohydrolase I [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169781|gb|ADV13319.1| GTP cyclohydrolase I [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 211

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 125/173 (72%), Gaps = 2/173 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  E + A+R +LRW GD+PDREGL DTP RV K+++E+F GY   P   D     F 
Sbjct: 22  RPSEAEVEAAVRTLLRWTGDNPDREGLVDTPKRVAKAFREMFGGYDMCPA--DELGRTFE 79

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D+V++KDI+F S+CEHH++PI GK H+ Y+P   V+GLSK+ R++++++ RLQ 
Sbjct: 80  EVAGYDDLVIVKDITFHSHCEHHMVPIIGKAHVGYLPDGKVVGLSKIARVVDIFAHRLQT 139

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           QE LT QIA  I+   + +GVAV+IE +HMCM+MRGI++ G TT+T+ FTG F
Sbjct: 140 QEALTAQIAGVIQDVLNPRGVAVMIEAEHMCMAMRGIRKQGSTTLTSTFTGVF 192


>gi|325293132|ref|YP_004278996.1| GTP cyclohydrolase I [Agrobacterium sp. H13-3]
 gi|325060985|gb|ADY64676.1| GTP cyclohydrolase I [Agrobacterium sp. H13-3]
          Length = 208

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 137/190 (72%), Gaps = 2/190 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+EA+RV+LRW G++P REGL DTP RV K+Y+ELFAGY+     QD     F 
Sbjct: 21  RPSQTEAEEAVRVLLRWAGENPAREGLLDTPKRVAKAYRELFAGYEL--NVQDVLGTTFE 78

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y D+VL++DI FFS+CEHH++PI GK H+AY+P   V+GLSK+ R++E++ RRLQ 
Sbjct: 79  EVGGYDDVVLVRDIPFFSHCEHHMVPIVGKAHVAYLPAGRVLGLSKIARVVEIFGRRLQT 138

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA +IE +   +GVAV+I+ +HMCMSMRG+ + G TT+TT+FTG F  D  + 
Sbjct: 139 QENMTAQIARSIEETLKPRGVAVMIDAEHMCMSMRGVNKQGSTTLTTSFTGTFKNDPAEQ 198

Query: 195 DFFLKMTHNQ 204
             F+ M  N+
Sbjct: 199 VRFMTMVRNR 208


>gi|167042014|gb|ABZ06750.1| putative GTP cyclohydrolase I [uncultured marine microorganism
           HF4000_141F21]
          Length = 203

 Score =  198 bits (504), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/200 (50%), Positives = 131/200 (65%), Gaps = 3/200 (1%)

Query: 1   MKCLR-TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY 59
           MK ++ T     K +K + E+A+EAI+ I++W+G+DP+REGLK TP RVIK+YKE F GY
Sbjct: 1   MKLVKDTDQLQRKNQKISDEKAEEAIKTIIQWVGEDPEREGLKSTPRRVIKAYKEYFQGY 60

Query: 60  KQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLS 119
            Q P    T  F   E   Y DMV+ K+IS  S+CEHHI PI G  H+AYIP K V+GLS
Sbjct: 61  NQDPAEYLTKTF--TEVEGYDDMVIEKNISIRSHCEHHIAPIIGVAHVAYIPSKKVVGLS 118

Query: 120 KLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTV 179
           KL R++E +S+RLQ QERLTMQIA  I      +GVAV I   H CM+ RGIK++  TT+
Sbjct: 119 KLARVVEAFSKRLQTQERLTMQIAKTIMDVLKPRGVAVTINAAHQCMTNRGIKKENTTTI 178

Query: 180 TTAFTGEFSRDKGKTDFFLK 199
           T  F G F  D    + +L+
Sbjct: 179 TNNFLGVFKDDLSFQNRYLR 198


>gi|297170774|gb|ADI21795.1| GTP cyclohydrolase I [uncultured nuHF1 cluster bacterium
           HF0130_24M16]
 gi|297181552|gb|ADI17737.1| GTP cyclohydrolase I [uncultured nuHF1 cluster bacterium
           HF0130_31E21]
          Length = 213

 Score =  198 bits (504), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 132/190 (69%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           +KP+ EEA+EA++ ++RW GD+P REGL +TP RV+++Y+E F GY   P  +   +  F
Sbjct: 17  RKPSREEAEEAVKTLIRWAGDNPTREGLVETPSRVVRAYEEFFTGYSICP--KSFLKRTF 74

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y ++VL++DI F S+CEHH++PI GKIH+AY+P + V+G+SKL R+++VY++RLQ
Sbjct: 75  EETAGYDEIVLLRDIRFESHCEHHMVPIIGKIHIAYLPDQRVVGISKLARLVDVYAKRLQ 134

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T +IA  I      KGVAV+IEG H CM+ RG+ + G++ VT+   G F  D   
Sbjct: 135 IQEKMTAEIASTINEVLSPKGVAVVIEGVHQCMTTRGVFKPGVSMVTSQMLGAFRTDPST 194

Query: 194 TDFFLKMTHN 203
              FL M  N
Sbjct: 195 RREFLSMIGN 204


>gi|209884763|ref|YP_002288620.1| GTP cyclohydrolase I [Oligotropha carboxidovorans OM5]
 gi|209872959|gb|ACI92755.1| GTP cyclohydrolase I [Oligotropha carboxidovorans OM5]
          Length = 227

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 128/186 (68%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT EEA+ A++ +L +IG++P REGL DTP R++++Y ELF GY Q P   +     FG
Sbjct: 33  RPTREEAESAVKTLLSYIGENPSREGLLDTPRRMVEAYDELFQGYHQCPA--EVLNRTFG 90

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VLI+DI F S+CEHH++P +GK H+AY P   V+GLSK+ R+++ ++ RLQ 
Sbjct: 91  ETAGYDDFVLIRDIEFHSHCEHHVMPFYGKAHIAYTPVDRVVGLSKIARLVDAFAHRLQT 150

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QIA A++     +GVAVL+E +H CMS+RGI + G  TVT+ FTG F  +  + 
Sbjct: 151 QEHLTAQIAAALDKVLQPRGVAVLLEAEHTCMSVRGIAKHGAKTVTSRFTGMFYDNPDEQ 210

Query: 195 DFFLKM 200
           + FL M
Sbjct: 211 NRFLHM 216


>gi|328543259|ref|YP_004303368.1| GTP cyclohydrolase 1 [polymorphum gilvum SL003B-26A1]
 gi|326413005|gb|ADZ70068.1| GTP cyclohydrolase 1 [Polymorphum gilvum SL003B-26A1]
          Length = 211

 Score =  198 bits (504), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 133/189 (70%), Gaps = 2/189 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           ++ +P+ EEA+ A+R +L WIGDDP+REGL DTP RV+K+Y E+  GY + P  ++  + 
Sbjct: 19  EVARPSREEAEAAVRTLLAWIGDDPEREGLLDTPKRVVKAYTEVLGGYFEDP--EEHLQR 76

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F +   Y ++++++DI F S+CEHH+LP  G  H+AY P   V+GLSKL R++++Y+RR
Sbjct: 77  TFEDVGGYDELIMVRDIPFHSFCEHHMLPFIGTAHIAYYPSGGVVGLSKLARVVDIYARR 136

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ QE LT QI  AI+S    +G+AV++E +H CM+MRG+++ G++T+TT FTG F  D 
Sbjct: 137 LQTQEHLTAQIVSAIDSHLAPRGLAVMLEAEHQCMTMRGVQKQGVSTITTQFTGVFQDDP 196

Query: 192 GKTDFFLKM 200
            +   F+ +
Sbjct: 197 SEQVRFITL 205


>gi|316933351|ref|YP_004108333.1| GTP cyclohydrolase I [Rhodopseudomonas palustris DX-1]
 gi|315601065|gb|ADU43600.1| GTP cyclohydrolase I [Rhodopseudomonas palustris DX-1]
          Length = 229

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 133/190 (70%), Gaps = 2/190 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+ A++ +L +IG++ +REGL DTP RV+++Y ELF GY Q P  ++     FG
Sbjct: 41  RPSRAEAEAAVKTLLSYIGENTEREGLLDTPRRVVEAYDELFQGYHQCP--KEVLERTFG 98

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VL+++ISF S+CEHH++P +GK H+AY P + V+GLSKL R++++++RRLQ 
Sbjct: 99  ETAGYDDFVLVRNISFTSHCEHHVMPFYGKAHIAYTPVERVVGLSKLARLVDIFARRLQT 158

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QIA AI+     +GVAVLIE +H CMS+RGI + G TT T+ +TG F  +  + 
Sbjct: 159 QEHLTAQIAAAIDEVMKPRGVAVLIEAEHTCMSVRGIAKKGATTFTSRYTGVFRDNPAEQ 218

Query: 195 DFFLKMTHNQ 204
             F+ M  ++
Sbjct: 219 ARFMSMVRDR 228


>gi|296117329|ref|ZP_06835919.1| GTP cyclohydrolase I [Gluconacetobacter hansenii ATCC 23769]
 gi|295976095|gb|EFG82883.1| GTP cyclohydrolase I [Gluconacetobacter hansenii ATCC 23769]
          Length = 204

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 126/191 (65%), Gaps = 2/191 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           +  L  PT EEA++A+R +LRW G+DP REGL DTP RV++SY+E F GY + P   D  
Sbjct: 6   SAPLPPPTREEAEDAVRTLLRWAGEDPRREGLHDTPSRVVRSYEEFFCGYAEDPV--DLL 63

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F E   Y +MVL++DI F S+CEHH++PI G  H+AY+P+K V+G+SKL R+++ Y+
Sbjct: 64  TRTFSEVEDYDEMVLLRDIRFESHCEHHMVPIIGVAHVAYLPRKRVVGISKLARVVDAYA 123

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           +R QIQERLT QIA+ I      +GV V+IE  H CM+ RG+ R G++ VT+   G F  
Sbjct: 124 KRFQIQERLTAQIANTINDVLQPRGVGVVIEASHQCMTTRGVHRPGVSMVTSRMLGTFRS 183

Query: 190 DKGKTDFFLKM 200
           +      FL +
Sbjct: 184 NSDTRREFLSI 194


>gi|85715165|ref|ZP_01046149.1| GTP cyclohydrolase I [Nitrobacter sp. Nb-311A]
 gi|85698080|gb|EAQ35953.1| GTP cyclohydrolase I [Nitrobacter sp. Nb-311A]
          Length = 232

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 129/187 (68%), Gaps = 2/187 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++P+  EA++A+R +L +IG++P+REGL DTP RVI+SY E++ GY Q P   +     F
Sbjct: 45  QRPSRHEAEDAVRTLLSYIGENPEREGLLDTPRRVIESYDEIYQGYHQCPA--EVLNRTF 102

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
           GE + Y D VL++DI F S CEHH++P +GK H+AY P + V+GLSKL R+ ++++RRLQ
Sbjct: 103 GETAGYDDFVLVRDIEFTSQCEHHMMPFYGKAHIAYTPVERVVGLSKLARLTDIFARRLQ 162

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T QIA A++     +GVAV+IE +H CMS+RG+ + G  T T+ FTG F  +  +
Sbjct: 163 TQEHMTAQIAAAVDEVLKPRGVAVMIEAEHTCMSVRGVAKHGAMTFTSRFTGVFRDNPAE 222

Query: 194 TDFFLKM 200
              FL M
Sbjct: 223 QARFLSM 229


>gi|13471052|ref|NP_102621.1| GTP cyclohydrolase I [Mesorhizobium loti MAFF303099]
 gi|23821631|sp|Q98LQ6|GCH1_RHILO RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|14021796|dbj|BAB48407.1| GTP cyclohydrolase I [Mesorhizobium loti MAFF303099]
          Length = 197

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 86/173 (49%), Positives = 124/173 (71%), Gaps = 2/173 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  E + A+R +LRW GD+PDREGL DTP RV K+++E+F GY   P  +    F   
Sbjct: 8   RPSEAEVEAAVRTLLRWTGDNPDREGLIDTPKRVAKAFREMFGGYDMCPAEELGRTFE-- 65

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D+V++KDI F S+CEHH++PI GK H+ Y+P   V+GLSK+ R++++++ RLQ 
Sbjct: 66  EVAGYDDLVIVKDIHFHSHCEHHMVPIIGKAHVGYLPDGKVVGLSKIARVVDIFAHRLQT 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           QE LT QIA  I+   + +GVAV+IE +HMCM+MRGI++ G TT+T+ FTG F
Sbjct: 126 QEALTAQIAGVIQDVLNPRGVAVMIEAEHMCMAMRGIRKQGSTTLTSTFTGVF 178


>gi|304391872|ref|ZP_07373814.1| GTP cyclohydrolase I [Ahrensia sp. R2A130]
 gi|303296101|gb|EFL90459.1| GTP cyclohydrolase I [Ahrensia sp. R2A130]
          Length = 211

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 128/176 (72%), Gaps = 2/176 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           KPT  EA+ A++ +LRW GDD  REGL+DTP RV KSY ELF+GY + PT      F   
Sbjct: 23  KPTRAEAEAAVKTLLRWSGDDITREGLQDTPARVAKSYSELFSGYGEDPTEALGRTFE-- 80

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E S Y DMV+I+DI F S+CEHH++PI GK H+ Y+P   V+GLSK+ R++++++RRLQ 
Sbjct: 81  EVSGYDDMVVIRDIHFHSHCEHHMVPIIGKAHVGYLPDGKVVGLSKIARVVDIFARRLQT 140

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           QE LT QIAH I+   + +GVAV+IE QHMCM MRGIK+DG TT+TT FTG +  D
Sbjct: 141 QEALTSQIAHTIQDVLEPRGVAVMIEAQHMCMVMRGIKKDGSTTLTTTFTGAYRDD 196


>gi|126658689|ref|ZP_01729834.1| GTP cyclohydrolase I [Cyanothece sp. CCY0110]
 gi|126619951|gb|EAZ90675.1| GTP cyclohydrolase I [Cyanothece sp. CCY0110]
          Length = 218

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 99/196 (50%), Positives = 133/196 (67%), Gaps = 8/196 (4%)

Query: 14  KKPTV--EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSR 70
           ++P V  EE ++A+R +L  +G+DPDREGLKDTP RV+K+ K L +GY Q +    + + 
Sbjct: 25  QQPPVSEEEMRQAVRTLLLGLGEDPDREGLKDTPKRVVKALKFLTSGYHQSLDELLNGAV 84

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
           FH        +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y R
Sbjct: 85  FH----ENANEMVLVRDIDLFSSCEHHILPILGRAHVAYIPDGKVIGLSKIARICEMYGR 140

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ+QERLT QIA A++     KGVAV++E  HMCM MRG+++ G  T T+A  GEF+ D
Sbjct: 141 RLQVQERLTAQIADALQGLLQPKGVAVVVEATHMCMVMRGVQKPGSWTSTSALRGEFAND 200

Query: 191 -KGKTDFFLKMTHNQR 205
            K + +F   + HN R
Sbjct: 201 AKTRQEFMSLIQHNPR 216


>gi|92117205|ref|YP_576934.1| GTP cyclohydrolase I [Nitrobacter hamburgensis X14]
 gi|91800099|gb|ABE62474.1| GTP cyclohydrolase I [Nitrobacter hamburgensis X14]
          Length = 234

 Score =  198 bits (503), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 129/186 (69%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+ A+R +L +IG++PDREGL DTP RVI++Y E++ GY Q P   +     FG
Sbjct: 47  RPSRHEAEYAVRTLLSYIGENPDREGLLDTPRRVIEAYDEIYQGYHQCPA--EVLNRTFG 104

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VL++DI+F S CEHH++P +GK H+AY P + V+GLSKL R+ ++++RRLQ 
Sbjct: 105 ETAGYDDFVLVRDIAFTSQCEHHMMPFYGKAHIAYTPVERVVGLSKLARLTDIFARRLQT 164

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA A++     +GVAV+IE +H CMS+RG+ + G  T+T+ FTG F  +  + 
Sbjct: 165 QEHMTAQIAAAVDEVLKPRGVAVMIEAEHTCMSVRGVAKHGALTLTSRFTGVFRDNPAEQ 224

Query: 195 DFFLKM 200
             FL M
Sbjct: 225 ARFLSM 230


>gi|118591261|ref|ZP_01548660.1| GTP cyclohydrolase I [Stappia aggregata IAM 12614]
 gi|118436337|gb|EAV42979.1| GTP cyclohydrolase I [Stappia aggregata IAM 12614]
          Length = 211

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 133/193 (68%), Gaps = 2/193 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           +L +P+ EEA+ A+R +L W GDDPDREGL +TP RV+K+  +L++GY + P       F
Sbjct: 19  QLHRPSREEAEAAVRTLLAWTGDDPDREGLVETPKRVVKALSQLYSGYYEDPAEHLARTF 78

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
              +   Y+D+VL++ I F S+CEHH+LP  G+ H+AY P + V+GLSKL R++++Y++R
Sbjct: 79  E--DVGGYKDIVLVRGIPFHSHCEHHMLPFIGEAHIAYYPAEGVVGLSKLARVVDIYAKR 136

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ QE LT QIA  I+ +   +G+AV++E +H CM+MRG+++ G++T+TT FTG F  D 
Sbjct: 137 LQTQENLTAQIASVIDDALAPRGLAVMLEAEHQCMTMRGVQKPGVSTITTQFTGVFQDDP 196

Query: 192 GKTDFFLKMTHNQ 204
            +   F+ +   +
Sbjct: 197 AEQAKFMSLVRGK 209


>gi|154245593|ref|YP_001416551.1| GTP cyclohydrolase I [Xanthobacter autotrophicus Py2]
 gi|154159678|gb|ABS66894.1| GTP cyclohydrolase I [Xanthobacter autotrophicus Py2]
          Length = 242

 Score =  197 bits (501), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 133/190 (70%), Gaps = 2/190 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ +EA+ A+R +L +IG+DP REGL DTP RV+K+Y ELF+GY +   +++     FG
Sbjct: 54  RPSRQEAEAAVRTLLAYIGEDPAREGLLDTPKRVVKAYDELFSGYGE--DSEELLERTFG 111

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   + D VL++DI F S+CEHH++P  GK H+AY P + V+GLSK+ R++++++RRLQ 
Sbjct: 112 EIGTFDDFVLVRDIPFHSHCEHHMVPFVGKAHIAYFPVERVVGLSKIARVVDIFARRLQT 171

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QI   ++     +GVAV+IE +HMCMSMRGI + G++T+TT FTG F  D  + 
Sbjct: 172 QEHLTSQITTTLDEGLRPRGVAVMIEAEHMCMSMRGITKQGVSTLTTQFTGVFRDDPAEQ 231

Query: 195 DFFLKMTHNQ 204
             F+ +  ++
Sbjct: 232 VRFITLVRSK 241


>gi|299135296|ref|ZP_07028487.1| GTP cyclohydrolase I [Afipia sp. 1NLS2]
 gi|298590273|gb|EFI50477.1| GTP cyclohydrolase I [Afipia sp. 1NLS2]
          Length = 227

 Score =  197 bits (501), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 130/192 (67%), Gaps = 2/192 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +P+ + A++A++ +L +IG++PDREGL DTP R++++Y ELF GY Q P   +  
Sbjct: 28  NPDQPRPSRDAAEQAVKTLLAYIGENPDREGLLDTPRRMVEAYDELFQGYHQCPA--EVL 85

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              FGE + Y D VLI+DI F S+CEHH++P +GK H+AY P   V+GLSK+ R+++ ++
Sbjct: 86  NRTFGETAGYDDFVLIRDIEFHSHCEHHVMPFYGKAHIAYTPVDRVVGLSKIARLVDAFA 145

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
            RLQ QE LT QIA A++     +GVAVL+E +H CMS+RGI + G  TVT+ FTG F  
Sbjct: 146 HRLQTQEHLTAQIAAALDKVLQPRGVAVLLEAEHTCMSVRGIAKHGAKTVTSRFTGMFYD 205

Query: 190 DKGKTDFFLKMT 201
           +  + + FL M 
Sbjct: 206 NPDEQNRFLHMV 217


>gi|144898183|emb|CAM75047.1| GTP cyclohydrolase I [Magnetospirillum gryphiswaldense MSR-1]
          Length = 220

 Score =  197 bits (501), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 91/190 (47%), Positives = 128/190 (67%), Gaps = 2/190 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA+ A+R +++W GDDPDREGL  TPDRV++SY+E FAGY   P   +  +  F 
Sbjct: 25  RPSREEAEAAVRTLIQWAGDDPDREGLVGTPDRVVRSYEEFFAGYDLDPV--EMLKRTFE 82

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MV+++DI   S+CEHH++PI GK H+AY+P + V+G+SKL R++EV+S+RLQI
Sbjct: 83  ETDGYDEMVILRDIRLESHCEHHMVPIIGKAHVAYLPDRRVVGISKLARVVEVFSKRLQI 142

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE+LT QIA+ I      KGVAV+IE  H CM+ RGI + G+T VT+   G F       
Sbjct: 143 QEKLTAQIANTINEVLQPKGVAVIIEAAHQCMTTRGIHKPGVTMVTSRMLGVFRDHPPTR 202

Query: 195 DFFLKMTHNQ 204
             F+ +   Q
Sbjct: 203 KEFMSLVQGQ 212


>gi|39936454|ref|NP_948730.1| GTP cyclohydrolase I [Rhodopseudomonas palustris CGA009]
 gi|192292240|ref|YP_001992845.1| GTP cyclohydrolase I [Rhodopseudomonas palustris TIE-1]
 gi|81562033|sp|Q6N4E7|GCH1_RHOPA RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|229487982|sp|B3QE25|GCH1_RHOPT RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|39650309|emb|CAE28832.1| possible GTP cyclohydrolase I [Rhodopseudomonas palustris CGA009]
 gi|192285989|gb|ACF02370.1| GTP cyclohydrolase I [Rhodopseudomonas palustris TIE-1]
          Length = 229

 Score =  197 bits (501), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 133/190 (70%), Gaps = 2/190 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+ A++ +L +IG++ +REGL DTP RV+++Y ELF GY Q P  ++     FG
Sbjct: 41  RPSRAEAEAAVKTLLSYIGENTEREGLIDTPRRVVEAYDELFQGYHQCP--KEVLERTFG 98

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VL+++ISF S+CEHH++P +GK H+AY P + V+GLSKL R++++++RRLQ 
Sbjct: 99  ETAGYDDFVLVRNISFTSHCEHHVMPFYGKAHIAYTPVERVVGLSKLARLVDIFARRLQT 158

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QIA AI+     +GVAVL+E +H CMS+RGI + G TT T+ +TG F  +  + 
Sbjct: 159 QEHLTAQIAAAIDEVLKPRGVAVLLEAEHTCMSVRGIAKKGATTFTSRYTGVFRDNPAEQ 218

Query: 195 DFFLKMTHNQ 204
             F+ M  ++
Sbjct: 219 ARFMSMVRDR 228


>gi|15965173|ref|NP_385526.1| GTP cyclohydrolase I [Sinorhizobium meliloti 1021]
 gi|307309187|ref|ZP_07588858.1| GTP cyclohydrolase I [Sinorhizobium meliloti BL225C]
 gi|307321517|ref|ZP_07600912.1| GTP cyclohydrolase I [Sinorhizobium meliloti AK83]
 gi|23821621|sp|Q92QB4|GCH1_RHIME RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|15074353|emb|CAC45999.1| Probable GTP cyclohydrolase I [Sinorhizobium meliloti 1021]
 gi|306892824|gb|EFN23615.1| GTP cyclohydrolase I [Sinorhizobium meliloti AK83]
 gi|306900333|gb|EFN30949.1| GTP cyclohydrolase I [Sinorhizobium meliloti BL225C]
          Length = 204

 Score =  197 bits (501), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 122/159 (76%), Gaps = 2/159 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT +EA+EA+RV+LRW G+DP REGLKDTP RV K+Y+E+F GY  +   +D     F 
Sbjct: 16  RPTQKEAEEAVRVLLRWAGEDPAREGLKDTPSRVAKAYREIFGGYDLV--AEDVLGRTFE 73

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E S Y D+VL KDI F+S+CEHH++PI GK H+AY+P   V+GLSK+ R++++Y+RRLQ 
Sbjct: 74  EVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLPNGRVLGLSKIARVVDIYARRLQT 133

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKR 173
           QE +T QIA AI+ +   +GVAV+IE +H+CM+MRGIK+
Sbjct: 134 QEAMTAQIAKAIDETLMPRGVAVMIEAEHLCMAMRGIKK 172


>gi|209520530|ref|ZP_03269287.1| GTP cyclohydrolase I [Burkholderia sp. H160]
 gi|209499014|gb|EDZ99112.1| GTP cyclohydrolase I [Burkholderia sp. H160]
          Length = 212

 Score =  197 bits (501), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 131/191 (68%), Gaps = 2/191 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +++P+ EEA+ A+RV+LRW GDDP+REGL DTP RV++SY+E FAGY QI   +  +R  
Sbjct: 15  VERPSREEAEAAVRVLLRWAGDDPNREGLIDTPARVVRSYQEFFAGY-QIDPREILAR-T 72

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RL
Sbjct: 73  FSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPSHRVVGISKLARLVDAFAKRL 132

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T+QIA  +       GV V++E  H CMS RG+ + G+T VT+   G F  D  
Sbjct: 133 QIQEKMTVQIADTLNDVLQPVGVGVILEAAHQCMSTRGVHKAGVTMVTSRMLGTFRTDPS 192

Query: 193 KTDFFLKMTHN 203
               FL +  N
Sbjct: 193 TRREFLAIVGN 203


>gi|182678551|ref|YP_001832697.1| GTP cyclohydrolase I [Beijerinckia indica subsp. indica ATCC 9039]
 gi|229487622|sp|B2IBC4|GCH1_BEII9 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|182634434|gb|ACB95208.1| GTP cyclohydrolase I [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 213

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 129/192 (67%), Gaps = 3/192 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA+ A+ V+LRW GDDP REGL+DTP RV+K+++E F+GY       D     F 
Sbjct: 23  RPSREEAEAAVEVLLRWTGDDPSREGLRDTPKRVVKAFEEFFSGYNA--DASDVLSRVFE 80

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQ 133
           E   Y +MVL++DI F S+CEHH++P +G  H+ Y P +  VIGLSKL R+++++++RLQ
Sbjct: 81  EVHGYDNMVLVRDIPFSSHCEHHMVPFFGVAHIGYYPSEAGVIGLSKLARLVDIFAKRLQ 140

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE LT QI  AI+     +G A+++E +HMCMSMRG+++ G +T+TT FTG F  D  +
Sbjct: 141 TQEALTAQIIGAIDEHLQPRGCAIMLEAEHMCMSMRGVQKHGTSTLTTQFTGVFKNDPAE 200

Query: 194 TDFFLKMTHNQR 205
              F  M  N +
Sbjct: 201 QVRFFGMVRNPK 212


>gi|67922211|ref|ZP_00515725.1| GTP cyclohydrolase I [Crocosphaera watsonii WH 8501]
 gi|67855914|gb|EAM51159.1| GTP cyclohydrolase I [Crocosphaera watsonii WH 8501]
          Length = 218

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/196 (50%), Positives = 132/196 (67%), Gaps = 8/196 (4%)

Query: 14  KKPTV--EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSR 70
           K P V  EE ++A+R +L  +G+DPDREGLKDTP RV+K+ K L +GY Q +    + + 
Sbjct: 25  KHPAVSEEEMRQAVRTLLLGLGEDPDREGLKDTPKRVVKALKFLTSGYNQSLEELLNGAV 84

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
           FH        +MVL++DI  FS CEHHILPI G++H+AYIP   VIGLSK+ RI E+Y R
Sbjct: 85  FH----EDTNEMVLVRDIDLFSSCEHHILPILGRVHVAYIPDGKVIGLSKIARICEMYGR 140

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ QERLT QIA A++     KGVAVL+E  H+C+ MRG+++ G  T T+A  GEF+ D
Sbjct: 141 RLQAQERLTAQIADALQELLKPKGVAVLVEASHLCVVMRGVQKPGAWTSTSALRGEFAND 200

Query: 191 -KGKTDFFLKMTHNQR 205
            K + +F   + HN R
Sbjct: 201 AKTRQEFMSLVQHNPR 216


>gi|148256497|ref|YP_001241082.1| GTP cyclohydrolase I [Bradyrhizobium sp. BTAi1]
 gi|146408670|gb|ABQ37176.1| GTP cyclohydrolase I [Bradyrhizobium sp. BTAi1]
          Length = 232

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 90/189 (47%), Positives = 126/189 (66%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+ A+  +L +IG+DP REGL DTP RV+++Y EL+ GY Q P   +     FG
Sbjct: 43  RPSRAEAEAAVYTLLNYIGEDPTREGLVDTPRRVVEAYDELYQGYHQCPA--EVLDRTFG 100

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VLI+DI F S CEHH++P +GK H+AY P + V+GLSKL R+ ++++RRLQ 
Sbjct: 101 ETAGYDDFVLIRDIEFTSQCEHHMMPFYGKAHIAYTPVERVVGLSKLARLTDIFARRLQT 160

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QIA AI+     +GVAV+IE +H CMS+RG+ + G  T T+ FTG F  +  + 
Sbjct: 161 QEHLTAQIAAAIDEVLKPRGVAVMIEAEHTCMSVRGVAKHGAVTFTSRFTGMFRDNPAEQ 220

Query: 195 DFFLKMTHN 203
             FL M  +
Sbjct: 221 SRFLSMVRS 229


>gi|254500660|ref|ZP_05112811.1| GTP cyclohydrolase I [Labrenzia alexandrii DFL-11]
 gi|222436731|gb|EEE43410.1| GTP cyclohydrolase I [Labrenzia alexandrii DFL-11]
          Length = 240

 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 132/189 (69%), Gaps = 2/189 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           +L++P+ EEA+ A+R IL W GDDP+REGL DTP RV+K+  +L+ GY + P       F
Sbjct: 51  QLQRPSREEAEAAVRTILAWTGDDPEREGLLDTPKRVVKAITQLYGGYFEDPAEHLERTF 110

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
              +   YQD+VL++ I F S+CEHH+LP  G+ H+AY P + V+GLSKL R+++++++R
Sbjct: 111 E--DVGGYQDIVLVRGIPFHSHCEHHMLPFVGEAHIAYYPAEGVVGLSKLARVVDIFAKR 168

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ QE LT QIA  I+ +   +G+AV++E +H CM+MRG+++ G++T+TT FTG F  D 
Sbjct: 169 LQTQENLTSQIASTIDDALAPRGLAVMMEAEHQCMTMRGVQKPGVSTITTQFTGIFEDDP 228

Query: 192 GKTDFFLKM 200
            +   F+ +
Sbjct: 229 AEQAKFMTL 237


>gi|115524357|ref|YP_781268.1| GTP cyclohydrolase I [Rhodopseudomonas palustris BisA53]
 gi|115518304|gb|ABJ06288.1| GTP cyclohydrolase [Rhodopseudomonas palustris BisA53]
          Length = 226

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 130/186 (69%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT +EA++A++ +L +IG++ +REGL DTP RV+++Y ELF GY Q P   +     FG
Sbjct: 40  RPTRDEAEQAVKTLLAYIGENTEREGLLDTPRRVVEAYDELFQGYHQCPA--EVLNRTFG 97

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VLI+D+ F S+CEHH++P +G+ H+AY P + V+GLSKL R++++++RRLQ 
Sbjct: 98  ETAGYDDFVLIRDMHFTSHCEHHVMPFYGRAHIAYTPVERVVGLSKLARLVDIFARRLQT 157

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QIA A++     +GVAV+IE +H CMS+RGI + G  T TT FTG F  +  + 
Sbjct: 158 QEHLTAQIAAAVDEVLKPRGVAVMIEAEHTCMSVRGIAKRGAMTFTTRFTGMFRDNPAEQ 217

Query: 195 DFFLKM 200
             F+ M
Sbjct: 218 ARFMTM 223


>gi|146339979|ref|YP_001205027.1| GTP cyclohydrolase I [Bradyrhizobium sp. ORS278]
 gi|146192785|emb|CAL76790.1| GTP cyclohydrolase I [Bradyrhizobium sp. ORS278]
          Length = 235

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 90/189 (47%), Positives = 126/189 (66%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+ A+  +L +IG+DP REGL DTP RV+++Y ELF GY Q P   +     FG
Sbjct: 46  RPSRAEAEAAVYTLLNYIGEDPTREGLIDTPRRVVEAYDELFQGYHQCPA--EVLDRTFG 103

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VLI+DI F S CEHH++P +G+ H+AY P + V+GLSKL R+ ++++RRLQ 
Sbjct: 104 ETAGYDDFVLIRDIEFTSQCEHHMMPFYGRAHIAYTPVERVVGLSKLARLTDIFARRLQT 163

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QIA AI+     +GVAV+IE +H CMS+RG+ + G  T T+ FTG F  +  + 
Sbjct: 164 QEHLTAQIAAAIDEVLKPRGVAVMIEAEHTCMSVRGVAKHGAVTFTSRFTGMFRDNPAEQ 223

Query: 195 DFFLKMTHN 203
             FL M  +
Sbjct: 224 SRFLSMVRS 232


>gi|323528608|ref|YP_004230760.1| GTP cyclohydrolase I [Burkholderia sp. CCGE1001]
 gi|323385610|gb|ADX57700.1| GTP cyclohydrolase I [Burkholderia sp. CCGE1001]
          Length = 212

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 128/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA+ A+RV+LRW GD+P+REGL DTP RV+++Y+E FAGY+  P  +D     F 
Sbjct: 17  RPSREEAEAAVRVLLRWAGDNPEREGLVDTPARVVRAYEEFFAGYQVDP--RDILARTFS 74

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 75  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPGHRVVGISKLARLVDAFAKRLQI 134

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +       GV V++E  H CMS RG+ + G+T VT+   G F  D    
Sbjct: 135 QEKMTVQIADTLNEVLQPAGVGVILEAAHQCMSTRGVHKAGVTMVTSRMLGTFRTDPSTR 194

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 195 REFLSIVGN 203


>gi|114771716|ref|ZP_01449120.1| GTP cyclohydrolase I [alpha proteobacterium HTCC2255]
 gi|114547788|gb|EAU50678.1| GTP cyclohydrolase I [alpha proteobacterium HTCC2255]
          Length = 207

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 132/191 (69%), Gaps = 2/191 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           KP+  EA+ A++ +LRW GD+P REGL +TP RV+K+Y + F GY++ P  Q   +  F 
Sbjct: 16  KPSQAEAEAAVQTLLRWAGDNPSREGLLETPSRVVKAYSQWFRGYREDP--QALLQRTFE 73

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MVL+KDI F SYCEHH+ PI G  H+AY+P   V+G+SKL R+++ +++RLQ+
Sbjct: 74  EVEGYNEMVLLKDIRFESYCEHHMAPIIGTAHVAYVPTDRVVGISKLARVVDAFAKRLQV 133

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T QIA+ I+     +GVAV++EG+H CMS RG+ + G++ VT+A  G+F +D+   
Sbjct: 134 QEKMTAQIANTIDEVLRPRGVAVVLEGEHHCMSTRGVNKHGVSMVTSAMRGDFQKDRELR 193

Query: 195 DFFLKMTHNQR 205
             F+ +  N R
Sbjct: 194 RDFMGIIGNPR 204


>gi|187919026|ref|YP_001888057.1| GTP cyclohydrolase I [Burkholderia phytofirmans PsJN]
 gi|187717464|gb|ACD18687.1| GTP cyclohydrolase I [Burkholderia phytofirmans PsJN]
          Length = 212

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 129/190 (67%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++P+ EEA+ A+RV+LRW GDDP REGL DTP RV++SY+E +AGY+  P  ++     F
Sbjct: 16  ERPSREEAEAAVRVLLRWAGDDPAREGLIDTPARVVRSYEEFYAGYQVDP--REILARTF 73

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P+  V+G+SKL R+++ +++RLQ
Sbjct: 74  SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPQHRVVGISKLARLVDAFAKRLQ 133

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +       GV V++E  H CMS RG+ + G+T VT+   G F  D   
Sbjct: 134 IQEKMTVQIADTLNEVLQPAGVGVILEAAHQCMSTRGVHKAGVTMVTSRMLGTFRTDPST 193

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 194 RREFLSIVGN 203


>gi|296156951|ref|ZP_06839788.1| GTP cyclohydrolase I [Burkholderia sp. Ch1-1]
 gi|295892837|gb|EFG72618.1| GTP cyclohydrolase I [Burkholderia sp. Ch1-1]
          Length = 212

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 129/190 (67%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++P+ EEA+ A+RV+LRW GDDP REGL DTP RV++SY+E +AGY+  P  ++     F
Sbjct: 16  ERPSREEAEAAVRVLLRWAGDDPAREGLIDTPARVVRSYEEFYAGYQVDP--REILARTF 73

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P+  V+G+SKL R+++ +++RLQ
Sbjct: 74  SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPQHRVVGISKLARLVDAFAKRLQ 133

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +       GV V++E  H CMS RG+ + G+T VT+   G F  D   
Sbjct: 134 IQEKMTVQIADTLNEVLQPAGVGVILEAAHQCMSTRGVHKAGVTMVTSRMLGTFRTDPST 193

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 194 RREFLSIVGN 203


>gi|162146600|ref|YP_001601059.1| GTP cyclohydrolase I [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543407|ref|YP_002275636.1| GTP cyclohydrolase I [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785175|emb|CAP54721.1| GTP cyclohydrolase I [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531084|gb|ACI51021.1| GTP cyclohydrolase I [Gluconacetobacter diazotrophicus PAl 5]
          Length = 205

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 126/178 (70%), Gaps = 2/178 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
            + L +P+ EEA++AIR +LRW G+DP REGL DTP RV++SY+E F GY + P+ +  S
Sbjct: 6   TVPLPRPSREEAEDAIRTLLRWAGEDPAREGLLDTPGRVVRSYEEFFQGYAEDPS-EILS 64

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
           R  F E   Y ++VL++DI F S+CEHH++PI G  H+AY+P K V+G+SKL R++E +S
Sbjct: 65  RT-FSEVDDYDEIVLLRDIRFESHCEHHMVPIIGVAHVAYLPGKRVVGISKLARVVEAFS 123

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           RRLQIQERLT QIA+ I       GVAV++E  H CM+ RG+ R G++ VT+   G F
Sbjct: 124 RRLQIQERLTAQIANTINDVLQPHGVAVILEAGHQCMTTRGVHRPGVSMVTSRMLGVF 181


>gi|91779454|ref|YP_554662.1| GTP cyclohydrolase [Burkholderia xenovorans LB400]
 gi|91692114|gb|ABE35312.1| GTP cyclohydrolase I [Burkholderia xenovorans LB400]
          Length = 212

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 129/190 (67%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++P+ EEA+ A+RV+LRW GDDP REGL DTP RV++SY+E +AGY+  P  ++     F
Sbjct: 16  ERPSREEAEAAVRVLLRWAGDDPAREGLIDTPARVVRSYEEFYAGYQVDP--REILARTF 73

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P+  V+G+SKL R+++ +++RLQ
Sbjct: 74  SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPEHRVVGISKLARLVDAFAKRLQ 133

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +       GV V++E  H CMS RG+ + G+T VT+   G F  D   
Sbjct: 134 IQEKMTVQIADTLNEVLQPAGVGVILEAAHQCMSTRGVHKAGVTMVTSRMLGTFRTDPST 193

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 194 RREFLSIVGN 203


>gi|254472434|ref|ZP_05085834.1| GTP cyclohydrolase I [Pseudovibrio sp. JE062]
 gi|211958717|gb|EEA93917.1| GTP cyclohydrolase I [Pseudovibrio sp. JE062]
          Length = 207

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 128/189 (67%), Gaps = 2/189 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K+PT E+A+ A+R ++ W GDDP+REGL DTP RV ++Y++ FAGY+  P    T  F  
Sbjct: 14  KRPTREDAEAAVRTLIEWSGDDPEREGLLDTPARVARAYEDFFAGYETDPKQLLTQTFE- 72

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y D+++++++   S+CEHHI+PI GK H+AY+P   V+G+SKL R++E YS+RLQ
Sbjct: 73  -ETDGYDDLIVLRNMRLESHCEHHIVPIIGKAHVAYLPAGRVVGISKLARVVEAYSKRLQ 131

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE LT QI  AI  +   +GVAV++E  HMCM+ RGI++ G++ VT  F G+F  +   
Sbjct: 132 IQETLTAQIGDAIWEALQPRGVAVIVEAAHMCMTTRGIRKPGVSMVTRYFEGDFKTNTAM 191

Query: 194 TDFFLKMTH 202
              FL + H
Sbjct: 192 RQEFLSLLH 200


>gi|153009488|ref|YP_001370703.1| GTP cyclohydrolase I [Ochrobactrum anthropi ATCC 49188]
 gi|239831907|ref|ZP_04680236.1| GTP cyclohydrolase I [Ochrobactrum intermedium LMG 3301]
 gi|166220279|sp|A6X0X0|GCH1_OCHA4 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|151561376|gb|ABS14874.1| GTP cyclohydrolase I [Ochrobactrum anthropi ATCC 49188]
 gi|239824174|gb|EEQ95742.1| GTP cyclohydrolase I [Ochrobactrum intermedium LMG 3301]
          Length = 213

 Score =  196 bits (497), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 135/187 (72%), Gaps = 2/187 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           KPT  +A+ A+R +L W GDDP+REGL +TP RV K+YKELFAGY + P  ++     F 
Sbjct: 27  KPTQADAEAAVRTLLLWAGDDPEREGLLETPKRVAKAYKELFAGYTESP--EEVLGTVFE 84

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y D+VL+KDISF S+CEHH++PI GK H+AY+P   V+GLSK+ R++++++RRLQ 
Sbjct: 85  EVGGYNDLVLVKDISFHSHCEHHMVPIIGKAHVAYLPDHKVVGLSKIARVVDIFARRLQT 144

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA +I+     +GVAV+IE +HMCM+MRGI++ G TT+TT FTGE   +  + 
Sbjct: 145 QESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRGIRKQGSTTITTTFTGEMQVNAEEQ 204

Query: 195 DFFLKMT 201
             F+ +T
Sbjct: 205 VRFMTLT 211


>gi|91977714|ref|YP_570373.1| GTP cyclohydrolase I [Rhodopseudomonas palustris BisB5]
 gi|123748925|sp|Q134L7|GCH1_RHOPS RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|91684170|gb|ABE40472.1| GTP cyclohydrolase [Rhodopseudomonas palustris BisB5]
          Length = 229

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 131/190 (68%), Gaps = 2/190 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA++A++ +L +IG++  REGL DTP RV+++Y ELF GY Q P   +     FG
Sbjct: 41  RPSRTEAEQAVKTLLAYIGENTGREGLLDTPRRVVEAYDELFQGYHQCPA--EVLDRTFG 98

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VL++DI F S+CEHH++P +GK H+AY P + V+GLSKL R++E+++RRLQ 
Sbjct: 99  ETAGYDDFVLVRDIGFTSHCEHHVMPFYGKAHIAYTPVERVVGLSKLARLVEIFARRLQT 158

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QIA AI+     +GVAV+IE +H CMS+RGI + G +T T+ +TG F  +  + 
Sbjct: 159 QEHLTAQIAAAIDEVLKPRGVAVMIEAEHTCMSVRGIGKQGASTFTSRYTGMFRDNPAEQ 218

Query: 195 DFFLKMTHNQ 204
             F+ M  ++
Sbjct: 219 ARFMSMIRSR 228


>gi|90424605|ref|YP_532975.1| GTP cyclohydrolase I [Rhodopseudomonas palustris BisB18]
 gi|122475929|sp|Q212N0|GCH1_RHOPB RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|90106619|gb|ABD88656.1| GTP cyclohydrolase [Rhodopseudomonas palustris BisB18]
          Length = 234

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 129/191 (67%), Gaps = 2/191 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA++A++ +L +IG+D  REGL DTP RV+++Y ELF GY Q P   +     FG
Sbjct: 46  RPSRGEAEQAVKTLLAYIGEDTAREGLLDTPRRVVEAYDELFQGYHQCPA--EVLNRTFG 103

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VLI+D+SF S+CEHH++P +GK H+AY P + V+GLSKL R++++++ RLQ 
Sbjct: 104 ETAGYDDFVLIRDMSFTSHCEHHVMPFYGKAHIAYTPVERVVGLSKLARLVDIFAHRLQT 163

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QIA A++     +GVAV+IE +H CMS+RGI + G  T T+ FTG F  +  + 
Sbjct: 164 QEHLTAQIAAAVDEVLKPRGVAVMIEAEHTCMSVRGIAKQGAVTFTSRFTGMFRDNPAEQ 223

Query: 195 DFFLKMTHNQR 205
             F+ M    R
Sbjct: 224 ARFMSMIRGGR 234


>gi|307727102|ref|YP_003910315.1| GTP cyclohydrolase I [Burkholderia sp. CCGE1003]
 gi|307587627|gb|ADN61024.1| GTP cyclohydrolase I [Burkholderia sp. CCGE1003]
          Length = 212

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA+ A+RV+LRW GDDP REGL DTP RV++SY+E FAGY+  P  ++     F 
Sbjct: 17  RPSREEAEAAVRVLLRWAGDDPSREGLIDTPARVVRSYEEFFAGYQVDP--REILARTFS 74

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 75  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPGHRVVGISKLARLVDAFAKRLQI 134

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +       GV V++E  H CMS RG+ + G+T VT+   G F  D    
Sbjct: 135 QEKMTVQIADTLNEVLQPVGVGVILEAAHQCMSTRGVHKAGVTMVTSRMLGSFRTDPSTR 194

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 195 REFLSIVGN 203


>gi|186473272|ref|YP_001860614.1| GTP cyclohydrolase I [Burkholderia phymatum STM815]
 gi|184195604|gb|ACC73568.1| GTP cyclohydrolase I [Burkholderia phymatum STM815]
          Length = 209

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 128/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA+EA+R +LRW GD+P REGL DTP RV+++Y+E FAGY   P  +D     F 
Sbjct: 14  RPSREEAEEAVRTLLRWAGDNPQREGLLDTPARVVRAYEEFFAGYNVEP--RDILARTFS 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P+  V+G+SKL R+++ +++RLQI
Sbjct: 72  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPEHRVVGISKLARLVDAFAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H CMS RG+ + G+  VT+   G F  D    
Sbjct: 132 QEKMTVQIADTLNEVLQPKGVGVILEASHQCMSTRGVHKAGVEMVTSRMLGTFRSDPSTR 191

Query: 195 DFFLKMTHN 203
             FL + ++
Sbjct: 192 REFLSIVNS 200


>gi|121601665|ref|YP_988948.1| GTP cyclohydrolase I [Bartonella bacilliformis KC583]
 gi|166218210|sp|A1USJ5|GCH1_BARBK RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|120613842|gb|ABM44443.1| GTP cyclohydrolase I [Bartonella bacilliformis KC583]
          Length = 206

 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 136/189 (71%), Gaps = 2/189 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           ++EE ++AIR +L W+G++PDREGL +TP R+ K YKELF+GY +  +  +     F E 
Sbjct: 20  SLEEVEKAIRTLLLWVGENPDREGLLETPKRIAKVYKELFSGYGE--SVDEILGVVFEEV 77

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y + V++KDI F+S+CEHH++PI GK H+AY+P K ++GLSK+ R+++V++ RLQ QE
Sbjct: 78  AGYDEPVIVKDIFFYSHCEHHMIPIIGKAHVAYLPDKKIVGLSKIARVVDVFAHRLQTQE 137

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
            +T Q+A++++     +G+AVLIE +HMCM+MRG+++ G  T+TT+F G + +D+     
Sbjct: 138 TMTAQVANSLKKYLKPRGLAVLIEAEHMCMAMRGVQKQGAATITTSFHGYYKKDQVAQAN 197

Query: 197 FLKMTHNQR 205
           F+ +T   R
Sbjct: 198 FMTITRGIR 206


>gi|262276969|ref|ZP_06054762.1| GTP cyclohydrolase I [alpha proteobacterium HIMB114]
 gi|262224072|gb|EEY74531.1| GTP cyclohydrolase I [alpha proteobacterium HIMB114]
          Length = 203

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 97/191 (50%), Positives = 129/191 (67%), Gaps = 3/191 (1%)

Query: 9   FNMKL-KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQD 67
           F  KL +K + EEAK+AI+ IL++IG++PDREGL +TP RVIK++ E F+GY + P  Q 
Sbjct: 9   FKAKLVEKISKEEAKKAIQTILKYIGENPDREGLIETPKRVIKAFDEYFSGYAEDP--QL 66

Query: 68  TSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEV 127
                FG+   Y DMV+ K+IS  S+CEHH+ PI G  H+AYIP + V+GLSKL R++E 
Sbjct: 67  YLEKTFGDVEGYNDMVIQKNISIQSHCEHHMAPIIGITHVAYIPSEKVVGLSKLARVVEA 126

Query: 128 YSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           YSRRLQ QERLTMQIA+AI     + G AV I+  H CM+ RG+ ++  +TVT  FTG F
Sbjct: 127 YSRRLQTQERLTMQIANAINKGLKAHGAAVCIDAVHQCMTTRGVMKENASTVTNYFTGSF 186

Query: 188 SRDKGKTDFFL 198
              +     FL
Sbjct: 187 RDSQSLQQRFL 197


>gi|254254865|ref|ZP_04948182.1| GTP cyclohydrolase I [Burkholderia dolosa AUO158]
 gi|124899510|gb|EAY71353.1| GTP cyclohydrolase I [Burkholderia dolosa AUO158]
          Length = 210

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 128/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA++A+RV+LRW GDDP REGL DTP RV+++Y++ FAGY   P  +D     F 
Sbjct: 15  RPSREEAEDAVRVLLRWAGDDPTREGLIDTPARVVRAYEQFFAGYAVEP--RDILARTFS 72

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P K V+G+SKL R+++ +++RLQI
Sbjct: 73  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNKRVVGISKLARLVDAFAKRLQI 132

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RG+ + G+  VT+   G F  D    
Sbjct: 133 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRMLGTFRTDPSTR 192

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 193 REFLSIVAN 201


>gi|307945498|ref|ZP_07660834.1| GTP cyclohydrolase I [Roseibium sp. TrichSKD4]
 gi|307771371|gb|EFO30596.1| GTP cyclohydrolase I [Roseibium sp. TrichSKD4]
          Length = 211

 Score =  195 bits (495), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 133/192 (69%), Gaps = 8/192 (4%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           KL +P+  EA+ A+R +L W GDDP+REGL DTP RV K++++L+AGY      +D S  
Sbjct: 19  KLSRPSRAEAEAAVRTLLAWTGDDPEREGLLDTPKRVAKAFEQLYAGY-----FEDASEH 73

Query: 72  ---HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
               F +   YQD+VL++ I F S+CEHH+LP  G+ H+AY P + V+GLSKL R++++Y
Sbjct: 74  LERTFDDVGGYQDIVLVRGIPFHSHCEHHMLPFIGEAHIAYYPAEGVVGLSKLARVVDIY 133

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           ++RLQ QE LT +I  AI+ +   +G+AV++E +H CM+MRG+++ G++T+TT FTG F 
Sbjct: 134 AKRLQTQENLTSEIVSAIDDALAPRGLAVMLEAEHQCMTMRGVQKPGVSTITTQFTGVFQ 193

Query: 189 RDKGKTDFFLKM 200
            D  +   F+ +
Sbjct: 194 DDPAEQAKFMTL 205


>gi|254294733|ref|YP_003060756.1| GTP cyclohydrolase I [Hirschia baltica ATCC 49814]
 gi|254043264|gb|ACT60059.1| GTP cyclohydrolase I [Hirschia baltica ATCC 49814]
          Length = 204

 Score =  194 bits (494), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 88/188 (46%), Positives = 129/188 (68%), Gaps = 2/188 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K+PT EEA++A++ +L W GDDP+REGL DTP RV+K+Y+E F+GY+  P    +  F  
Sbjct: 17  KRPTREEAEKAVKTLLAWAGDDPEREGLLDTPKRVVKAYEEWFSGYRDDPVKYLSRTFE- 75

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            +   Y D+V+++DI   S+CEHH+ P  GK ++AY+P   V+G+SKL R++E+Y++RLQ
Sbjct: 76  -DVQGYDDIVMLRDIDVESHCEHHMAPFMGKAYVAYMPTDSVVGISKLARVVEIYAKRLQ 134

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T QI  AIE S    GVAV+I+  H CM+ RG+    ++T+TT FTG F  DK  
Sbjct: 135 TQETMTSQICEAIEESLKPAGVAVMIDAVHQCMTTRGVHHPNVSTITTQFTGVFKTDKDL 194

Query: 194 TDFFLKMT 201
            D FL+++
Sbjct: 195 RDRFLRLS 202


>gi|91205618|ref|YP_537973.1| GTP cyclohydrolase I [Rickettsia bellii RML369-C]
 gi|157827331|ref|YP_001496395.1| GTP cyclohydrolase I [Rickettsia bellii OSU 85-389]
 gi|122425550|sp|Q1RID0|GCH1_RICBR RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|166220282|sp|A8GUB6|GCH1_RICB8 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|91069162|gb|ABE04884.1| GTP cyclohydrolase I [Rickettsia bellii RML369-C]
 gi|157802635|gb|ABV79358.1| GTP cyclohydrolase I [Rickettsia bellii OSU 85-389]
          Length = 192

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 92/192 (47%), Positives = 131/192 (68%), Gaps = 4/192 (2%)

Query: 11  MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTS 69
           M +KKPT EEAKEA+R +LR+IG+DP+REGL  TPDRVIKSY+E+F+GY K I    +T 
Sbjct: 1   MTIKKPTKEEAKEAVRTLLRFIGEDPNREGLFKTPDRVIKSYEEIFSGYGKNIEEILETK 60

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
              F +   +QD + ++ I F S+CEHH+LP  G +H+AYIP   ++G+SKL RI+  ++
Sbjct: 61  ---FSDTGNFQDFISLEGIKFTSFCEHHMLPFSGTVHIAYIPDNCIVGISKLARIVNAFA 117

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           +RLQIQE++T+QIA +++ +    GVAV I   H CMSMRG+ +D     T  +TG F+ 
Sbjct: 118 KRLQIQEKMTVQIAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSIMNTMHYTGIFAE 177

Query: 190 DKGKTDFFLKMT 201
            +     FL +T
Sbjct: 178 QQKYRHEFLNLT 189


>gi|329114526|ref|ZP_08243285.1| GTP cyclohydrolase 1 [Acetobacter pomorum DM001]
 gi|326696006|gb|EGE47688.1| GTP cyclohydrolase 1 [Acetobacter pomorum DM001]
          Length = 203

 Score =  194 bits (494), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 87/187 (46%), Positives = 125/187 (66%), Gaps = 2/187 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K+PT  EA++A+R +LRW GD+PDREGL DTP RV ++Y E F GY+  P      R  F
Sbjct: 10  KRPTQAEAEQAVRTLLRWAGDNPDREGLHDTPARVARAYTEFFCGYEIDPAA--LLRRTF 67

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y ++VL++DI F S+CEHH+ PI G+ H+AY+P++ V+G+SKL R+++ Y++RLQ
Sbjct: 68  SEVEGYDEIVLLRDIRFESHCEHHLAPIIGRAHVAYLPRQRVVGISKLARVVDAYAKRLQ 127

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQERLT QIA+ I    +  GVAV+IE  H CM+ RG+ + G++ VT+   G F  +   
Sbjct: 128 IQERLTAQIANTINDELEPHGVAVIIESAHECMTTRGVHKPGVSMVTSTMLGVFRENSDT 187

Query: 194 TDFFLKM 200
               + M
Sbjct: 188 RRELMAM 194


>gi|67921567|ref|ZP_00515085.1| GTP cyclohydrolase I [Crocosphaera watsonii WH 8501]
 gi|67856679|gb|EAM51920.1| GTP cyclohydrolase I [Crocosphaera watsonii WH 8501]
          Length = 218

 Score =  194 bits (493), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/194 (50%), Positives = 132/194 (68%), Gaps = 8/194 (4%)

Query: 14  KKPTV--EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSR 70
           ++P V  EE ++A+R +L  +G+DPDREGLKDTP RV+K+ K L +GY Q +    + + 
Sbjct: 25  QRPLVSDEEMRQAVRTLLLGLGEDPDREGLKDTPKRVVKALKFLTSGYHQSLDELLNEAV 84

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
           FH        +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y R
Sbjct: 85  FH----ESANEMVLVRDIDLFSSCEHHILPIIGRAHVAYIPDGKVIGLSKIARICEMYGR 140

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ+QERLT QIA A++     KGVAV++E  HMCM MRG+++ G  T T+A  GEF+ D
Sbjct: 141 RLQVQERLTGQIADALQGLLQPKGVAVVVEATHMCMVMRGVQKPGSWTSTSAVRGEFAND 200

Query: 191 -KGKTDFFLKMTHN 203
            K + +F   + HN
Sbjct: 201 AKTRQEFMSLIQHN 214


>gi|114570949|ref|YP_757629.1| GTP cyclohydrolase I [Maricaulis maris MCS10]
 gi|122315351|sp|Q0AM02|GCH1_MARMM RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|114341411|gb|ABI66691.1| GTP cyclohydrolase I [Maricaulis maris MCS10]
          Length = 205

 Score =  194 bits (493), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 127/186 (68%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           KP+ EEA+ A+R ++ W GDDP REGL DTP RV+K+Y+E F+GY   P       F   
Sbjct: 18  KPSREEAEAAVRTLISWAGDDPTREGLLDTPKRVVKAYEEWFSGYDADPLKALGKTFE-- 75

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           +   Y DMV++ +I   S+CEHH+ PI G  H+AY+P K V+G+SK+ R++E++S+R+Q 
Sbjct: 76  DVQGYDDMVMLTNIDVESHCEHHLAPIMGVAHVAYLPSKAVVGISKIARVVEIFSKRMQT 135

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA A+  + + +GVAVL++ +H CM+ RG+    ++T+TT FTGEF  D+   
Sbjct: 136 QETMTAQIADALTEAMEPRGVAVLVDAKHQCMTTRGVHHPNVSTITTTFTGEFRNDRDLK 195

Query: 195 DFFLKM 200
           D F+++
Sbjct: 196 DRFMRL 201


>gi|170693073|ref|ZP_02884234.1| GTP cyclohydrolase I [Burkholderia graminis C4D1M]
 gi|170142071|gb|EDT10238.1| GTP cyclohydrolase I [Burkholderia graminis C4D1M]
          Length = 216

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 130/189 (68%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA+ A+RV+LRW GD+P+REGL DTP RV++SY+E +AGY QI   +  +R  F 
Sbjct: 21  RPSREEAEAAVRVLLRWAGDNPEREGLIDTPARVVRSYEEFYAGY-QIDPREILART-FS 78

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 79  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPGHRVVGISKLARLVDAFAKRLQI 138

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      +GV V++E  H CMS RG+ + G+T VT+   G F  D    
Sbjct: 139 QEKMTVQIADTLNDVLQPEGVGVILEASHQCMSTRGVHKAGVTMVTSRMLGTFRTDPSTR 198

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 199 REFLSIVGN 207


>gi|295700164|ref|YP_003608057.1| GTP cyclohydrolase I [Burkholderia sp. CCGE1002]
 gi|295439377|gb|ADG18546.1| GTP cyclohydrolase I [Burkholderia sp. CCGE1002]
          Length = 212

 Score =  194 bits (492), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 128/191 (67%), Gaps = 2/191 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +++P+ EEA+ A+RV+LRW GDDP REGL DTP RV ++Y+E FAGY+  P  ++     
Sbjct: 15  VERPSREEAEAAVRVLLRWAGDDPRREGLIDTPARVTRAYEEFFAGYQVDP--REILART 72

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RL
Sbjct: 73  FSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRL 132

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T+QIA  +       GV V++E  H CMS RG+ + G+T VT+   G F  D  
Sbjct: 133 QIQEKMTVQIADTLNDVLQPAGVGVILEAAHQCMSTRGVHKAGVTMVTSRMLGTFRTDPS 192

Query: 193 KTDFFLKMTHN 203
               FL +  N
Sbjct: 193 TRREFLAIVGN 203


>gi|330991852|ref|ZP_08315801.1| GTP cyclohydrolase 1 [Gluconacetobacter sp. SXCC-1]
 gi|329760873|gb|EGG77368.1| GTP cyclohydrolase 1 [Gluconacetobacter sp. SXCC-1]
          Length = 201

 Score =  194 bits (492), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 123/186 (66%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT  EA++A+R +LRW G+DP REGL DTP RV+KSY E F GY + P   +  R  F 
Sbjct: 7   RPTRAEAEDAVRTLLRWAGEDPGREGLLDTPARVVKSYDEFFCGYAEDPA--EMLRRTFS 64

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y +MVL++DI   S+CEHH++PI G  H+AY+P++ V+G+SKL R+++ Y+RR QI
Sbjct: 65  EVADYDEMVLLRDIRLESHCEHHMVPIIGVAHVAYLPRRRVVGISKLARVVDAYARRFQI 124

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QERLT QIA+ I       GV V+IE  H CM+ RG+ R G++ VT+   G F  +    
Sbjct: 125 QERLTAQIANTINEELQPYGVGVVIEAAHQCMTTRGVHRPGVSMVTSRMLGTFRTNSDTR 184

Query: 195 DFFLKM 200
             FL +
Sbjct: 185 REFLSI 190


>gi|209515525|ref|ZP_03264390.1| GTP cyclohydrolase I [Burkholderia sp. H160]
 gi|209503992|gb|EEA03983.1| GTP cyclohydrolase I [Burkholderia sp. H160]
          Length = 211

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 129/186 (69%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT ++A+EA+R ++RW GD+P+REGL  TP RV ++Y+E F+GY+  P     + F   
Sbjct: 16  RPTRDQAEEAVRTLIRWAGDNPEREGLIQTPARVARAYREFFSGYESDPMQILATTF--S 73

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MV++KDI F SYCEHH++PI G+ H+AY+P+  V+G+SKL R+++VY++RLQI
Sbjct: 74  EVDGYDEMVVLKDIRFESYCEHHMVPIIGRAHVAYLPEHRVVGISKLARLVDVYAKRLQI 133

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA A+ +    KGVAV++E  H CMS RG+ + G + VT+   G F  D    
Sbjct: 134 QEKMTVQIADALNTVLQPKGVAVILEAAHQCMSTRGVHKPGASLVTSRMLGAFRDDPSTR 193

Query: 195 DFFLKM 200
             FL +
Sbjct: 194 REFLSI 199


>gi|167818088|ref|ZP_02449768.1| GTP cyclohydrolase I [Burkholderia pseudomallei 91]
          Length = 236

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 40  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 97

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 98  SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 157

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 158 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 217

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 218 RREFLSIVAN 227


>gi|167740906|ref|ZP_02413680.1| GTP cyclohydrolase I [Burkholderia pseudomallei 14]
 gi|167848003|ref|ZP_02473511.1| GTP cyclohydrolase I [Burkholderia pseudomallei B7210]
 gi|167904933|ref|ZP_02492138.1| GTP cyclohydrolase I [Burkholderia pseudomallei NCTC 13177]
 gi|167913238|ref|ZP_02500329.1| GTP cyclohydrolase I [Burkholderia pseudomallei 112]
 gi|242313558|ref|ZP_04812575.1| GTP cyclohydrolase I [Burkholderia pseudomallei 1106b]
 gi|254192154|ref|ZP_04898652.1| GTP cyclohydrolase I [Burkholderia pseudomallei Pasteur 52237]
 gi|254209492|ref|ZP_04915837.1| GTP cyclohydrolase I [Burkholderia mallei JHU]
 gi|254262535|ref|ZP_04953400.1| GTP cyclohydrolase I [Burkholderia pseudomallei 1710a]
 gi|254301898|ref|ZP_04969340.1| GTP cyclohydrolase I [Burkholderia pseudomallei 406e]
 gi|147750012|gb|EDK57084.1| GTP cyclohydrolase I [Burkholderia mallei JHU]
 gi|157825068|gb|EDO88960.1| GTP cyclohydrolase I [Burkholderia pseudomallei 406e]
 gi|157987634|gb|EDO95401.1| GTP cyclohydrolase I [Burkholderia pseudomallei Pasteur 52237]
 gi|242136797|gb|EES23200.1| GTP cyclohydrolase I [Burkholderia pseudomallei 1106b]
 gi|254213537|gb|EET02922.1| GTP cyclohydrolase I [Burkholderia pseudomallei 1710a]
          Length = 236

 Score =  194 bits (492), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 40  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 97

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 98  SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 157

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 158 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 217

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 218 RREFLSIVAN 227


>gi|83312785|ref|YP_423049.1| GTP cyclohydrolase I [Magnetospirillum magneticum AMB-1]
 gi|82947626|dbj|BAE52490.1| GTP cyclohydrolase I [Magnetospirillum magneticum AMB-1]
          Length = 290

 Score =  194 bits (492), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 129/192 (67%), Gaps = 2/192 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++PT E+A EA++ ++ + GD+P REGL+ TPDRVI++Y E FAGY    T  +  +  F
Sbjct: 96  RRPTREDAMEAVKTLIAYSGDNPYREGLRGTPDRVIRAYDEFFAGYHS--TAAEVLKTTF 153

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +MV + DI F S+CEHH++P  G +H+AYIP K V+G+SKL R++E+Y+RRLQ
Sbjct: 154 AETGSYDEMVTLTDIEFDSHCEHHMVPFTGVVHIAYIPDKTVVGISKLARLVEIYARRLQ 213

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T QIA  +  +   KGVAV+I GQHMCM+ RG+K+  +  +T+  TG F  D   
Sbjct: 214 IQEKMTTQIADKLHMALKPKGVAVVIAGQHMCMTTRGVKKKRVKMITSTMTGVFREDPKV 273

Query: 194 TDFFLKMTHNQR 205
              F+ +  N +
Sbjct: 274 RSEFMNLIGNPK 285


>gi|134292458|ref|YP_001116194.1| GTP cyclohydrolase I [Burkholderia vietnamiensis G4]
 gi|134135615|gb|ABO56729.1| GTP cyclohydrolase I [Burkholderia vietnamiensis G4]
          Length = 209

 Score =  193 bits (491), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT EEA++A+RV+LRW GDDP REGL DTP RV+++Y++ FAGY   P  +D     F 
Sbjct: 14  RPTREEAEDAVRVLLRWAGDDPAREGLLDTPARVVRAYEQFFAGYALEP--RDILARTFS 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 72  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RG+ + G+  VT+   G F  D    
Sbjct: 132 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRMLGTFRTDPSTR 191

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 192 REFLSIVAN 200


>gi|53715973|ref|YP_104898.1| GTP cyclohydrolase I [Burkholderia mallei ATCC 23344]
 gi|254204325|ref|ZP_04910683.1| GTP cyclohydrolase I [Burkholderia mallei FMH]
 gi|52421943|gb|AAU45513.1| GTP cyclohydrolase I [Burkholderia mallei ATCC 23344]
 gi|147744862|gb|EDK51944.1| GTP cyclohydrolase I [Burkholderia mallei FMH]
          Length = 242

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 46  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 103

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 104 SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 163

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 164 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 223

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 224 RREFLSIVAN 233


>gi|251766754|ref|ZP_02264888.2| GTP cyclohydrolase I [Burkholderia mallei PRL-20]
 gi|243064854|gb|EES47040.1| GTP cyclohydrolase I [Burkholderia mallei PRL-20]
          Length = 240

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 44  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 101

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 102 SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 161

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 162 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 221

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 222 RREFLSIVAN 231


>gi|167721944|ref|ZP_02405180.1| GTP cyclohydrolase I [Burkholderia pseudomallei DM98]
 gi|167826487|ref|ZP_02457958.1| GTP cyclohydrolase I [Burkholderia pseudomallei 9]
 gi|167896553|ref|ZP_02483955.1| GTP cyclohydrolase I [Burkholderia pseudomallei 7894]
 gi|167921185|ref|ZP_02508276.1| GTP cyclohydrolase I [Burkholderia pseudomallei BCC215]
 gi|284159980|ref|YP_001061070.2| GTP cyclohydrolase I [Burkholderia pseudomallei 668]
 gi|283775151|gb|ABN87763.2| GTP cyclohydrolase I [Burkholderia pseudomallei 668]
          Length = 236

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 40  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 97

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 98  SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 157

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 158 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 217

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 218 RREFLSIVAN 227


>gi|258542913|ref|YP_003188346.1| GTP cyclohydrolase I [Acetobacter pasteurianus IFO 3283-01]
 gi|256633991|dbj|BAH99966.1| GTP cyclohydrolase I [Acetobacter pasteurianus IFO 3283-01]
 gi|256637051|dbj|BAI03020.1| GTP cyclohydrolase I [Acetobacter pasteurianus IFO 3283-03]
 gi|256640103|dbj|BAI06065.1| GTP cyclohydrolase I [Acetobacter pasteurianus IFO 3283-07]
 gi|256643160|dbj|BAI09115.1| GTP cyclohydrolase I [Acetobacter pasteurianus IFO 3283-22]
 gi|256646215|dbj|BAI12163.1| GTP cyclohydrolase I [Acetobacter pasteurianus IFO 3283-26]
 gi|256649267|dbj|BAI15208.1| GTP cyclohydrolase I [Acetobacter pasteurianus IFO 3283-32]
 gi|256652254|dbj|BAI18188.1| GTP cyclohydrolase I [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655311|dbj|BAI21238.1| GTP cyclohydrolase I [Acetobacter pasteurianus IFO 3283-12]
          Length = 203

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/187 (45%), Positives = 125/187 (66%), Gaps = 2/187 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++PT  EA++A+R +LRW GD+PDREGL DTP RV ++Y E F GY+  P      R  F
Sbjct: 10  QRPTQAEAEQAVRTLLRWAGDNPDREGLHDTPARVARAYTEFFCGYEIDPAA--LLRRTF 67

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y ++VL++DI F S+CEHH+ PI G+ H+AY+P++ V+G+SKL R+++ Y++RLQ
Sbjct: 68  SEVEGYDEIVLLRDIRFESHCEHHLAPIIGRAHVAYLPRQRVVGISKLARVVDAYAKRLQ 127

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQERLT QIA+ I    +  GVAV+IE  H CM+ RG+ + G++ VT+   G F  +   
Sbjct: 128 IQERLTAQIANTINDELEPHGVAVIIESSHECMTTRGVHKPGVSMVTSTMLGVFRENSDT 187

Query: 194 TDFFLKM 200
               + M
Sbjct: 188 RRELMAM 194


>gi|254192711|ref|ZP_04899147.1| GTP cyclohydrolase I [Burkholderia pseudomallei S13]
 gi|169649466|gb|EDS82159.1| GTP cyclohydrolase I [Burkholderia pseudomallei S13]
          Length = 292

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 96  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 153

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 154 SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 213

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 214 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 273

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 274 RREFLSIVAN 283


>gi|76818716|ref|YP_336706.1| GTP cyclohydrolase I [Burkholderia pseudomallei 1710b]
 gi|124382169|ref|YP_001025282.1| GTP cyclohydrolase I [Burkholderia mallei NCTC 10229]
 gi|126447728|ref|YP_001077260.1| GTP cyclohydrolase I [Burkholderia mallei NCTC 10247]
 gi|126458073|ref|YP_001074094.1| GTP cyclohydrolase I [Burkholderia pseudomallei 1106a]
 gi|217423198|ref|ZP_03454700.1| GTP cyclohydrolase I [Burkholderia pseudomallei 576]
 gi|238562167|ref|ZP_04609929.1| GTP cyclohydrolase I [Burkholderia mallei GB8 horse 4]
 gi|254179113|ref|ZP_04885766.1| GTP cyclohydrolase I [Burkholderia mallei ATCC 10399]
 gi|254359543|ref|ZP_04975815.1| GTP cyclohydrolase I [Burkholderia mallei 2002721280]
 gi|76583189|gb|ABA52663.1| GTP cyclohydrolase I [Burkholderia pseudomallei 1710b]
 gi|126231841|gb|ABN95254.1| GTP cyclohydrolase I [Burkholderia pseudomallei 1106a]
 gi|126240582|gb|ABO03694.1| GTP cyclohydrolase I [Burkholderia mallei NCTC 10247]
 gi|148028730|gb|EDK86690.1| GTP cyclohydrolase I [Burkholderia mallei 2002721280]
 gi|160694631|gb|EDP84640.1| GTP cyclohydrolase I [Burkholderia mallei ATCC 10399]
 gi|217394106|gb|EEC34126.1| GTP cyclohydrolase I [Burkholderia pseudomallei 576]
 gi|238523158|gb|EEP86598.1| GTP cyclohydrolase I [Burkholderia mallei GB8 horse 4]
 gi|261826683|gb|ABM98711.2| GTP cyclohydrolase I [Burkholderia mallei NCTC 10229]
          Length = 292

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 96  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 153

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 154 SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 213

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 214 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 273

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 274 RREFLSIVAN 283


>gi|254185520|ref|ZP_04892107.1| GTP cyclohydrolase I [Burkholderia pseudomallei 1655]
 gi|184209754|gb|EDU06797.1| GTP cyclohydrolase I [Burkholderia pseudomallei 1655]
          Length = 292

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 96  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 153

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 154 SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 213

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 214 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 273

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 274 RREFLSIVAN 283


>gi|121597088|ref|YP_990796.1| GTP cyclohydrolase I [Burkholderia mallei SAVP1]
 gi|121224886|gb|ABM48417.1| GTP cyclohydrolase I [Burkholderia mallei SAVP1]
          Length = 292

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 96  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 153

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 154 SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 213

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 214 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 273

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 274 RREFLSIVAN 283


>gi|226193549|ref|ZP_03789154.1| GTP cyclohydrolase I [Burkholderia pseudomallei Pakistan 9]
 gi|237510448|ref|ZP_04523163.1| GTP cyclohydrolase I [Burkholderia pseudomallei MSHR346]
 gi|225934431|gb|EEH30413.1| GTP cyclohydrolase I [Burkholderia pseudomallei Pakistan 9]
 gi|235002653|gb|EEP52077.1| GTP cyclohydrolase I [Burkholderia pseudomallei MSHR346]
          Length = 292

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 96  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 153

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 154 SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 213

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 214 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 273

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 274 RREFLSIVAN 283


>gi|134284056|ref|ZP_01770751.1| GTP cyclohydrolase I [Burkholderia pseudomallei 305]
 gi|134244667|gb|EBA44766.1| GTP cyclohydrolase I [Burkholderia pseudomallei 305]
          Length = 292

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F
Sbjct: 96  NRPSRDEAEAAVRVLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTF 153

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 154 SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 213

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 214 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPAT 273

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 274 RREFLSIVAN 283


>gi|307947379|ref|ZP_07662713.1| GTP cyclohydrolase I [Roseibium sp. TrichSKD4]
 gi|307769521|gb|EFO28748.1| GTP cyclohydrolase I [Roseibium sp. TrichSKD4]
          Length = 229

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 84/173 (48%), Positives = 123/173 (71%), Gaps = 2/173 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  +A+ A+RV+L W GDDPDREGL DTP RV+++Y+E F GYK  P       F   
Sbjct: 36  RPSRADAEAAVRVLLEWSGDDPDREGLVDTPARVVRAYEEFFEGYKIDPAELLARTFE-- 93

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D+++++++   S+CEHH++PI GK+H+AY+P   V+G+SKL R++EVY++RLQI
Sbjct: 94  ETNDYDDLIVLRNMRLESHCEHHVVPIIGKVHVAYLPANRVVGISKLARVVEVYAKRLQI 153

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           QE LT QIA  I+     +GVAV++E  HMCM+ RGIK+ G++ +T    GEF
Sbjct: 154 QETLTSQIADTIQDVLQPRGVAVVVEAAHMCMTTRGIKKPGVSMLTRRLLGEF 206


>gi|167576508|ref|ZP_02369382.1| GTP cyclohydrolase I [Burkholderia thailandensis TXDOH]
          Length = 242

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 128/191 (67%), Gaps = 2/191 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + +P+ +EA+ A+RV+LRW GDDP+REGL DTP RV+++Y+E F+GY   P  +D     
Sbjct: 45  VNRPSRDEAEAAVRVLLRWAGDDPEREGLVDTPARVVRAYEEFFSGYTLEP--RDILART 102

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RL
Sbjct: 103 FSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRL 162

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D  
Sbjct: 163 QIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPA 222

Query: 193 KTDFFLKMTHN 203
               FL +  N
Sbjct: 223 TRREFLSIVAN 233


>gi|167614682|ref|ZP_02383317.1| GTP cyclohydrolase I [Burkholderia thailandensis Bt4]
 gi|257141271|ref|ZP_05589533.1| GTP cyclohydrolase I [Burkholderia thailandensis E264]
          Length = 198

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 128/191 (67%), Gaps = 2/191 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + +P+ +EA+ A+RV+LRW GDDP+REGL DTP RV+++Y+E F+GY   P  +D     
Sbjct: 1   MNRPSRDEAEAAVRVLLRWAGDDPEREGLVDTPARVVRAYEEFFSGYTLEP--RDILART 58

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RL
Sbjct: 59  FSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRL 118

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D  
Sbjct: 119 QIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPA 178

Query: 193 KTDFFLKMTHN 203
               FL +  N
Sbjct: 179 TRREFLSIVAN 189


>gi|167571881|ref|ZP_02364755.1| GTP cyclohydrolase I [Burkholderia oklahomensis C6786]
          Length = 200

 Score =  193 bits (490), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 128/193 (66%), Gaps = 2/193 (1%)

Query: 11  MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR 70
           M   +P+ +EA+ A+RV+LRW GDDP+REGL DTP RV+++Y+E F+GY   P  +D   
Sbjct: 1   MPASRPSRDEAEAAVRVLLRWAGDDPEREGLVDTPARVVRAYEEFFSGYALEP--RDILA 58

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
             F E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++
Sbjct: 59  RTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPHHRVVGISKLARLVDAFAK 118

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQIQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D
Sbjct: 119 RLQIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTD 178

Query: 191 KGKTDFFLKMTHN 203
                 FL +  N
Sbjct: 179 PATRREFLSIVAN 191


>gi|206561925|ref|YP_002232688.1| GTP cyclohydrolase I [Burkholderia cenocepacia J2315]
 gi|198037965|emb|CAR53910.1| GTP cyclohydrolase I [Burkholderia cenocepacia J2315]
          Length = 211

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA++A+RV+LRW GDDP REGL DTP RV+++Y++ FAGY   P  +D     F 
Sbjct: 16  RPSREEAEDAVRVLLRWAGDDPAREGLLDTPARVVRAYEQFFAGYALDP--RDILARTFS 73

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 74  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 133

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RG+ + G+  VT+   G F  D    
Sbjct: 134 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRMLGTFRTDPSTR 193

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 194 REFLSIVAN 202


>gi|83716218|ref|YP_438245.1| GTP cyclohydrolase I [Burkholderia thailandensis E264]
 gi|83650043|gb|ABC34107.1| GTP cyclohydrolase I [Burkholderia thailandensis E264]
          Length = 258

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 128/191 (67%), Gaps = 2/191 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + +P+ +EA+ A+RV+LRW GDDP+REGL DTP RV+++Y+E F+GY   P  +D     
Sbjct: 61  VNRPSRDEAEAAVRVLLRWAGDDPEREGLVDTPARVVRAYEEFFSGYTLEP--RDILART 118

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RL
Sbjct: 119 FSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRL 178

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D  
Sbjct: 179 QIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPA 238

Query: 193 KTDFFLKMTHN 203
               FL +  N
Sbjct: 239 TRREFLSIVAN 249


>gi|296114664|ref|ZP_06833316.1| GTP cyclohydrolase I [Gluconacetobacter hansenii ATCC 23769]
 gi|295978760|gb|EFG85486.1| GTP cyclohydrolase I [Gluconacetobacter hansenii ATCC 23769]
          Length = 203

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/187 (45%), Positives = 125/187 (66%), Gaps = 2/187 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT  +A+EA+R +L W GDDPDREGL  TPDRV+++Y+E F GY+  P       F   
Sbjct: 14  RPTRAQAEEAVRTLLAWTGDDPDREGLVGTPDRVVRAYEEFFEGYQDDPVALLERTFE-- 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MV+++DI   S+CEHHI+P+ GK H+AY+P + V+G+SKL R+++V++ RLQI
Sbjct: 72  ETGNYNEMVVLRDIRLESHCEHHIIPLIGKAHVAYLPDRRVVGISKLARLVDVFAHRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE+LT QIA  I+S    +GVAV+I+  H CM+ RG+ + G++ VT+   GEF   +   
Sbjct: 132 QEKLTAQIADTIQSVLQPRGVAVVIDAAHQCMTTRGVHKPGVSMVTSRLLGEFETSESLR 191

Query: 195 DFFLKMT 201
             F  M 
Sbjct: 192 RQFFAMA 198


>gi|78063978|ref|YP_373886.1| GTP cyclohydrolase I [Burkholderia sp. 383]
 gi|77971863|gb|ABB13242.1| GTP cyclohydrolase I [Burkholderia sp. 383]
          Length = 210

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA++A+RV+LRW GDDP REGL DTP RV+++Y++ FAGY   P  +D     F 
Sbjct: 15  RPSREEAEDAVRVLLRWAGDDPAREGLIDTPARVVRAYEQFFAGYALEP--RDILARTFS 72

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 73  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 132

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RG+ + G+  VT+   G F  D    
Sbjct: 133 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRMLGTFRTDPSTR 192

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 193 REFLSIVAN 201


>gi|22298852|ref|NP_682099.1| GTP cyclohydrolase I [Thermosynechococcus elongatus BP-1]
 gi|34222547|sp|Q8DJB8|GCH1_THEEB RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|22295033|dbj|BAC08861.1| GTP cyclohydrolase I [Thermosynechococcus elongatus BP-1]
          Length = 229

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 130/187 (69%), Gaps = 5/187 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           EE   A+R IL  +G+DPDREGL  TP RV ++ + L +GY Q + T  + + F  G   
Sbjct: 44  EEMMAAVRTILLNVGEDPDREGLLKTPKRVAEAMQFLTSGYSQSLETLVNGAIFDEG--- 100

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
            + +MVL++DI+FFS CEHH+LP  GK H+AYIP + VIGLSKL R++E+Y+RRLQ+QER
Sbjct: 101 -HDEMVLVRDINFFSLCEHHMLPFIGKAHVAYIPNQRVIGLSKLARVVEMYARRLQVQER 159

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT Q+A AIE+  D KGVAV++E  HMCM MRG+++ G  TVT++  G F  D+   + F
Sbjct: 160 LTRQVAEAIETVLDPKGVAVVMEATHMCMVMRGVQKPGSWTVTSSMLGVFREDQKTREEF 219

Query: 198 LKMTHNQ 204
           L +  +Q
Sbjct: 220 LNLIRHQ 226


>gi|107027452|ref|YP_624963.1| GTP cyclohydrolase I [Burkholderia cenocepacia AU 1054]
 gi|116693836|ref|YP_839369.1| GTP cyclohydrolase I [Burkholderia cenocepacia HI2424]
 gi|105896826|gb|ABF79990.1| GTP cyclohydrolase I [Burkholderia cenocepacia AU 1054]
 gi|116651836|gb|ABK12476.1| GTP cyclohydrolase I [Burkholderia cenocepacia HI2424]
          Length = 211

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA++A+RV+LRW GDDP REGL DTP RV+++Y++ FAGY   P  +D     F 
Sbjct: 16  RPSREEAEDAVRVLLRWAGDDPAREGLLDTPARVVRAYEQFFAGYALEP--RDILARTFS 73

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 74  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 133

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RG+ + G+  VT+   G F  D    
Sbjct: 134 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRMLGTFRTDPSTR 193

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 194 REFLSIVAN 202


>gi|170751028|ref|YP_001757288.1| GTP cyclohydrolase I [Methylobacterium radiotolerans JCM 2831]
 gi|170657550|gb|ACB26605.1| GTP cyclohydrolase I [Methylobacterium radiotolerans JCM 2831]
          Length = 272

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 130/191 (68%), Gaps = 2/191 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
            ++  +P+  EA+ A+R +LRW GDDP REGL DTP RV K+Y++LF GY  +   +   
Sbjct: 78  GIETGRPSRAEAEAAVRTLLRWAGDDPTREGLLDTPARVTKAYEQLFGGYA-VDAEKLLE 136

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
           R  F E   Y D+VL++DI F S+CEHH++P  G  H+AY P + V+GLSKL R+++ ++
Sbjct: 137 RV-FEEVEGYSDIVLVRDIPFHSHCEHHMVPFMGLAHIAYYPTRGVVGLSKLARVVDTFA 195

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQ QE +T QIA  IES    +GVAV++E +H+CM+MRG+++ G++T+T+ F G F  
Sbjct: 196 RRLQTQETMTAQIADVIESILKPRGVAVMVEAEHLCMAMRGVQKAGVSTITSQFRGVFKD 255

Query: 190 DKGKTDFFLKM 200
           +  +   FL +
Sbjct: 256 NANEQVRFLTL 266


>gi|312113815|ref|YP_004011411.1| GTP cyclohydrolase I [Rhodomicrobium vannielii ATCC 17100]
 gi|311218944|gb|ADP70312.1| GTP cyclohydrolase I [Rhodomicrobium vannielii ATCC 17100]
          Length = 220

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 134/192 (69%), Gaps = 2/192 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++P+ EEA+ A+R +L W GDDP REGL DTP RV+ SY E F GY   P  + +  F  
Sbjct: 26  QRPSREEAEAAVRTLLAWTGDDPTREGLIDTPKRVVDSYAEYFWGYDGDPVDELSRTFE- 84

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            +   Y D+V+++DI F S+CEHH++PI G  H+AYIP + ++G+SKL R++++Y++RLQ
Sbjct: 85  -DVQGYDDIVMLRDIDFASHCEHHMVPIIGVAHVAYIPDRRIVGISKLARVVDIYAKRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T QIA+ I+ +   KGVAV+I+  H CM+MRG+ + G TT+TT FTG FS DK +
Sbjct: 144 TQETMTAQIANCIQDALKPKGVAVMIDALHQCMTMRGVHKKGTTTITTRFTGVFSEDKAE 203

Query: 194 TDFFLKMTHNQR 205
            D F+++ +  R
Sbjct: 204 RDRFMQLVNGTR 215


>gi|170696900|ref|ZP_02887996.1| GTP cyclohydrolase I [Burkholderia ambifaria IOP40-10]
 gi|170138074|gb|EDT06306.1| GTP cyclohydrolase I [Burkholderia ambifaria IOP40-10]
          Length = 209

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ +EA+EA+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  ++     F 
Sbjct: 14  RPSRKEAEEAVRVLLRWAGDDPAREGLLDTPARVVRAYEEFFAGYALEP--REILARTFS 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 72  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D    
Sbjct: 132 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPSTR 191

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 192 REFLSIVAN 200


>gi|115359759|ref|YP_776897.1| GTP cyclohydrolase I [Burkholderia ambifaria AMMD]
 gi|115285047|gb|ABI90563.1| GTP cyclohydrolase I [Burkholderia ambifaria AMMD]
          Length = 209

 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ +EA+EA+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  ++     F 
Sbjct: 14  RPSRKEAEEAVRVLLRWAGDDPAREGLLDTPARVVRAYEEFFAGYALEP--REILARTFS 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 72  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D    
Sbjct: 132 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPSTR 191

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 192 REFLSIVAN 200


>gi|161521826|ref|YP_001585253.1| GTP cyclohydrolase I [Burkholderia multivorans ATCC 17616]
 gi|189352013|ref|YP_001947640.1| GTP cyclohydrolase I [Burkholderia multivorans ATCC 17616]
 gi|221197541|ref|ZP_03570588.1| GTP cyclohydrolase I [Burkholderia multivorans CGD2M]
 gi|221204214|ref|ZP_03577232.1| GTP cyclohydrolase I [Burkholderia multivorans CGD2]
 gi|160345876|gb|ABX18961.1| GTP cyclohydrolase I [Burkholderia multivorans ATCC 17616]
 gi|189336035|dbj|BAG45104.1| GTP cyclohydrolase I [Burkholderia multivorans ATCC 17616]
 gi|221176380|gb|EEE08809.1| GTP cyclohydrolase I [Burkholderia multivorans CGD2]
 gi|221184095|gb|EEE16495.1| GTP cyclohydrolase I [Burkholderia multivorans CGD2M]
          Length = 209

 Score =  192 bits (488), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA++A+RV+LRW GDDP REGL DTP RV+++Y++ FAGY   P  +D     F 
Sbjct: 14  RPSREEAEDAVRVLLRWAGDDPTREGLIDTPARVVRAYEQFFAGYSIEP--RDILARTFS 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 72  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RG+ + G+  VT+   G F  D    
Sbjct: 132 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRMLGTFRTDPSTR 191

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 192 REFLSIVAN 200


>gi|171316025|ref|ZP_02905252.1| GTP cyclohydrolase I [Burkholderia ambifaria MEX-5]
 gi|171098829|gb|EDT43621.1| GTP cyclohydrolase I [Burkholderia ambifaria MEX-5]
          Length = 209

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ +EA+EA+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  ++     F 
Sbjct: 14  RPSRKEAEEAVRVLLRWAGDDPAREGLLDTPARVVRAYEEFFAGYALEP--REILARTFS 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 72  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D    
Sbjct: 132 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPSTR 191

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 192 REFLSIVAN 200


>gi|221210555|ref|ZP_03583535.1| GTP cyclohydrolase I [Burkholderia multivorans CGD1]
 gi|221169511|gb|EEE01978.1| GTP cyclohydrolase I [Burkholderia multivorans CGD1]
          Length = 209

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ EEA++A+RV+LRW GDDP REGL DTP RV+++Y++ FAGY   P  +D     F 
Sbjct: 14  RPSREEAEDAVRVLLRWAGDDPTREGLIDTPARVVRAYEQFFAGYAIEP--RDILARTFS 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 72  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RG+ + G+  VT+   G F  D    
Sbjct: 132 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRMLGTFRTDPSTR 191

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 192 REFLSIVAN 200


>gi|302382797|ref|YP_003818620.1| GTP cyclohydrolase I [Brevundimonas subvibrioides ATCC 15264]
 gi|302193425|gb|ADL00997.1| GTP cyclohydrolase I [Brevundimonas subvibrioides ATCC 15264]
          Length = 204

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 130/195 (66%), Gaps = 2/195 (1%)

Query: 6   TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT 65
           T V N  L +PT EEA  A+R ++ W GD+PDREGL DTP RV+ +Y E F GY   P  
Sbjct: 9   TLVGNDHLTRPTREEALAAVRTLIAWSGDNPDREGLLDTPKRVVDAYGEWFEGYTADPA- 67

Query: 66  QDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRIL 125
           ++ SR  F +   Y DMVL++DI   S+CEHH+ P  GK ++AY+P + V+G+SK+ R++
Sbjct: 68  KELSRT-FEDVQGYDDMVLLRDIEVESHCEHHMAPFLGKAYVAYLPTEKVVGISKIARVV 126

Query: 126 EVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           E++S+RLQ QE LT +IA A+E      GVAVLI+ +H CM+ RG+    ++T+TT FTG
Sbjct: 127 EIFSKRLQTQETLTQEIAGALEDHLSPAGVAVLIDAEHQCMTTRGVHHRHVSTITTRFTG 186

Query: 186 EFSRDKGKTDFFLKM 200
           +F  D    + FLK+
Sbjct: 187 QFKTDPALIERFLKL 201


>gi|172062194|ref|YP_001809845.1| GTP cyclohydrolase I [Burkholderia ambifaria MC40-6]
 gi|171994711|gb|ACB65629.1| GTP cyclohydrolase I [Burkholderia ambifaria MC40-6]
          Length = 209

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ +EA+EA+RV+LRW GDDP REGL DTP RV+++Y+E FAGY   P  ++     F 
Sbjct: 14  RPSRKEAEEAVRVLLRWAGDDPAREGLLDTPARVVRAYEEFFAGYALEP--REILARTFS 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 72  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D    
Sbjct: 132 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPSTR 191

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 192 REFLSIVAN 200


>gi|325525144|gb|EGD03023.1| GTP cyclohydrolase I [Burkholderia sp. TJI49]
          Length = 209

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ +EA+EA+RV+LRW GDDP REGL DTP RV+++Y+E F+GY   P  +D     F 
Sbjct: 14  RPSRDEAEEAVRVLLRWAGDDPAREGLIDTPARVVRAYEEFFSGYTLEP--RDILARTFS 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 72  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RG+ + G+  VT+   G F  D    
Sbjct: 132 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRMLGTFRTDPSTR 191

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 192 REFLSIVAN 200


>gi|167838510|ref|ZP_02465369.1| GTP cyclohydrolase I [Burkholderia thailandensis MSMB43]
          Length = 223

 Score =  192 bits (487), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 126/190 (66%), Gaps = 2/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ +EA+ A+RV+LRW GDDP+REGL DTP RV+++Y+E F GY   P  +D     F
Sbjct: 27  NRPSRDEAEAAVRVLLRWAGDDPEREGLVDTPARVVRAYEEFFVGYALEP--RDILARTF 84

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQ
Sbjct: 85  SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQ 144

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D   
Sbjct: 145 IQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRSDPTT 204

Query: 194 TDFFLKMTHN 203
              FL +  N
Sbjct: 205 RREFLSIVAN 214


>gi|254706738|ref|ZP_05168566.1| GTP cyclohydrolase I [Brucella pinnipedialis M163/99/10]
 gi|261314202|ref|ZP_05953399.1| GTP cyclohydrolase I [Brucella pinnipedialis M163/99/10]
 gi|261303228|gb|EEY06725.1| GTP cyclohydrolase I [Brucella pinnipedialis M163/99/10]
          Length = 207

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 120/160 (75%), Gaps = 2/160 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP   EA+ A+R +L W G+DPDREGL +TP RV K+Y+ELF GY + P  ++     F
Sbjct: 26  KKPGKAEAEAAVRTLLLWAGEDPDREGLLETPKRVAKAYQELFGGYSESP--EEVLGTTF 83

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E + Y DMVL+KDISFFS+CEHH++PI GK H+AY+P+  V+GLSK+ R++++++RRLQ
Sbjct: 84  EEVAGYDDMVLVKDISFFSHCEHHMVPIIGKAHVAYLPEGRVVGLSKIARVVDIFARRLQ 143

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKR 173
            QE +T QIA +I+     +GVAV+IE +HMCM+MR I++
Sbjct: 144 TQESITAQIADSIQRILKPRGVAVMIEAEHMCMAMRSIRK 183


>gi|167564715|ref|ZP_02357631.1| GTP cyclohydrolase I [Burkholderia oklahomensis EO147]
          Length = 200

 Score =  191 bits (486), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 127/193 (65%), Gaps = 2/193 (1%)

Query: 11  MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR 70
           M   +P  +EA+ A+RV+LRW GDDP+REGL DTP RV+++Y+E F+GY   P  +D   
Sbjct: 1   MPASRPGRDEAEAAVRVLLRWAGDDPEREGLVDTPARVVRAYEEFFSGYALEP--RDILA 58

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
             F E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++
Sbjct: 59  RTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPHHRVVGISKLARLVDAFAK 118

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQIQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D
Sbjct: 119 RLQIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTD 178

Query: 191 KGKTDFFLKMTHN 203
                 FL +  N
Sbjct: 179 PATRREFLSIVAN 191


>gi|54288323|gb|AAV31611.1| predicted GTP cyclohydrolase I [uncultured alpha proteobacterium
           EBAC2C11]
          Length = 215

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 131/188 (69%), Gaps = 2/188 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           + P+ +EA++A+ V+LRWIG+DP REGL  TP RV++++KE  +GY++ P  Q   R  F
Sbjct: 27  RTPSRQEAEQAVDVLLRWIGEDPSREGLAGTPSRVVRAWKEFCSGYQENPA-QLLERT-F 84

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y DMV++++I   S+CEHH++PI G  H+AY+P + V+G+SKL R+L+ +SRRLQ
Sbjct: 85  EEVEGYDDMVMLRNIRLESHCEHHLVPILGIAHIAYLPNRRVVGISKLARVLDGFSRRLQ 144

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE LT Q+A  I++    KGVAVLI+ QH CM+ RG+++  ++ +T+ FTG F  D+  
Sbjct: 145 TQETLTAQVADCIQNVLQPKGVAVLIDAQHQCMTTRGVRKPDVSMITSRFTGIFKADESL 204

Query: 194 TDFFLKMT 201
           +  FL  T
Sbjct: 205 SRRFLDQT 212


>gi|74316260|ref|YP_314000.1| GTP cyclohydrolase I [Thiobacillus denitrificans ATCC 25259]
 gi|74055755|gb|AAZ96195.1| GTP cyclohydrolase I [Thiobacillus denitrificans ATCC 25259]
          Length = 206

 Score =  191 bits (485), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 126/187 (67%), Gaps = 2/187 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++PT E A+EA+R ++ W GDDP REGL DTP RV+++Y+E FAGY   P  Q  +R  F
Sbjct: 10  QRPTREAAEEAVRTLIAWAGDDPSREGLIDTPARVVRAYEEYFAGYPDDPA-QVLART-F 67

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y +M+++ DI F S+CEHH+ PI GK H+AY+P   V+G+SKL R++++Y++RLQ
Sbjct: 68  SEVDGYDEMIVMTDIRFESHCEHHMAPIIGKAHVAYLPTHRVVGISKLARLVDLYAKRLQ 127

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           IQER+T+QIA  + +    +GVAV+IEG H CM+ RG+ + G   VT+   G F  +   
Sbjct: 128 IQERMTVQIADTLNNVLQPQGVAVVIEGSHQCMTTRGVHKPGAAMVTSRMLGVFRSNVAT 187

Query: 194 TDFFLKM 200
              FL M
Sbjct: 188 RREFLAM 194


>gi|170736850|ref|YP_001778110.1| GTP cyclohydrolase I [Burkholderia cenocepacia MC0-3]
 gi|254249481|ref|ZP_04942801.1| GTP cyclohydrolase I [Burkholderia cenocepacia PC184]
 gi|124875982|gb|EAY65972.1| GTP cyclohydrolase I [Burkholderia cenocepacia PC184]
 gi|169819038|gb|ACA93620.1| GTP cyclohydrolase I [Burkholderia cenocepacia MC0-3]
          Length = 211

 Score =  191 bits (485), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 85/189 (44%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ E+A++A+RV+LRW GDDP REGL DTP RV+++Y++ FAGY   P  +D     F 
Sbjct: 16  RPSREQAEDAVRVLLRWAGDDPAREGLLDTPARVVRAYEQFFAGYALEP--RDILARTFS 73

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 74  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 133

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RG+ + G+  VT+   G F  D    
Sbjct: 134 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRMLGTFRTDPSTR 193

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 194 REFLSIVAN 202


>gi|225850457|ref|YP_002730691.1| GTP cyclohydrolase I [Persephonella marina EX-H1]
 gi|254791048|sp|C0QPU5|GCH1_PERMH RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|225646414|gb|ACO04600.1| GTP cyclohydrolase I [Persephonella marina EX-H1]
          Length = 185

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/187 (47%), Positives = 127/187 (67%), Gaps = 7/187 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K +IR+ L  IG+DPDREGLK+TPDR+++ ++E F  Y+    T       F +   
Sbjct: 6   EKLKRSIRLFLEAIGEDPDREGLKETPDRIVRLWEE-FKSYENFNMTV------FEDIGD 58

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y +MV+++DI F+S+CEHH+LP +GK H+AYIP+K V GLSKLVR++  ++ R Q+QERL
Sbjct: 59  YNEMVVVRDIQFYSFCEHHLLPFFGKAHIAYIPEKKVCGLSKLVRVVNKFAYRPQVQERL 118

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA  +E     KGVAV++E +H+CMSMRG+K     T+T+  TG F  D+   + FL
Sbjct: 119 TAQIAEFLEKELSPKGVAVVLEAEHLCMSMRGVKNPTSYTITSKLTGAFMEDEKTRNEFL 178

Query: 199 KMTHNQR 205
            + HN R
Sbjct: 179 NLIHNGR 185


>gi|330813812|ref|YP_004358051.1| GTP cyclohydrolase I type 1 [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486907|gb|AEA81312.1| GTP cyclohydrolase I type 1 [Candidatus Pelagibacter sp. IMCC9063]
          Length = 200

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 130/186 (69%), Gaps = 2/186 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           L+K + +EA++AI+ IL+++G++PDREGL +TP RVIK+++E F GY   P   D     
Sbjct: 12  LEKISKDEAEKAIKTILKFVGENPDREGLVETPKRVIKAFQEYFGGYLINP--DDYLEKT 69

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           FG+   Y DMV+ K+I+  S+CEHH+ PI G +H+AY+P + V+GLSKL R+++ Y+RRL
Sbjct: 70  FGDVEGYDDMVIQKNITIHSHCEHHMAPIIGTVHVAYVPSEKVVGLSKLARVVDAYARRL 129

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           Q QERLTMQIA++I     S G AV I+ +H CM+ RG++++G TT+T  FTG F   + 
Sbjct: 130 QTQERLTMQIANSIYKGLKSHGSAVSIDAEHQCMTTRGVRKEGATTITNYFTGVFRDSQN 189

Query: 193 KTDFFL 198
               FL
Sbjct: 190 LQKRFL 195


>gi|332704911|ref|ZP_08424997.1| GTP cyclohydrolase I [Lyngbya majuscula 3L]
 gi|332356263|gb|EGJ35717.1| GTP cyclohydrolase I [Lyngbya majuscula 3L]
          Length = 218

 Score =  191 bits (484), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 129/196 (65%), Gaps = 7/196 (3%)

Query: 13  LKKPTV--EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTS 69
           +++P V  EE ++A+R +L  +G++PDREGLKDTP RV+K+ K L +GY Q +    + +
Sbjct: 24  IQQPLVSEEEMRQAVRTLLLGLGENPDREGLKDTPKRVVKALKFLTSGYHQSLDELLNGA 83

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
            FH        +MVL++DI  FS CEHHILPI G  H+AYIP   VIGLSK+ RI E+Y 
Sbjct: 84  VFH----ENTNEMVLVRDIDLFSSCEHHILPILGHAHVAYIPDGKVIGLSKIARICEMYG 139

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQ+QERLT QIA A++     KGVAV++E  HMCM MRG+++ G  T T+A  G F+ 
Sbjct: 140 RRLQVQERLTAQIADALQGLLKPKGVAVVVEASHMCMVMRGVQKPGSWTATSAVRGVFAD 199

Query: 190 DKGKTDFFLKMTHNQR 205
           D      F+ + H  R
Sbjct: 200 DPKTRQEFMSLIHYNR 215


>gi|170079039|ref|YP_001735677.1| GTP cyclohydrolase I [Synechococcus sp. PCC 7002]
 gi|169886708|gb|ACB00422.1| GTP cyclohydrolase I [Synechococcus sp. PCC 7002]
          Length = 239

 Score =  190 bits (483), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 133/195 (68%), Gaps = 9/195 (4%)

Query: 15  KPTVEEAK----EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTS 69
           +P  EE++    EA+  +L  +G+DPDREGL  TP RV K+ + L  GY Q +    + +
Sbjct: 45  RPATEESQQKMAEAVHTMLEAVGEDPDREGLLKTPLRVAKAMQFLTQGYNQSLEDIVNGA 104

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
            F  G    + +MVL++DI FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+YS
Sbjct: 105 IFDEG----HNEMVLVRDIDFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYS 160

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQ+QERLT QIA A++   D +GVAV++EG HMCMSMRG+++ G  TVT+A  G F +
Sbjct: 161 RRLQVQERLTRQIAEAVQEILDPQGVAVVMEGIHMCMSMRGVQKPGSWTVTSAMIGCFQK 220

Query: 190 DKGKTDFFLKMTHNQ 204
           ++   + FL +  +Q
Sbjct: 221 EQKTREEFLNLIRHQ 235


>gi|330819250|ref|YP_004348112.1| GTP cyclohydrolase I [Burkholderia gladioli BSR3]
 gi|327371245|gb|AEA62600.1| GTP cyclohydrolase I [Burkholderia gladioli BSR3]
          Length = 220

 Score =  190 bits (483), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 127/191 (66%), Gaps = 2/191 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +++P+  EA++A+RV+LRW GDDP REGL DTP RV ++Y+E F GY+  P  +D     
Sbjct: 23  VERPSRAEAEDAVRVLLRWAGDDPAREGLLDTPARVARAYEEFFKGYQLEP--KDILART 80

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RL
Sbjct: 81  FSEVEGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRL 140

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D  
Sbjct: 141 QIQEKMTVQIADTLFEVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPS 200

Query: 193 KTDFFLKMTHN 203
               FL +  N
Sbjct: 201 TRREFLSIVSN 211


>gi|51473573|ref|YP_067330.1| GTP cyclohydrolase I [Rickettsia typhi str. Wilmington]
 gi|81610798|sp|Q68WZ4|GCH1_RICTY RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|51459885|gb|AAU03848.1| GTP cyclohydrolase I [Rickettsia typhi str. Wilmington]
          Length = 190

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/187 (48%), Positives = 124/187 (66%), Gaps = 2/187 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + KPT EEAKEA+R +LR+IG+DP REGL  TPDRVI SY E+F+GY +    Q+     
Sbjct: 1   MNKPTREEAKEAVRTLLRFIGEDPTREGLLKTPDRVINSYMEIFSGYGK--DVQEILNTK 58

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F +   +QD++ ++ I F S+CEHHILP  G +H+AYIP   +IG+SKL RI+ ++SRRL
Sbjct: 59  FYDTYNFQDLISLEGIKFTSFCEHHILPFNGTVHIAYIPDNCIIGVSKLARIVNIFSRRL 118

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T+QIA +I+ S    GVA+ I   H CMSMRG+  D     T  +TG F+  + 
Sbjct: 119 QIQEKMTVQIAESIQESLKPLGVAIKISAFHSCMSMRGVMHDNSVMNTMYYTGIFAEQQK 178

Query: 193 KTDFFLK 199
               FL 
Sbjct: 179 YRHEFLN 185


>gi|148261643|ref|YP_001235770.1| GTP cyclohydrolase I [Acidiphilium cryptum JF-5]
 gi|326405133|ref|YP_004285215.1| GTP cyclohydrolase [Acidiphilium multivorum AIU301]
 gi|146403324|gb|ABQ31851.1| GTP cyclohydrolase I [Acidiphilium cryptum JF-5]
 gi|325051995|dbj|BAJ82333.1| GTP cyclohydrolase [Acidiphilium multivorum AIU301]
          Length = 212

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/191 (45%), Positives = 126/191 (65%), Gaps = 2/191 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ E+A+ AIR ++RW GDD DREG++DTP RV ++Y++ F GY + P    +  F   
Sbjct: 18  RPSREDAEAAIRTLIRWAGDDADREGVRDTPARVARAYEDFFRGYGEDPEAILSRTFE-- 75

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MVL++DI   S+CEHH++PI G  H+AY+P + V+G+SKL R+++ Y+RRLQI
Sbjct: 76  ETEGYDEMVLLRDIRVESHCEHHMVPIIGVAHVAYLPNRRVVGISKLARVVDAYARRLQI 135

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE+LT QIA+ I      +GVAV+IE  H CMS RG+ + G++ VT+   G F  D    
Sbjct: 136 QEKLTAQIANTINEVLQPRGVAVVIEAGHECMSTRGVHKPGVSMVTSRMLGAFRDDPSTR 195

Query: 195 DFFLKMTHNQR 205
             FL M   +R
Sbjct: 196 REFLAMIQGRR 206


>gi|284054381|ref|ZP_06384591.1| GTP cyclohydrolase I [Arthrospira platensis str. Paraca]
 gi|291570818|dbj|BAI93090.1| GTP cyclohydrolase I [Arthrospira platensis NIES-39]
          Length = 239

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 134/196 (68%), Gaps = 5/196 (2%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDT 68
           N+  ++ T EE   A+  IL  +G+DP+REGL  TP RV ++ + L  GY Q +    + 
Sbjct: 45  NLGRREVTQEEMMGAVETILLGVGEDPEREGLLKTPKRVAEAMRFLTNGYSQSLEELVND 104

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
           + F  G    +++MVL++DI+FFS CEHH+LP  GK H+AYIP + VIGLSKL R++E+Y
Sbjct: 105 AIFDEG----HEEMVLVRDINFFSLCEHHMLPFMGKAHVAYIPNQKVIGLSKLARVVEMY 160

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           SRRLQ+QERLT Q+A AI+S  + +GVAV++E  HMCM+MRG+++ G  TVT+A  G F 
Sbjct: 161 SRRLQVQERLTRQVAEAIQSVLEPQGVAVVMEASHMCMAMRGVQKPGSWTVTSAMIGVFQ 220

Query: 189 RDKGKTDFFLKMTHNQ 204
            D+   + FL +  +Q
Sbjct: 221 DDQKTREEFLNLIRHQ 236


>gi|167588043|ref|ZP_02380431.1| GTP cyclohydrolase I [Burkholderia ubonensis Bu]
          Length = 209

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 125/189 (66%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+  EA+ A+RV+LRW GDDP REGL DTP RV+++Y+E F+GY   P  +D     F 
Sbjct: 14  RPSRSEAEAAVRVLLRWAGDDPAREGLVDTPARVVRAYEEFFSGYAIEP--RDILARTFS 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQI
Sbjct: 72  EVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T+QIA  +      KGV V++E  H C+S RGI + G+  VT+   G F  D    
Sbjct: 132 QEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPSTR 191

Query: 195 DFFLKMTHN 203
             FL +  N
Sbjct: 192 REFLSIVAN 200


>gi|218245727|ref|YP_002371098.1| GTP cyclohydrolase I [Cyanothece sp. PCC 8801]
 gi|257058773|ref|YP_003136661.1| GTP cyclohydrolase I [Cyanothece sp. PCC 8802]
 gi|218166205|gb|ACK64942.1| GTP cyclohydrolase I [Cyanothece sp. PCC 8801]
 gi|256588939|gb|ACU99825.1| GTP cyclohydrolase I [Cyanothece sp. PCC 8802]
          Length = 214

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 129/189 (68%), Gaps = 6/189 (3%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGE 75
           T EE ++A+R +L  +G+DPDREGL+DTP RV+K+ K L +GY Q +    + + FH   
Sbjct: 25  TEEEMRQAVRTLLLGLGEDPDREGLRDTPKRVVKALKFLTSGYHQSLDELLNGAVFH--- 81

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
                +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y RRLQ+Q
Sbjct: 82  -ENTDEMVLVRDIDLFSSCEHHILPILGRAHIAYIPDGKVIGLSKIARICEMYGRRLQVQ 140

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKT 194
           ERLT QIA A++     KGVAV++E  HMCM MRG+++ G  TVT+A  G F+ D K + 
Sbjct: 141 ERLTAQIADALQGLLQPKGVAVVVEATHMCMVMRGVQKAGSWTVTSAVRGLFAEDAKTRQ 200

Query: 195 DFFLKMTHN 203
           +F   + H+
Sbjct: 201 EFMSLIRHS 209


>gi|27380633|ref|NP_772162.1| GTP cyclohydrolase I [Bradyrhizobium japonicum USDA 110]
 gi|41017185|sp|Q89IW2|GCH1_BRAJA RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|27353798|dbj|BAC50787.1| GTP cyclohydrolase I [Bradyrhizobium japonicum USDA 110]
          Length = 229

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 127/191 (66%), Gaps = 2/191 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P   +A+ A++ +L +IG++ +REGL DTP RV++++ EL+ GY Q P   +     FG
Sbjct: 41  RPARAQAEAAVKTLLAYIGENTEREGLLDTPRRVVEAFDELYQGYHQCPA--EVLDRTFG 98

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E + Y D VL++DI F S CEHH++P +GK H+AY P + V+GLSKL R+ ++++RRLQ 
Sbjct: 99  ETAGYDDFVLVRDIEFTSQCEHHMMPFYGKAHIAYTPVERVVGLSKLARLTDIFARRLQT 158

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT QIA AI+     +GVAVLIE +H CMS+RG+ + G +T T+ FTG F  +  + 
Sbjct: 159 QEHLTAQIAAAIDEVLKPRGVAVLIEAEHTCMSVRGVAKHGASTFTSRFTGMFRDNPAEQ 218

Query: 195 DFFLKMTHNQR 205
             FL +    R
Sbjct: 219 ARFLSLVRGTR 229


>gi|157803871|ref|YP_001492420.1| GTP cyclohydrolase I [Rickettsia canadensis str. McKiel]
 gi|157785134|gb|ABV73635.1| GTP cyclohydrolase I [Rickettsia canadensis str. McKiel]
          Length = 219

 Score =  189 bits (481), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 132/191 (69%), Gaps = 2/191 (1%)

Query: 11  MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR 70
           MKL+KP+ EEAKEA+R +L++IG+DP+REGL  TPDRVI SY E+F+GY++      +++
Sbjct: 28  MKLEKPSREEAKEAVRTLLKFIGEDPNREGLLKTPDRVINSYMEIFSGYEKDVAEILSTK 87

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
           F+  +   +QD + +  I F S+CEHH+LP  G +H++YIP   +IG+SKL RI+ V++R
Sbjct: 88  FY--DTCNFQDFISLDGIRFTSFCEHHMLPFNGTVHISYIPDNCIIGISKLARIVNVFAR 145

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQIQE++T+QIA +++ +    GVAV I   H CMS+RG+ +D     T  +TG F+  
Sbjct: 146 RLQIQEKMTVQIAESVQDNLKPLGVAVRISALHSCMSIRGVIQDNSIMNTMHYTGIFAEQ 205

Query: 191 KGKTDFFLKMT 201
           +     FL +T
Sbjct: 206 QKYRHEFLNLT 216


>gi|172038848|ref|YP_001805349.1| GTP cyclohydrolase I [Cyanothece sp. ATCC 51142]
 gi|171700302|gb|ACB53283.1| GTP cyclohydrolase I [Cyanothece sp. ATCC 51142]
          Length = 239

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 130/189 (68%), Gaps = 5/189 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGE 75
           + E+ KEA+  +L  +G+DP+REGL  TP RV ++ K L  GY Q +    + + F  G 
Sbjct: 51  STEKMKEAVYTMLEAVGEDPEREGLLKTPKRVAEAMKFLTQGYNQSLEELVNGAIFDEG- 109

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
              + +MVL++DI+FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+YSRRLQ+Q
Sbjct: 110 ---HNEMVLVRDINFFSLCEHHMLPFMGQAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQ 166

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           ERLT QIA AI+   + +GVAV++E  HMCM MRG+++ G  TVT+A  GEF  ++   +
Sbjct: 167 ERLTRQIAEAIQEILEPRGVAVVMEASHMCMVMRGVQKPGSWTVTSAMIGEFDEEQKTRE 226

Query: 196 FFLKMTHNQ 204
            FL +  +Q
Sbjct: 227 EFLNLIRHQ 235


>gi|126657238|ref|ZP_01728404.1| GTP cyclohydrolase I [Cyanothece sp. CCY0110]
 gi|126621509|gb|EAZ92220.1| GTP cyclohydrolase I [Cyanothece sp. CCY0110]
          Length = 239

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 130/189 (68%), Gaps = 5/189 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGE 75
           + E+ KEA+  +L  +G+DP+REGL  TP RV ++ K L  GY Q +    + + F  G 
Sbjct: 51  STEKMKEAVYTMLEAVGEDPEREGLLKTPKRVAEAMKFLTQGYNQSLEELVNGAIFDEG- 109

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
              + +MVL++DI+FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+YSRRLQ+Q
Sbjct: 110 ---HNEMVLVRDINFFSLCEHHMLPFMGQAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQ 166

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           ERLT QIA AI+   + +GVAV++E  HMCM MRG+++ G  TVT+A  GEF  ++   +
Sbjct: 167 ERLTRQIAEAIQEILEPRGVAVVMEASHMCMVMRGVQKPGSWTVTSAMIGEFDEEQKTRE 226

Query: 196 FFLKMTHNQ 204
            FL +  +Q
Sbjct: 227 EFLNLIRHQ 235


>gi|238023557|ref|YP_002907789.1| GTP cyclohydrolase I [Burkholderia glumae BGR1]
 gi|237878222|gb|ACR30554.1| GTP cyclohydrolase I [Burkholderia glumae BGR1]
          Length = 219

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/191 (43%), Positives = 127/191 (66%), Gaps = 2/191 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + +P+  EA++A+RV+LRW GDDP REGL DTP RV+++Y+E F GY+  P  ++     
Sbjct: 22  IARPSRAEAEDAVRVLLRWAGDDPAREGLLDTPARVVRAYEEFFRGYQLEP--REILART 79

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y +M+++KDI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RL
Sbjct: 80  FSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRL 139

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T+QIA  +      KGV V++E  H C+S RG+ + G+  VT+   G F  D  
Sbjct: 140 QIQEKMTVQIADTLFEVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTSRMLGTFRSDPA 199

Query: 193 KTDFFLKMTHN 203
               FL +  N
Sbjct: 200 TRREFLSIVAN 210


>gi|119508940|ref|ZP_01628092.1| GTP cyclohydrolase I [Nodularia spumigena CCY9414]
 gi|119466469|gb|EAW47354.1| GTP cyclohydrolase I [Nodularia spumigena CCY9414]
          Length = 235

 Score =  189 bits (480), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/197 (46%), Positives = 133/197 (67%), Gaps = 8/197 (4%)

Query: 12  KLKKPTVEEAK---EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQD 67
            L  PT EE +   + +R I+  +G+DP+REGL  TP RV ++ + L +GY Q +    +
Sbjct: 39  NLHPPTAEEMESMMDGVRAIIVGVGEDPEREGLLKTPKRVAEAMQFLTSGYNQSLEELLN 98

Query: 68  TSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEV 127
            + F  G    + +MVL++DI+FFS CEHH+LP  GK H+AYIP + V+GLSKL RI+E+
Sbjct: 99  DAIFDEG----HNEMVLVRDINFFSLCEHHMLPFMGKAHVAYIPNQKVVGLSKLARIVEM 154

Query: 128 YSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           YSRRLQ+QERLT QIA AI++  + +GVAV++E  HMCM+MRG+++ G  TVT+A  G F
Sbjct: 155 YSRRLQVQERLTRQIAEAIQTILEPQGVAVVMEATHMCMAMRGVQKPGSWTVTSAMVGAF 214

Query: 188 SRDKGKTDFFLKMTHNQ 204
             D+   + F  +  +Q
Sbjct: 215 DEDQKTREEFFNLIRHQ 231


>gi|291543274|emb|CBL16383.1| GTP cyclohydrolase I [Ruminococcus sp. 18P13]
          Length = 183

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 127/181 (70%), Gaps = 5/181 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
            E+ ++ +R++L  IG+DP+REGL+DTPDRV + Y ELFAGY    +T  ++ F    AS
Sbjct: 3   AEKIRQGVRLLLEGIGEDPEREGLRDTPDRVARMYAELFAGYADSASTHLSTTF----AS 58

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              +MVL KDI+F+S CEHH+LP +GK+H+AYIP   V+G+SKL R +EV++RRLQIQE+
Sbjct: 59  PDSEMVLEKDITFYSTCEHHLLPFFGKVHIAYIPDGRVVGISKLARTVEVFARRLQIQEQ 118

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDF 196
           +T QIA A+ +    KG  V ++ +H CM+MRGIK+ G  T+T    G F++D   K +F
Sbjct: 119 MTAQIADALMAELHPKGAMVAVDAEHTCMTMRGIKKPGTRTLTYCSRGAFAKDPELKREF 178

Query: 197 F 197
           F
Sbjct: 179 F 179


>gi|197106579|ref|YP_002131956.1| GTP cyclohydrolase I [Phenylobacterium zucineum HLK1]
 gi|196479999|gb|ACG79527.1| GTP cyclohydrolase I [Phenylobacterium zucineum HLK1]
          Length = 197

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 88/185 (47%), Positives = 125/185 (67%), Gaps = 3/185 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++P+  EA  A+R ++ W GDDPDREGL DTP RV+KSYKELFAGY+  P  ++  +  F
Sbjct: 8   RRPSEAEALAAVRTLIEWAGDDPDREGLLDTPRRVVKSYKELFAGYETDP--REYLQRTF 65

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y ++V++KDI   S+CEHH+LP  GK H+ Y+P+  V+G+SKL R++  ++RRLQ
Sbjct: 66  DEVGGYDELVILKDIRVVSFCEHHMLPFLGKAHVGYLPRNRVVGISKLARVVHGFARRLQ 125

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KG 192
           IQE+LT +IA AI+     KGV V+I  +H CM+MRG+   G    T+   GE   D + 
Sbjct: 126 IQEKLTAEIAEAIQDILQPKGVGVVIVSEHSCMTMRGVNTPGSRLTTSHLLGEVRDDPRT 185

Query: 193 KTDFF 197
           +T+FF
Sbjct: 186 RTEFF 190


>gi|126654834|ref|ZP_01726368.1| GTP cyclohydrolase I [Cyanothece sp. CCY0110]
 gi|126623569|gb|EAZ94273.1| GTP cyclohydrolase I [Cyanothece sp. CCY0110]
          Length = 216

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 128/189 (67%), Gaps = 6/189 (3%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGE 75
           T EE  +A+R +L  +G+DPDREGL+DTP RV+K+ K L +GY Q +    + + FH   
Sbjct: 27  TEEEMHQAVRTLLLGLGEDPDREGLRDTPKRVVKALKFLTSGYHQSLDELLNGAVFH--- 83

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
                +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y RRLQ+Q
Sbjct: 84  -ENTDEMVLVRDIDLFSSCEHHILPILGRAHVAYIPDGKVIGLSKIARICEMYGRRLQVQ 142

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKT 194
           ERLT QIA A++     KGVAV++E  HMCM MRG+++ G  TVT+A  G F+ D K + 
Sbjct: 143 ERLTAQIADALQGLLQPKGVAVVVEATHMCMVMRGVQKPGSWTVTSAVRGMFAEDAKTRQ 202

Query: 195 DFFLKMTHN 203
           +F   + H+
Sbjct: 203 EFMSLIRHS 211


>gi|158336194|ref|YP_001517368.1| GTP cyclohydrolase I [Acaryochloris marina MBIC11017]
 gi|158306435|gb|ABW28052.1| GTP cyclohydrolase I [Acaryochloris marina MBIC11017]
          Length = 211

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 131/192 (68%), Gaps = 8/192 (4%)

Query: 15  KPTVEEAK--EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRF 71
           +P V EA+   A+R +L  +G+DPDREGL+DTP RV+KS K L +GY+Q +    + + F
Sbjct: 19  QPIVSEAEMEAAVRTLLLGMGEDPDREGLRDTPKRVVKSLKFLSSGYQQSLDELLNGAVF 78

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
               +    +MVL++DI  FS CEHHILPI GK H+AYIP   VIGLSK+ RI E+Y+RR
Sbjct: 79  ----SEDLDEMVLVRDIDLFSSCEHHILPIIGKAHVAYIPNGKVIGLSKIARICEMYARR 134

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD- 190
           LQ+QERLT QIA A++     +GVAV++E  HMCM MRG+++ G  T T+A  G FS D 
Sbjct: 135 LQVQERLTAQIADALQGLLKPQGVAVVVEASHMCMVMRGVQKPGSWTSTSAMRGVFSSDA 194

Query: 191 KGKTDFFLKMTH 202
           + + +FF  + H
Sbjct: 195 RTRQEFFNLVAH 206


>gi|83593167|ref|YP_426919.1| GTP cyclohydrolase [Rhodospirillum rubrum ATCC 11170]
 gi|83576081|gb|ABC22632.1| GTP cyclohydrolase [Rhodospirillum rubrum ATCC 11170]
          Length = 210

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/185 (49%), Positives = 128/185 (69%), Gaps = 3/185 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K  +V EA+ AI V+LR+IG+DP REGL +TP R I++    FAGY Q P     + F  
Sbjct: 23  KPVSVGEAEAAIAVLLRYIGEDPTREGLVETPARFIRACGHHFAGYAQDPLRILATTF-- 80

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E++ Y  M+L++DI F ++CEHH+ PI GK H+AY+P   V+GLSKL R+++V+++RLQ
Sbjct: 81  SESAGYAGMILLRDIRFEAFCEHHLAPIIGKAHVAYMPNDRVVGLSKLARVVDVFAKRLQ 140

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG- 192
           +QER+TMQIA AIE++   +GVAVLIE +H CMS RG  + G T VT+  TG F  D   
Sbjct: 141 LQERMTMQIATAIEAALAPRGVAVLIESEHHCMSTRGAYKPGSTMVTSVTTGCFEADGAP 200

Query: 193 KTDFF 197
           + +FF
Sbjct: 201 RREFF 205


>gi|67458991|ref|YP_246615.1| GTP cyclohydrolase I [Rickettsia felis URRWXCal2]
 gi|75536573|sp|Q4ULX3|GCH1_RICFE RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|67004524|gb|AAY61450.1| GTP cyclohydrolase I [Rickettsia felis URRWXCal2]
          Length = 190

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 127/190 (66%), Gaps = 4/190 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRF 71
           + KPT EEAKEA+R +L++IG+DP REGL  TPDRV+ SY E+F+GY K +    +T   
Sbjct: 1   MSKPTREEAKEAVRTLLKFIGEDPTREGLLKTPDRVVNSYTEIFSGYGKDVAEILNTK-- 58

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F +   +QD +L+KDI F S+CEHH+LP  G + +AYIP   ++G+SKL RI+  +S+R
Sbjct: 59  -FYDTCNFQDFILLKDIKFTSFCEHHMLPFIGTVDIAYIPDNCIVGISKLARIVNAFSKR 117

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T+QIA +++ +    GVAV I   H CMSMRG+ +D     T  +TG F+  +
Sbjct: 118 LQIQEKMTVQIAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSVMNTMHYTGIFAEQQ 177

Query: 192 GKTDFFLKMT 201
                FL +T
Sbjct: 178 KYRYDFLNLT 187


>gi|172036416|ref|YP_001802917.1| GTP cyclohydrolase I [Cyanothece sp. ATCC 51142]
 gi|171697870|gb|ACB50851.1| GTP cyclohydrolase I [Cyanothece sp. ATCC 51142]
          Length = 212

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/189 (49%), Positives = 128/189 (67%), Gaps = 6/189 (3%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGE 75
           T EE ++A+R +L  +G+DPDREGL+DTP RV+K+ K L +GY Q +    + + FH   
Sbjct: 23  TEEEMRQAVRTLLLGLGEDPDREGLRDTPKRVVKALKFLTSGYHQSLDELLNGAVFH--- 79

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
                +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y RRLQ+Q
Sbjct: 80  -ENTDEMVLVRDIDLFSSCEHHILPILGRAHVAYIPDGKVIGLSKIARICEMYGRRLQVQ 138

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKT 194
           ERLT QIA A++     KGVAV++E  HMCM MRG+++ G  T T+A  G F+ D K + 
Sbjct: 139 ERLTAQIADALQGLLQPKGVAVVVEATHMCMVMRGVQKPGSWTTTSAVRGVFAEDAKTRQ 198

Query: 195 DFFLKMTHN 203
           +F   + H+
Sbjct: 199 EFMSLIRHS 207


>gi|282899483|ref|ZP_06307449.1| GTP cyclohydrolase I [Cylindrospermopsis raciborskii CS-505]
 gi|281195640|gb|EFA70571.1| GTP cyclohydrolase I [Cylindrospermopsis raciborskii CS-505]
          Length = 235

 Score =  188 bits (478), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 134/189 (70%), Gaps = 5/189 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGE 75
           ++E+ K A+R +L  +G+DP+REGL  TP RV ++ K L +GY Q +    + + F+ G 
Sbjct: 47  SIEQMKAAVRTMLIGVGEDPEREGLLKTPKRVAEAMKFLTSGYNQSLEELVNGAIFNEG- 105

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
              +++MVL++DI+FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+Y+RRLQ+Q
Sbjct: 106 ---HEEMVLVRDINFFSLCEHHMLPFTGRAHVAYIPNQKVVGLSKLARIVEMYARRLQVQ 162

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           ERLT QIA A+++  + KGVAV++E  HMCM MRG+++ G  TVT++  G F  ++   +
Sbjct: 163 ERLTRQIAEAVQTILEPKGVAVVMEATHMCMVMRGVQKPGSWTVTSSMIGVFQEEQKTRE 222

Query: 196 FFLKMTHNQ 204
            FL +  +Q
Sbjct: 223 EFLNLIRHQ 231


>gi|15604248|ref|NP_220764.1| GTP cyclohydrolase I [Rickettsia prowazekii str. Madrid E]
 gi|9296997|sp|Q9ZDE8|GCH1_RICPR RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|3860940|emb|CAA14840.1| GTP CYCLOHYDROLASE I (folE) [Rickettsia prowazekii]
 gi|292571990|gb|ADE29905.1| GTP cyclohydrolase I [Rickettsia prowazekii Rp22]
          Length = 190

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 126/188 (67%), Gaps = 2/188 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + KPT EEAKEA+R +L++IG+DP+REGL  TPDRVI SY E+F+GY +    Q+     
Sbjct: 1   MSKPTREEAKEAVRTLLKFIGEDPNREGLLKTPDRVINSYTEIFSGYGK--DAQEILNTK 58

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F +   +QD++ ++ I F S+CEHHILP  G +H+AYIP   +IG+SKL RI+ +++RRL
Sbjct: 59  FYDICNFQDLISLEGIKFTSFCEHHILPFNGTVHIAYIPDNCIIGVSKLARIVNIFARRL 118

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T++IA +++ +    GVAV I   H CMSMRG+  D     T  +TG F+  + 
Sbjct: 119 QIQEKMTLEIAESVQENLKPLGVAVKISALHSCMSMRGVMHDNSVMNTMYYTGIFAEQQK 178

Query: 193 KTDFFLKM 200
               FL +
Sbjct: 179 YRYEFLNL 186


>gi|167648485|ref|YP_001686148.1| GTP cyclohydrolase I [Caulobacter sp. K31]
 gi|167350915|gb|ABZ73650.1| GTP cyclohydrolase I [Caulobacter sp. K31]
          Length = 213

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 87/178 (48%), Positives = 122/178 (68%), Gaps = 2/178 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++PT +EA  A+R +L W GD+PDREGL DTP RV+ +Y E FAGY   P  ++ SR  F
Sbjct: 25  QRPTRDEAMAAVRTLLAWAGDNPDREGLLDTPQRVVDAYGEWFAGYNGDPA-KELSRT-F 82

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            +   Y DMV+++ I   S+CEHH+ P  GK  +AY+P   V+GLSKL R++E++++RLQ
Sbjct: 83  EDVQGYDDMVMLRGIDVQSHCEHHMAPFLGKAWVAYMPTGKVVGLSKLARLVEIFAKRLQ 142

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
            QE +TMQIA +IE    + GVAVLI+ +H CMS RG++   ++T+TT F G F  DK
Sbjct: 143 TQETMTMQIADSIEDELSAAGVAVLIDAEHQCMSTRGVRHHDVSTITTQFRGAFKTDK 200


>gi|300023299|ref|YP_003755910.1| GTP cyclohydrolase I [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525120|gb|ADJ23589.1| GTP cyclohydrolase I [Hyphomicrobium denitrificans ATCC 51888]
          Length = 203

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 131/200 (65%), Gaps = 2/200 (1%)

Query: 4   LRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP 63
           L T V  +  ++P+  EA+EA+R ++ W GD+P R GL+ TP+RV +++ E F GYKQ  
Sbjct: 6   LPTPVTALSPRRPSRAEAEEAVRTLIAWSGDNPARPGLEKTPERVAEAFGEYFKGYKQDA 65

Query: 64  TTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVR 123
             +    F   + S Y +MVL+KDI+F S+CEHHI P +G  H+AY+P   ++GLSK+ R
Sbjct: 66  LAELAQTFE--DPSGYNEMVLLKDIAFESHCEHHIAPFFGSAHVAYLPSDRIVGLSKIAR 123

Query: 124 ILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAF 183
           ++++++RRLQ QE LT QIA  +E    ++GVA+++  +H CM+ RG+++  + TVT  F
Sbjct: 124 VVDIFARRLQTQESLTEQIATTLEEGLQARGVAIMMSARHHCMAARGVQQRDVATVTFRF 183

Query: 184 TGEFSRDKGKTDFFLKMTHN 203
            GEF R+    D F+ +  +
Sbjct: 184 LGEFERNSALRDRFMAVVRD 203


>gi|217979836|ref|YP_002363983.1| GTP cyclohydrolase I [Methylocella silvestris BL2]
 gi|217505212|gb|ACK52621.1| GTP cyclohydrolase I [Methylocella silvestris BL2]
          Length = 190

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 125/191 (65%), Gaps = 2/191 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + KPT  +A+ A+RV++ W GDDPDREGL DTP RV +SY+ELF+GY   P       F 
Sbjct: 1   MAKPTEADAEAAVRVLIEWAGDDPDREGLLDTPRRVARSYRELFSGYVADPRAYLERTFE 60

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
             E   Y ++V+++DI   S+CEHH+LP+ G+ H+ Y+P   V+G+SKL R++  ++RRL
Sbjct: 61  --EVGGYDELVVLRDIRVVSFCEHHMLPVLGRAHVGYLPTNKVVGISKLARVVHGFARRL 118

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE+LT +IA AI+   + +GV V+IE +H CMS+RG+   G T +T+   G    D  
Sbjct: 119 QIQEKLTAEIADAIQDILEPQGVGVVIEAEHSCMSLRGVNTIGATLITSRLLGVIRDDPR 178

Query: 193 KTDFFLKMTHN 203
             + FL++T  
Sbjct: 179 TREEFLRLTRG 189


>gi|209524084|ref|ZP_03272635.1| GTP cyclohydrolase I [Arthrospira maxima CS-328]
 gi|209495459|gb|EDZ95763.1| GTP cyclohydrolase I [Arthrospira maxima CS-328]
          Length = 215

 Score =  188 bits (477), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 94/186 (50%), Positives = 127/186 (68%), Gaps = 6/186 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           EE ++A+R +L  +G++PDREGLKDTP RV+K+ K L +GY Q +    + + FH     
Sbjct: 29  EEMRQAVRTLLLGLGENPDREGLKDTPKRVVKALKFLTSGYHQSLDELLNGAVFH----E 84

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y+RRLQ+QER
Sbjct: 85  NTDEMVLVRDIDIFSSCEHHILPILGRAHVAYIPDGKVIGLSKVARICEMYARRLQVQER 144

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDF 196
           LT QIA A++     KGVAV++E  HMCM MRG+++ G  T T+A  G FS D K + +F
Sbjct: 145 LTAQIADALQGLLKPKGVAVVVEASHMCMVMRGVQKVGSWTSTSAVRGVFSEDAKTRQEF 204

Query: 197 FLKMTH 202
              + H
Sbjct: 205 MSLIRH 210


>gi|170076598|ref|YP_001733237.1| GTP cyclohydrolase I [Synechococcus sp. PCC 7002]
 gi|169887460|gb|ACB01168.1| GTP cyclohydrolase I [Synechococcus sp. PCC 7002]
          Length = 212

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 131/199 (65%), Gaps = 6/199 (3%)

Query: 4   LRTGVFNMKLKKPTVE-EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ- 61
           +R    N ++K P  E E + A+R +L  +G+DPDREGL+DTP R++K+ K L +GY Q 
Sbjct: 10  IRQQTINTEIKPPVSEAEMQAAVRTLLLGLGEDPDREGLRDTPKRLVKALKFLTSGYHQS 69

Query: 62  IPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKL 121
           +    + + FH        +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+
Sbjct: 70  LDELLNGAVFH----ENTNEMVLVRDIDLFSSCEHHILPILGRAHVAYIPNGKVIGLSKI 125

Query: 122 VRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTT 181
            RI E+Y+RRLQ+QERLT QIA A+      +GVAV++E  HMCM MRG+++ G  TVT+
Sbjct: 126 ARICEMYARRLQVQERLTQQIADALHGLLQPQGVAVVVEATHMCMVMRGVEKPGSWTVTS 185

Query: 182 AFTGEFSRDKGKTDFFLKM 200
           +  G F+ +      F+++
Sbjct: 186 SMQGIFADNDATRQEFMEL 204


>gi|315498777|ref|YP_004087581.1| gtp cyclohydrolase i [Asticcacaulis excentricus CB 48]
 gi|315416789|gb|ADU13430.1| GTP cyclohydrolase I [Asticcacaulis excentricus CB 48]
          Length = 222

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 127/189 (67%), Gaps = 2/189 (1%)

Query: 11  MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR 70
           + +++P+ EEA  A+R +L W GDDP REGL DTP RV+++Y E F+GY+  P  ++ SR
Sbjct: 32  LNVERPSKEEAMAAVRTLLAWAGDDPTREGLIDTPKRVVEAYDEWFSGYQADPA-KELSR 90

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
             F +   Y DMV+++ I   S+CEHH+    GK ++AY+P   V+G+SK+ R++E++S+
Sbjct: 91  T-FEDVQGYDDMVMLRHIDVESHCEHHMASFLGKAYVAYMPTAKVVGISKIARVVEIFSK 149

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ QE LT QIA AIE S    GVAVLI+ +H CM+ RG+    +TTVTT FTG F  D
Sbjct: 150 RLQTQETLTKQIADAIEQSLAPLGVAVLIDAEHQCMTTRGVHHKNVTTVTTRFTGVFKAD 209

Query: 191 KGKTDFFLK 199
               D F++
Sbjct: 210 LALQDRFMR 218


>gi|209524934|ref|ZP_03273479.1| GTP cyclohydrolase I [Arthrospira maxima CS-328]
 gi|209494583|gb|EDZ94893.1| GTP cyclohydrolase I [Arthrospira maxima CS-328]
          Length = 239

 Score =  187 bits (476), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 92/189 (48%), Positives = 129/189 (68%), Gaps = 5/189 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGE 75
           T EE   A+  IL  +G+DP+REGL  TP RV  + + L  GY Q +    + + F  G 
Sbjct: 52  TQEEMMGAVETILLGVGEDPEREGLLKTPKRVADAMRFLTNGYSQSLEELVNDAIFDEG- 110

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
              +++MVL++DI+FFS CEHH+LP  GK H+AYIP + VIGLSKL R++E+YSRRLQ+Q
Sbjct: 111 ---HEEMVLVRDINFFSLCEHHMLPFMGKAHVAYIPNQKVIGLSKLARVVEMYSRRLQVQ 167

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           ERLT Q+A AI+S  + +GVAV++E  HMCM+MRG+++ G  TVT+A  G F  D+   +
Sbjct: 168 ERLTRQVAEAIQSVLEPQGVAVVMEASHMCMAMRGVQKPGSWTVTSAMIGVFQDDQKTRE 227

Query: 196 FFLKMTHNQ 204
            FL +  +Q
Sbjct: 228 EFLNLIRHQ 236


>gi|16331608|ref|NP_442336.1| GTP cyclohydrolase I [Synechocystis sp. PCC 6803]
 gi|2494696|sp|Q55759|GCH1_SYNY3 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|1001671|dbj|BAA10406.1| GTP cyclohydrolase I [Synechocystis sp. PCC 6803]
          Length = 234

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 133/196 (67%), Gaps = 8/196 (4%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDT 68
           N++L K   E+  +A+RV+L  +G+DP+REGL  TP RV ++ + L  GY Q +    + 
Sbjct: 42  NVELNK---EKMMDAVRVMLESVGEDPEREGLLKTPKRVAEAMQFLTQGYDQSLEKLVNG 98

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
           + F  G    + +MVL++DI FFS CEHH+LP  GK HLAYIP + V+GLSKL RI+E++
Sbjct: 99  AIFDEG----HNEMVLVRDIDFFSLCEHHMLPFMGKAHLAYIPNQKVVGLSKLARIVEMF 154

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           SRRLQ+QERLT QIA A++   D +GVAV++E  HMCM MRG+++ G  TVT+A  G F 
Sbjct: 155 SRRLQVQERLTRQIAEAVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMIGSFQ 214

Query: 189 RDKGKTDFFLKMTHNQ 204
            ++   + FL +  +Q
Sbjct: 215 NEQKTREEFLNLIRHQ 230


>gi|22002492|gb|AAM82644.1| Gch1 [Synechococcus elongatus PCC 7942]
          Length = 219

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 129/186 (69%), Gaps = 5/186 (2%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASK 78
           E + A+R +L  +G+DP+REGL  TP RV ++Y+ L +GY Q +    + + F  G    
Sbjct: 33  EMEAAVRTLLLGVGEDPEREGLLKTPKRVAEAYRFLTSGYSQSLDDLVNGAIFDEG---- 88

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           + +MVL++DI+ FS CEHH+LP  GK+H+AYIP + V+GLSKL RI+E+YSRRLQ+QERL
Sbjct: 89  HNEMVLVRDITAFSLCEHHMLPFMGKVHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERL 148

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA +++   D +GVAV++E  HMCM MRG+++ G  TVT+A  G F  D+   + FL
Sbjct: 149 TRQIAESVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVFQEDQRTREEFL 208

Query: 199 KMTHNQ 204
            +  +Q
Sbjct: 209 SLIRHQ 214


>gi|329849854|ref|ZP_08264700.1| GTP cyclohydrolase I [Asticcacaulis biprosthecum C19]
 gi|328841765|gb|EGF91335.1| GTP cyclohydrolase I [Asticcacaulis biprosthecum C19]
          Length = 210

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 128/189 (67%), Gaps = 2/189 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +P+ E+A EA+R +L W GD+PDREGL DTP RV+ +Y+E F GY   P  ++ SR  F
Sbjct: 23  NRPSREQAMEAVRTLLAWAGDNPDREGLIDTPKRVVDAYQEWFQGYDADPK-KELSR-TF 80

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            +   Y DMV++++I   S+CEHH+ P  GK  +AY+P + V+G+SK+ R++E++++RLQ
Sbjct: 81  EDVQGYDDMVMLREIDVESHCEHHMAPFLGKAWVAYMPTEKVVGISKIARVVEIFAKRLQ 140

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
            QE +T Q+A A+E S    GVAVLI+ +H CMS RG+    ++TVTT FTG F  D   
Sbjct: 141 TQETMTKQVADALEDSLAPLGVAVLIDAEHQCMSTRGVHHKNVSTVTTRFTGVFKTDTVL 200

Query: 194 TDFFLKMTH 202
            + FL++T 
Sbjct: 201 QERFLRLTQ 209


>gi|1399847|gb|AAB82043.1| GTP cyclohydrolase I [Synechococcus elongatus PCC 7942]
          Length = 215

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 129/186 (69%), Gaps = 5/186 (2%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASK 78
           E + A+R +L  +G+DP+REGL  TP RV ++Y+ L +GY Q +    + + F  G    
Sbjct: 29  EMEAAVRTLLLGVGEDPEREGLLKTPKRVAEAYRFLTSGYSQSLDDLVNGAIFDEG---- 84

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           + +MVL++DI+ FS CEHH+LP  GK+H+AYIP + V+GLSKL RI+E+YSRRLQ+QERL
Sbjct: 85  HNEMVLVRDITAFSLCEHHMLPFMGKVHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERL 144

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA +++   D +GVAV++E  HMCM MRG+++ G  TVT+A  G F  D+   + FL
Sbjct: 145 TRQIAESVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVFQEDQRTREEFL 204

Query: 199 KMTHNQ 204
            +  +Q
Sbjct: 205 SLIRHQ 210


>gi|56750063|ref|YP_170764.1| GTP cyclohydrolase I [Synechococcus elongatus PCC 6301]
 gi|81300406|ref|YP_400614.1| GTP cyclohydrolase I [Synechococcus elongatus PCC 7942]
 gi|23831177|sp|Q54769|GCH1_SYNE7 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|81596931|sp|Q5N623|GCH1_SYNP6 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|56685022|dbj|BAD78244.1| GTP cyclohydrolase I [Synechococcus elongatus PCC 6301]
 gi|81169287|gb|ABB57627.1| GTP cyclohydrolase [Synechococcus elongatus PCC 7942]
          Length = 213

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 129/186 (69%), Gaps = 5/186 (2%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASK 78
           E + A+R +L  +G+DP+REGL  TP RV ++Y+ L +GY Q +    + + F  G    
Sbjct: 27  EMEAAVRTLLLGVGEDPEREGLLKTPKRVAEAYRFLTSGYSQSLDDLVNGAIFDEG---- 82

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           + +MVL++DI+ FS CEHH+LP  GK+H+AYIP + V+GLSKL RI+E+YSRRLQ+QERL
Sbjct: 83  HNEMVLVRDITAFSLCEHHMLPFMGKVHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERL 142

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA +++   D +GVAV++E  HMCM MRG+++ G  TVT+A  G F  D+   + FL
Sbjct: 143 TRQIAESVQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVFQEDQRTREEFL 202

Query: 199 KMTHNQ 204
            +  +Q
Sbjct: 203 SLIRHQ 208


>gi|300864525|ref|ZP_07109389.1| GTP cyclohydrolase [Oscillatoria sp. PCC 6506]
 gi|300337483|emb|CBN54537.1| GTP cyclohydrolase [Oscillatoria sp. PCC 6506]
          Length = 243

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 129/187 (68%), Gaps = 5/187 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           +E   A+R +L  +G+DP+REGL  TP RV ++ K L +GY Q +    + + F  G   
Sbjct: 57  DEMMAAVRTMLLGVGEDPEREGLLKTPKRVAEAMKFLTSGYSQSLEELLNGAIFDEG--- 113

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
            + +MVL++DIS FS CEHH+LP  GK H+AYIP + V+GLSKL RI+E+Y+RRLQ+QER
Sbjct: 114 -HNEMVLVRDISVFSLCEHHMLPFMGKAHVAYIPNQKVVGLSKLARIVEMYARRLQVQER 172

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QIA A+++  + KGVAV++E  HMCM MRG+++ G  TVT+A  GEF  ++   + F
Sbjct: 173 LTRQIAEAVQTILEPKGVAVVLEASHMCMVMRGVQKPGSWTVTSAMLGEFQDEQKTREEF 232

Query: 198 LKMTHNQ 204
           L +  +Q
Sbjct: 233 LNLIRHQ 239


>gi|186682125|ref|YP_001865321.1| GTP cyclohydrolase I [Nostoc punctiforme PCC 73102]
 gi|229487980|sp|B2J1L7|GCH1_NOSP7 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|186464577|gb|ACC80378.1| GTP cyclohydrolase I [Nostoc punctiforme PCC 73102]
          Length = 235

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 134/191 (70%), Gaps = 6/191 (3%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFH 72
           K+  +EE K+A+R I+  +G+DP+REGL  TP RV ++ + L +GY Q +    + + F 
Sbjct: 44  KEEHIEEMKDAVRKIILGVGEDPEREGLLKTPKRVAEAMRFLTSGYNQSLEELVNDAIFD 103

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
            G    + +MVL++DI+FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+YSRRL
Sbjct: 104 EG----HNEMVLVRDINFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRL 159

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-K 191
           Q+QERLT QIA AI++  + +GVAV++E  HMCM MRG+++ G  TVT+A  G F  + K
Sbjct: 160 QVQERLTRQIAEAIQTILEPRGVAVVMEASHMCMVMRGVQKPGSWTVTSAMVGVFQEEHK 219

Query: 192 GKTDFFLKMTH 202
            + +FF  + H
Sbjct: 220 TREEFFNLIRH 230


>gi|289423521|ref|ZP_06425322.1| GTP cyclohydrolase I [Peptostreptococcus anaerobius 653-L]
 gi|289156023|gb|EFD04687.1| GTP cyclohydrolase I [Peptostreptococcus anaerobius 653-L]
          Length = 184

 Score =  187 bits (475), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 91/173 (52%), Positives = 121/173 (69%), Gaps = 4/173 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +++A++A+R +L  IG+DPDREGL DTP RV K YKE+ AGY   P+   +  F   +A 
Sbjct: 4   IDKAQKAVRDLLIAIGEDPDREGLVDTPKRVAKMYKEVLAGYDDDPSEYLSRVFKADDA- 62

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              D VL KDI F+S CEHH+LP +GK+H+AYIP   V GLSKL R++EVY+RRLQ+QE+
Sbjct: 63  ---DWVLEKDIHFYSMCEHHMLPFFGKVHIAYIPNGKVTGLSKLARLVEVYARRLQLQEQ 119

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +T+QIA A+       GV V++E +HMCM+MRGIK+ G  TVT A  G F  D
Sbjct: 120 MTVQIADALVKELSPLGVVVIVEAEHMCMTMRGIKKPGTITVTQATRGRFKED 172


>gi|313889442|ref|ZP_07823090.1| GTP cyclohydrolase I [Streptococcus pseudoporcinus SPIN 20026]
 gi|313122274|gb|EFR45365.1| GTP cyclohydrolase I [Streptococcus pseudoporcinus SPIN 20026]
          Length = 187

 Score =  187 bits (474), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 125/185 (67%), Gaps = 4/185 (2%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+EAI  +L  +G+DP REGL+DTP RV+K Y+E+FAG +  P  + T+ F       Y 
Sbjct: 6   AEEAIYQLLEALGEDPKREGLRDTPKRVVKMYREMFAGLEMDPKNEFTTVFA---EETYD 62

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLT 139
           D+VL+KDI F+S CEHH++P +GK H+AYIP    V GLSKL R +EV S++ Q+QERLT
Sbjct: 63  DLVLVKDIPFYSMCEHHLVPFYGKAHVAYIPSGGRVTGLSKLARAVEVASKKPQLQERLT 122

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA A+E +   KGV VL+E +HMCM+MRGIK+ G  TVT    G F  D+    + L+
Sbjct: 123 SQIAIALEEALQPKGVFVLVEAEHMCMTMRGIKKPGSKTVTKMARGSFIEDRESQRYILE 182

Query: 200 MTHNQ 204
           +  ++
Sbjct: 183 LIKDK 187


>gi|332705840|ref|ZP_08425916.1| GTP cyclohydrolase I [Lyngbya majuscula 3L]
 gi|332355632|gb|EGJ35096.1| GTP cyclohydrolase I [Lyngbya majuscula 3L]
          Length = 240

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 130/195 (66%), Gaps = 9/195 (4%)

Query: 15  KPTVEEAKE----AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTS 69
           +P +EE  +    A+  IL  +G+DP REGL  TP RV+++ + L  GY Q +    + +
Sbjct: 46  QPPLEELNQEMINAVSTILLGVGEDPQREGLLKTPKRVVEAMRFLTGGYNQSLEAIVNGA 105

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
            F  G    + +MVL++DI+FFS CEHH+LP  GK H+AYIP + V+GLSK+ R++E+Y+
Sbjct: 106 IFDEG----HNEMVLVRDINFFSLCEHHMLPFMGKAHVAYIPNQKVVGLSKIARVVEMYA 161

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQ+QERLT QIA AI++  D KGVAV++E  HMCM MRG+++ G  T T+A  G F  
Sbjct: 162 RRLQVQERLTRQIAEAIQAVLDPKGVAVVMEATHMCMVMRGVQKPGSWTATSAMVGIFQE 221

Query: 190 DKGKTDFFLKMTHNQ 204
           D+   + FL +  +Q
Sbjct: 222 DQKTREEFLNLIRHQ 236


>gi|218245774|ref|YP_002371145.1| GTP cyclohydrolase I [Cyanothece sp. PCC 8801]
 gi|257058820|ref|YP_003136708.1| GTP cyclohydrolase I [Cyanothece sp. PCC 8802]
 gi|218166252|gb|ACK64989.1| GTP cyclohydrolase I [Cyanothece sp. PCC 8801]
 gi|256588986|gb|ACU99872.1| GTP cyclohydrolase I [Cyanothece sp. PCC 8802]
          Length = 239

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 128/187 (68%), Gaps = 5/187 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           E+  EA+R +L  +G+DP+REGL  TP RV ++   L  GY Q + T  + + F  G   
Sbjct: 53  EKMMEAVRTMLEALGEDPEREGLLKTPKRVAEAMAFLTEGYSQSLETLVNGAIFDEG--- 109

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
            + +MVL++DI+FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+YSRRLQ+QER
Sbjct: 110 -HNEMVLVRDINFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQER 168

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QIA A++   D +GVAV++E  HMCM MRG+++ G  TVT+A  G F  ++   + F
Sbjct: 169 LTRQIAEAVQEILDPRGVAVVMEASHMCMVMRGVQKPGSWTVTSAMLGVFQDEQKTREEF 228

Query: 198 LKMTHNQ 204
           L +  +Q
Sbjct: 229 LNLIRHQ 235


>gi|284053685|ref|ZP_06383895.1| GTP cyclohydrolase I [Arthrospira platensis str. Paraca]
 gi|291566543|dbj|BAI88815.1| GTP cyclohydrolase I [Arthrospira platensis NIES-39]
          Length = 215

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/186 (50%), Positives = 126/186 (67%), Gaps = 6/186 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           EE ++A+R +L  +G++PDREGLKDTP RV+K+ K L +GY Q +    + + FH     
Sbjct: 29  EEMRQAVRTLLLGLGENPDREGLKDTPKRVVKALKFLTSGYHQSLDELLNGAVFH----E 84

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y RRLQ+QER
Sbjct: 85  NTDEMVLVRDIDIFSSCEHHILPILGRAHVAYIPDGKVIGLSKVARICEMYGRRLQVQER 144

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDF 196
           LT QIA A++     KGVAV++E  HMCM MRG+++ G  T T+A  G FS D K + +F
Sbjct: 145 LTAQIADALQGLLKPKGVAVVVEASHMCMVMRGVQKVGSWTSTSAVRGVFSEDAKTRQEF 204

Query: 197 FLKMTH 202
              + H
Sbjct: 205 MSLIRH 210


>gi|67925134|ref|ZP_00518508.1| GTP cyclohydrolase I [Crocosphaera watsonii WH 8501]
 gi|67853028|gb|EAM48413.1| GTP cyclohydrolase I [Crocosphaera watsonii WH 8501]
          Length = 241

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/189 (47%), Positives = 130/189 (68%), Gaps = 5/189 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGE 75
           +++  +EA+  +L  +G+DP+REGL  TP RV ++ K L  GY Q +    + + F  G 
Sbjct: 53  SMDRMEEAVYTMLEELGEDPEREGLLKTPKRVAEAMKFLTQGYNQSLEELVNGAIFDEG- 111

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
              + +MVL++DI+FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+YSRRLQ+Q
Sbjct: 112 ---HNEMVLVRDINFFSLCEHHMLPFMGQAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQ 168

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           ERLT QIA AI+   + +GVAV+IE  HMCM MRG+++ G  TVT+A  GEF  ++   +
Sbjct: 169 ERLTRQIAEAIQEILEPRGVAVVIEASHMCMVMRGVQKPGSWTVTSAMLGEFDEEQKTRE 228

Query: 196 FFLKMTHNQ 204
            FL +  +Q
Sbjct: 229 EFLNLIRHQ 237


>gi|158340039|ref|YP_001521209.1| GTP cyclohydrolase I [Acaryochloris marina MBIC11017]
 gi|158310280|gb|ABW31895.1| GTP cyclohydrolase I [Acaryochloris marina MBIC11017]
          Length = 210

 Score =  186 bits (473), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/192 (48%), Positives = 133/192 (69%), Gaps = 6/192 (3%)

Query: 15  KPTVEEA--KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +P V EA  + A+R +L  +G+DPDREGL+DTP R++K+ K L +GY+Q    +  +   
Sbjct: 18  QPIVSEAEMQAAVRTLLLGLGEDPDREGLRDTPKRMVKALKFLTSGYQQ-SLDELLNGAI 76

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E     +MVL++DI  FS CEHHI PI GK+H+AYIP   VIGLSK+ RI E+Y+RRL
Sbjct: 77  FPE--DLDEMVLVRDIDLFSSCEHHIWPIIGKVHVAYIPNGKVIGLSKIARICEMYARRL 134

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-K 191
           Q+QERLT QIA A++   + +GVAV++E  HMCM MRG+++ G  T T+A  G FS D +
Sbjct: 135 QVQERLTAQIADALQGLLNPQGVAVVVEASHMCMVMRGVQKPGSWTSTSAMRGVFSSDSR 194

Query: 192 GKTDFFLKMTHN 203
            + +FF  ++H+
Sbjct: 195 TRQEFFNLISHS 206


>gi|157964461|ref|YP_001499285.1| GTP cyclohydrolase I [Rickettsia massiliae MTU5]
 gi|166989690|sp|A8F1F2|GCH1_RICM5 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|157844237|gb|ABV84738.1| GTP cyclohydrolase I [Rickettsia massiliae MTU5]
          Length = 189

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 127/190 (66%), Gaps = 5/190 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRF 71
           + KPT EEAKEA+R +L++IG+DP REGL  TPDRVI SY E+F+GY K +    +T   
Sbjct: 1   MSKPTREEAKEAVRTLLKFIGEDPSREGLLKTPDRVINSYAEIFSGYGKDVAKILNTK-- 58

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   +QD +L+ +I F S+CEHHILP  G + +AY+P   ++G+SKL RI+ +++RR
Sbjct: 59  -FYETCNFQDFILL-NIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T+QIA +++ +    GVAV I   H CMSMRG+ +D     T  +TG F+  +
Sbjct: 117 LQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQ 176

Query: 192 GKTDFFLKMT 201
                FL +T
Sbjct: 177 KYRHEFLNLT 186


>gi|119713631|gb|ABL97682.1| GTP cyclohydrolase I [uncultured marine bacterium EB0_39H12]
          Length = 192

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 125/178 (70%), Gaps = 2/178 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KKP+ EEA+EA+R ++ W GD+P+REGL +TP RV+KSY+E + GY Q P  +  S+  F
Sbjct: 3   KKPSREEAEEAVRTLISWAGDNPEREGLIETPKRVVKSYEEFYQGYDQNPD-EILSKV-F 60

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y ++VL+KDI   S+CEHH++PI GK H+AY+P + V+GLSKL R+++++ +RLQ
Sbjct: 61  EEIEGYDEIVLVKDIPLHSHCEHHMVPIIGKAHVAYLPDQRVVGLSKLARVVDMFGKRLQ 120

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
            QE +T QIA  I      +GVAV+I+ +H CMS RG+ + G +T+T+   G F  ++
Sbjct: 121 TQETMTAQIADTINDVLKPRGVAVIIDAEHQCMSSRGVSKHGASTITSRMLGVFRENQ 178


>gi|71275859|ref|ZP_00652143.1| GTP cyclohydrolase I [Xylella fastidiosa Dixon]
 gi|71899355|ref|ZP_00681515.1| GTP cyclohydrolase I [Xylella fastidiosa Ann-1]
 gi|170730157|ref|YP_001775590.1| GTP cyclohydrolase I [Xylella fastidiosa M12]
 gi|229488270|sp|B0U794|GCH1_XYLFM RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|71163437|gb|EAO13155.1| GTP cyclohydrolase I [Xylella fastidiosa Dixon]
 gi|71730869|gb|EAO32940.1| GTP cyclohydrolase I [Xylella fastidiosa Ann-1]
 gi|167964950|gb|ACA11960.1| GTP cyclohydrolase I [Xylella fastidiosa M12]
          Length = 203

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 126/183 (68%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV+++Y + F+GY++ P   D  +  F E 
Sbjct: 12  TQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDP--HDYLQRTFEEI 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           S Y +M+++++I++ S+CEHH+ PI GK+H+ Y+P   V+G+SKL R++E Y+RR QIQE
Sbjct: 70  SGYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVESYARRFQIQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+ +   +GV V+IEG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAACIQETLSPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|307155351|ref|YP_003890735.1| GTP cyclohydrolase I [Cyanothece sp. PCC 7822]
 gi|306985579|gb|ADN17460.1| GTP cyclohydrolase I [Cyanothece sp. PCC 7822]
          Length = 247

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/186 (47%), Positives = 128/186 (68%), Gaps = 5/186 (2%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASK 78
           +  +A+R+IL  +G+DPDREGL  TP RV ++ + L  GY Q +    + + F  G    
Sbjct: 62  QMSDAVRMILEAVGEDPDREGLLKTPKRVAEAMQFLTQGYNQSLEEIVNGAIFDEG---- 117

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           + +MVL++DI FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+YSRRLQ+QERL
Sbjct: 118 HNEMVLVRDIDFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERL 177

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA AI+   + +GVAV++E  HMCM MRG+++ G  TVT+A  G F  ++   + FL
Sbjct: 178 TRQIAEAIKEILEPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMLGVFQEEQKTREEFL 237

Query: 199 KMTHNQ 204
            + H++
Sbjct: 238 NLIHHR 243


>gi|304319903|ref|YP_003853546.1| GTP cyclohydrolase I [Parvularcula bermudensis HTCC2503]
 gi|303298806|gb|ADM08405.1| GTP cyclohydrolase I [Parvularcula bermudensis HTCC2503]
          Length = 203

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 83/186 (44%), Positives = 125/186 (67%), Gaps = 2/186 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ E A+EA+R +++W GDDP REGL DTP RV +++++ F+GY +    +      F 
Sbjct: 17  RPSREAAEEAVRTLIKWAGDDPGREGLIDTPARVARAFEDWFSGYGE--DAEAVLSRTFE 74

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y D+VL++DI   SYCEHH+ PI GK H+AY+P   V+G+SKL R+++++ +RLQ+
Sbjct: 75  EVEGYDDIVLMRDIRLESYCEHHMAPIIGKAHIAYLPDGKVVGISKLARLVDIFGKRLQV 134

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE++T QIA  +E     KGVA+++E +H CMS RG+ + G+ T+TT FTG F  D    
Sbjct: 135 QEKMTAQIADTLERVLKPKGVAIMVEAEHQCMSTRGVHKHGVDTMTTRFTGVFKDDPALE 194

Query: 195 DFFLKM 200
             F K+
Sbjct: 195 SRFFKL 200


>gi|194333692|ref|YP_002015552.1| GTP cyclohydrolase I [Prosthecochloris aestuarii DSM 271]
 gi|194311510|gb|ACF45905.1| GTP cyclohydrolase I [Prosthecochloris aestuarii DSM 271]
          Length = 226

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 125/187 (66%), Gaps = 3/187 (1%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +E    A+  IL  +G++P+REGL  TP+RV KS + L  GY++ P  +   +  F E+ 
Sbjct: 42  IETLSSAVTTILGGLGENPEREGLLKTPERVAKSLRFLTKGYRENPE-ELLKKAVFKES- 99

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
            Y +MVL+KDI  FS CEHH+LP +GK H+AYIP   ++GLSK+ R++EVY+RRLQ+QER
Sbjct: 100 -YDEMVLVKDIELFSMCEHHMLPFFGKAHVAYIPDGKIVGLSKIARVVEVYARRLQVQER 158

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QI  AI+   + KGV V+IE +HMCM MRG+++    T T+A +GEF         F
Sbjct: 159 LTQQIRDAIQDVLNPKGVGVIIEAKHMCMVMRGVEKQNSVTTTSAMSGEFISSPSTRSEF 218

Query: 198 LKMTHNQ 204
           L++ HN+
Sbjct: 219 LRLIHNR 225


>gi|323136850|ref|ZP_08071931.1| GTP cyclohydrolase I [Methylocystis sp. ATCC 49242]
 gi|322398167|gb|EFY00688.1| GTP cyclohydrolase I [Methylocystis sp. ATCC 49242]
          Length = 190

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 124/189 (65%), Gaps = 2/189 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + KPT  +A+ A+RV++ W GDDP+REGL DTP RV++SY+ELFAGY   P  ++  +  
Sbjct: 1   MAKPTQADAEAAVRVLIEWAGDDPNREGLLDTPARVVRSYRELFAGYAIDP--REYMKRT 58

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y ++V++K+I   S+CEHH+LP+ G+ H+ Y+P   V+G+SKL R++  +SRRL
Sbjct: 59  FEEVGGYDELVVLKNIRVVSFCEHHMLPVIGRAHVGYLPTNRVVGISKLARVVHGFSRRL 118

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE+LT +IA AI+      GV V+IE +H CM++RG+   G +  T+   G    D  
Sbjct: 119 QIQEKLTAEIAEAIQDILQPAGVGVVIEAEHNCMTLRGVNTPGSSLTTSKLLGVIRDDPR 178

Query: 193 KTDFFLKMT 201
             + FL M 
Sbjct: 179 TREEFLGMA 187


>gi|71897944|ref|ZP_00680149.1| GTP cyclohydrolase I [Xylella fastidiosa Ann-1]
 gi|71732188|gb|EAO34243.1| GTP cyclohydrolase I [Xylella fastidiosa Ann-1]
          Length = 203

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 126/183 (68%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV+++Y + F+GY++ P   D  +  F E 
Sbjct: 12  TQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDP--HDYLQRTFEEI 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           S Y +M+++++I++ S+CEHH+ PI GK+H+ Y+P   V+G+SKL R++E Y+RR QIQE
Sbjct: 70  SGYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVESYARRFQIQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+ +   +GV V+IEG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAACIQDTLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|268315768|ref|YP_003289487.1| GTP cyclohydrolase I [Rhodothermus marinus DSM 4252]
 gi|262333302|gb|ACY47099.1| GTP cyclohydrolase I [Rhodothermus marinus DSM 4252]
          Length = 220

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 125/183 (68%), Gaps = 9/183 (4%)

Query: 20  EAKEAI----RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           EA EAI    R ILRWIG+DPDREGL+ TP+RV  + + L  GY Q P    + + F   
Sbjct: 36  EATEAIQQHVREILRWIGEDPDREGLRRTPERVALALQYLTQGYHQDPRAILEAALFE-- 93

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
               Y +M+L++DI  +S CEHH+LP +GK H+AYIP K ++GLSK+ R+++V++RRLQ+
Sbjct: 94  --EDYSEMILVRDIQIYSLCEHHLLPFFGKAHVAYIPNKKIVGLSKIPRVVDVFARRLQV 151

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QERLT+QI  A+E      GVAV+IE QH+CM MRG+++    T T+A +GEF ++  + 
Sbjct: 152 QERLTIQIRDALEEVLQPLGVAVVIEAQHLCMMMRGVEKQHAITTTSAMSGEFLKEATRA 211

Query: 195 DFF 197
           +F 
Sbjct: 212 EFM 214


>gi|218440766|ref|YP_002379095.1| GTP cyclohydrolase I [Cyanothece sp. PCC 7424]
 gi|218173494|gb|ACK72227.1| GTP cyclohydrolase I [Cyanothece sp. PCC 7424]
          Length = 218

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 126/182 (69%), Gaps = 4/182 (2%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDM 82
           +A+R +L  +G+DPDREGL+DTP RV+K+ K L +GY Q    +  +   FGE +   +M
Sbjct: 36  QAVRTLLLGLGEDPDREGLRDTPKRVVKALKFLTSGYHQ-SLDELLNGAVFGEDTN--EM 92

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           VL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y+RRLQ+QERLT QI
Sbjct: 93  VLVRDIDLFSSCEHHILPILGRAHVAYIPNGKVIGLSKIARICEMYARRLQVQERLTAQI 152

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFFLKMT 201
           A A++     +GVAV+IE  HMCM MRG+++ G  T T+A  G F+ D K + +F   + 
Sbjct: 153 ADALQGLLKPQGVAVVIEATHMCMVMRGVQKPGSWTSTSAVRGVFAEDAKTRQEFMSLIR 212

Query: 202 HN 203
           HN
Sbjct: 213 HN 214


>gi|282897462|ref|ZP_06305464.1| GTP cyclohydrolase I [Raphidiopsis brookii D9]
 gi|281198114|gb|EFA73008.1| GTP cyclohydrolase I [Raphidiopsis brookii D9]
          Length = 235

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 132/189 (69%), Gaps = 5/189 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGE 75
           ++E+ K A++ +L  +G+DP REGL  TP RV ++ K L +GY Q +    + + F  G 
Sbjct: 47  SIEQMKAAVQTMLIGVGEDPQREGLLKTPKRVAEAMKFLTSGYNQSLEELVNGAIFDEG- 105

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
              +++MVL++DI+FFS CEHH+LP  G+ H+AYIP K V+GLSKL RI+E+Y+RRLQ+Q
Sbjct: 106 ---HEEMVLVRDINFFSLCEHHMLPFMGRAHVAYIPNKKVVGLSKLARIVEMYARRLQVQ 162

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           ERLT QIA A+++  + KGVAV++E  HMCM MRG+++ G  TVT++  G F  ++   +
Sbjct: 163 ERLTRQIAEAVQTILEPKGVAVVMEATHMCMVMRGVQKPGSWTVTSSMIGVFQDEQKTRE 222

Query: 196 FFLKMTHNQ 204
            FL +  +Q
Sbjct: 223 EFLNLIRHQ 231


>gi|241762071|ref|ZP_04760155.1| GTP cyclohydrolase I [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752350|ref|YP_003225243.1| GTP cyclohydrolase I [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283856426|ref|YP_162964.2| GTP cyclohydrolase I [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373537|gb|EER63124.1| GTP cyclohydrolase I [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258551713|gb|ACV74659.1| GTP cyclohydrolase I [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283775428|gb|AAV89853.2| GTP cyclohydrolase I [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 201

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 121/182 (66%), Gaps = 2/182 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           EE +EAIR ++RW GDDPDREGL DTP RV K++K    GY++ P  ++  +  F E   
Sbjct: 19  EEIQEAIRSLIRWAGDDPDREGLIDTPKRVAKAWKYYCRGYREDP--ENHLKTVFEEVGG 76

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y D+VL+KDI F+S+CEHH+ PI G  H+AY+P K V+GLSKL R+L+ Y+ RLQIQERL
Sbjct: 77  YDDIVLLKDIPFYSHCEHHMAPIMGHAHIAYLPDKKVVGLSKLARVLKGYAHRLQIQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T Q+A  I ++   +GVAV+I   H CM+ RG++   + TVT    G +S D  +    L
Sbjct: 137 TAQVADCIWNNLRPRGVAVVISAVHSCMAARGVETPNVQTVTKTLRGIYSEDPEQAKMIL 196

Query: 199 KM 200
            +
Sbjct: 197 NL 198


>gi|78045076|ref|YP_359802.1| GTP cyclohydrolase I [Carboxydothermus hydrogenoformans Z-2901]
 gi|123576525|sp|Q3ADI2|GCH1_CARHZ RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|77997191|gb|ABB16090.1| GTP cyclohydrolase I [Carboxydothermus hydrogenoformans Z-2901]
          Length = 192

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 120/166 (72%), Gaps = 5/166 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R+IL  IG+DPDREGLKDTP RV + Y+E+FAG  Q P+      F      ++++MV
Sbjct: 10  AVRMILEAIGEDPDREGLKDTPKRVARMYEEVFAGLSQDPSEHLERYF----TEEHEEMV 65

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           L+KDI  +S CEHH+LP +GK H+AYIP+K  V GLSKL R++E +++R Q+QERLT QI
Sbjct: 66  LVKDIPLYSMCEHHLLPFYGKAHVAYIPRKGKVTGLSKLARVVEGFAKRPQLQERLTSQI 125

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           A AI    + +GV V+IE +HMCM+MRG+K+ G  T+T+A  G F+
Sbjct: 126 ADAIMEKLNPRGVLVVIEAEHMCMTMRGVKKPGSKTITSAVRGIFA 171


>gi|332522155|ref|ZP_08398407.1| GTP cyclohydrolase I [Streptococcus porcinus str. Jelinkova 176]
 gi|332313419|gb|EGJ26404.1| GTP cyclohydrolase I [Streptococcus porcinus str. Jelinkova 176]
          Length = 187

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 125/185 (67%), Gaps = 4/185 (2%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+EAI  +L  +G+DP REGL DTP RV+K Y+E+FAG +  P  + T+ F       Y 
Sbjct: 6   AEEAIYQLLEALGEDPQREGLIDTPKRVVKMYQEMFAGLEMNPKNEFTTVF---AEETYD 62

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLT 139
           D+VL+KDI F+S CEHH++P +GK H+AYIP+   V GLSKL R +EV S+R Q+QERLT
Sbjct: 63  DIVLVKDIPFYSMCEHHLVPFYGKAHVAYIPRGGRVTGLSKLARAVEVASKRPQLQERLT 122

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA A+E +   +GV VL+E +HMCM+MRGIK+ G  TVT    G F  D+    + L+
Sbjct: 123 SQIAIALEEALHPEGVFVLVEAEHMCMTMRGIKKPGSKTVTKMARGSFIEDRESQRYILE 182

Query: 200 MTHNQ 204
           +  ++
Sbjct: 183 LIKDK 187


>gi|326387834|ref|ZP_08209440.1| GTP cyclohydrolase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207880|gb|EGD58691.1| GTP cyclohydrolase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 206

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 89/182 (48%), Positives = 121/182 (66%), Gaps = 10/182 (5%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K P  +  +EAIR ++RW GDDP+REGL+DTP RV +++KE   GY + P+      FH 
Sbjct: 19  KIPVPDHVQEAIRTLIRWAGDDPEREGLRDTPLRVARAWKEYCQGYGEDPS------FHL 72

Query: 74  G----EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
           G    E   Y ++VL+KDI F S+CEHH+ PI GK  +AY+P+  V+G+SKL R+L  Y+
Sbjct: 73  GRQFEEVGGYHELVLLKDIPFQSHCEHHMAPIIGKASIAYLPRDKVVGISKLARVLHGYA 132

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQIQERLT ++A  I  S    GVAV+IE QH CM+ RG++  G+  VT+   GEF +
Sbjct: 133 RRLQIQERLTSEVAQCIWDSLKPHGVAVVIEAQHGCMTGRGVRTPGVGMVTSRLMGEFLK 192

Query: 190 DK 191
           D 
Sbjct: 193 DN 194


>gi|182681421|ref|YP_001829581.1| GTP cyclohydrolase I [Xylella fastidiosa M23]
 gi|32129537|sp|Q87D63|GCH1_XYLFT RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|229488274|sp|B2I4L2|GCH1_XYLF2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|182631531|gb|ACB92307.1| GTP cyclohydrolase I [Xylella fastidiosa M23]
 gi|307579867|gb|ADN63836.1| GTP cyclohydrolase I [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 203

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 126/183 (68%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV+++Y + F+GY++ P   D  +  F E 
Sbjct: 12  TQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDP--HDYLQRTFEEI 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           S Y +M+++++I++ S+CEHH+ PI GK+H+ Y+P   V+G+SKL R++E Y+RR QIQE
Sbjct: 70  SCYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVESYARRFQIQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+ +   +GV V+IEG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAACIQDTLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|294086010|ref|YP_003552770.1| GTP cyclohydrolase I [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665585|gb|ADE40686.1| GTP cyclohydrolase I [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 213

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 123/183 (67%), Gaps = 2/183 (1%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE 75
           P+ EEA+ A+ V+LRW GDDP REGL  TP RV +++KE   GY + P   +     F E
Sbjct: 27  PSREEAEAAVEVLLRWAGDDPTREGLVGTPGRVARAWKEFCVGYTEDP--MEMLERTFDE 84

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
              Y DMV++++I   S+CEHH++PI G  H+AY+P K V+G+SKL R+L+ ++RRLQ Q
Sbjct: 85  VEGYDDMVMLRNIRMESHCEHHMVPILGVAHIAYMPDKRVVGISKLARVLDSFARRLQTQ 144

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           E LT Q+A+ I+++   KGVA+L++ QH CM+ RG+++  ++ +TT FTG F  D     
Sbjct: 145 ETLTAQVANCIQTALKPKGVAILMDAQHQCMTTRGVRKPDVSMLTTRFTGVFENDADLRG 204

Query: 196 FFL 198
            FL
Sbjct: 205 RFL 207


>gi|159026950|emb|CAO89201.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 232

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/190 (48%), Positives = 130/190 (68%), Gaps = 9/190 (4%)

Query: 16  PTVEEAKE----AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSR 70
           PT +E KE    A+R IL  +G+DP+REGL  TP RV ++ + L  GY+Q + T  + + 
Sbjct: 39  PTCDENKEQMMDAVRNILISVGEDPEREGLLKTPKRVAEAMQFLTQGYQQSLETLVNGAI 98

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
           F  G    + +MVL++DI FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+YSR
Sbjct: 99  FDEG----HNEMVLVRDIDFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSR 154

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ+QERLT QIA AI+   D +GVAV++E  HMCM MRG+++ G  TVT+A  G F  +
Sbjct: 155 RLQVQERLTRQIAEAIQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMLGVFQDE 214

Query: 191 KGKTDFFLKM 200
           +   + +L +
Sbjct: 215 QKTREEYLNL 224


>gi|28198728|ref|NP_779042.1| GTP cyclohydrolase I [Xylella fastidiosa Temecula1]
 gi|28056819|gb|AAO28691.1| GTP cyclohydrolase I [Xylella fastidiosa Temecula1]
          Length = 206

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 126/183 (68%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV+++Y + F+GY++ P   D  +  F E 
Sbjct: 15  TQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDP--HDYLQRTFEEI 72

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           S Y +M+++++I++ S+CEHH+ PI GK+H+ Y+P   V+G+SKL R++E Y+RR QIQE
Sbjct: 73  SCYDEMIVLRNITYESHCEHHMAPIIGKVHVGYLPNGKVVGISKLARVVESYARRFQIQE 132

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+ +   +GV V+IEG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 133 KMTAQIAACIQDTLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAE 192

Query: 197 FLK 199
           FL+
Sbjct: 193 FLQ 195


>gi|255528519|ref|ZP_05395302.1| GTP cyclohydrolase I [Clostridium carboxidivorans P7]
 gi|296188763|ref|ZP_06857149.1| GTP cyclohydrolase I [Clostridium carboxidivorans P7]
 gi|255507789|gb|EET84246.1| GTP cyclohydrolase I [Clostridium carboxidivorans P7]
 gi|296046648|gb|EFG86096.1| GTP cyclohydrolase I [Clostridium carboxidivorans P7]
          Length = 185

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 88/181 (48%), Positives = 121/181 (66%), Gaps = 4/181 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           K A+R+I+  IG++PDREGL++TPDR+ + Y E+FAG +Q P       F      K  D
Sbjct: 8   KTAVRMIIEAIGENPDREGLQETPDRIARMYSEIFAGLEQSPEKHLKKIF----TVKSND 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL KDI F+S CEHH++P +GK H+AYIP   V GLSKL R +EV+++R Q+QERLT Q
Sbjct: 64  IVLEKDIQFYSMCEHHLVPFYGKAHIAYIPDGKVTGLSKLARTVEVFAKRPQLQERLTGQ 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           +A AI    ++KGV V++E +HMCM+MRG+K+ G  TVT    GEF  +    D   KM 
Sbjct: 124 VADAIMEYLNAKGVMVVVEAEHMCMTMRGVKKPGSRTVTVVTRGEFHENHSLKDEVYKMI 183

Query: 202 H 202
           +
Sbjct: 184 N 184


>gi|329890425|ref|ZP_08268768.1| GTP cyclohydrolase 1 [Brevundimonas diminuta ATCC 11568]
 gi|328845726|gb|EGF95290.1| GTP cyclohydrolase 1 [Brevundimonas diminuta ATCC 11568]
          Length = 204

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 87/194 (44%), Positives = 127/194 (65%), Gaps = 2/194 (1%)

Query: 8   VFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQD 67
           V N   ++P+ E+A EA+R ++ W GD+PDR GL DTP RV+ +Y E F GY      ++
Sbjct: 11  VANEAPQRPSREQALEAVRTLIAWAGDNPDRPGLLDTPKRVVDAYGEWFDGYDA-DAGKE 69

Query: 68  TSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEV 127
            SR  F + + Y DMV+++DI   S+CEHH+ P  GK ++AY+P + V+G+SKL R++E+
Sbjct: 70  LSRT-FEDVTGYDDMVILRDIEVESHCEHHLAPFLGKAYVAYLPGEKVVGISKLARVVEI 128

Query: 128 YSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           ++RRLQ QE LT  I  AIES    +GVAVL++  H CM+ RG+    ++T+TT FTG F
Sbjct: 129 FARRLQNQETLTNDIIDAIESHLQPRGVAVLVDAAHQCMTTRGVHHRHVSTITTRFTGAF 188

Query: 188 SRDKGKTDFFLKMT 201
             D    + FLK+ 
Sbjct: 189 KNDPALAERFLKLA 202


>gi|329888177|ref|ZP_08266775.1| GTP cyclohydrolase I [Brevundimonas diminuta ATCC 11568]
 gi|328846733|gb|EGF96295.1| GTP cyclohydrolase I [Brevundimonas diminuta ATCC 11568]
          Length = 196

 Score =  185 bits (469), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 122/185 (65%), Gaps = 2/185 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           EEA+ A+R ++RW GD+P REGL +TP RV KSY+ELF GY+  P  +D     F E   
Sbjct: 14  EEAEAAVRTLIRWAGDNPAREGLIETPKRVAKSYRELFQGYEVEP--RDYLEKTFEEVGG 71

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y ++V++KDI F S+CEHH+LP+ GK H+AY+P   V+G+SKL R++  Y+RRLQIQE++
Sbjct: 72  YDELVVLKDIRFVSFCEHHMLPVVGKAHVAYLPTDRVVGISKLARVVRGYARRLQIQEKM 131

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T +IA+AI+      GV V+IE +H CM+MRG+   G +  T+   G    D    + FL
Sbjct: 132 TSEIANAIQDVLRPHGVGVVIEAEHSCMTMRGVDVPGASLSTSCLLGAVREDPRTREEFL 191

Query: 199 KMTHN 203
           ++   
Sbjct: 192 RLVRG 196


>gi|17232213|ref|NP_488761.1| GTP cyclohydrolase I [Nostoc sp. PCC 7120]
 gi|25090420|sp|Q8YN49|GCH12_ANASP RecName: Full=GTP cyclohydrolase 1 2; AltName: Full=GTP
           cyclohydrolase I 2; Short=GTP-CH-I 2
 gi|17133858|dbj|BAB76420.1| GTP cyclohydrolase I [Nostoc sp. PCC 7120]
          Length = 216

 Score =  184 bits (468), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/193 (48%), Positives = 131/193 (67%), Gaps = 6/193 (3%)

Query: 14  KKPTVEEAK--EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           + PTV EA+  +A+R +L  +G++PDREGL DTP RV+K+ + L  GY +    +  +  
Sbjct: 23  QTPTVTEAEMVQAVRTLLIGLGENPDREGLLDTPKRVVKALQFLTKGYNE-SLDELLNGA 81

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E +   +MVLI+DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ R+ E+Y+RR
Sbjct: 82  VFTEDAN--EMVLIRDIDIFSSCEHHILPIIGRAHVAYIPNGKVIGLSKIARVCEMYARR 139

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT+QIA A++     +GVAV+IE  HMCM MRG+++ G  TVT+A  G F+ D 
Sbjct: 140 LQVQERLTLQIADALQGLLKPQGVAVVIEATHMCMVMRGVQKPGSWTVTSAMRGVFAEDA 199

Query: 192 GKTDFFLKMT-HN 203
              + F+ +  HN
Sbjct: 200 RTREEFMNLVRHN 212


>gi|119488421|ref|ZP_01621594.1| GTP cyclohydrolase I [Lyngbya sp. PCC 8106]
 gi|119455232|gb|EAW36372.1| GTP cyclohydrolase I [Lyngbya sp. PCC 8106]
          Length = 231

 Score =  184 bits (468), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 127/183 (69%), Gaps = 5/183 (2%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQD-TSRFHFGEASKYQD 81
           EA+R +L  +G+DP+REGL  TP RV  + + L +GY Q  + +D  +   F E   +++
Sbjct: 50  EAVRTMLLGVGEDPEREGLLKTPKRVADAMRFLTSGYNQ--SLEDLVNEAIFDEG--HEE 105

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL++DI+ FS CEHH+LP  GK H+AYIP + VIGLSKL RI+E+Y+RRLQ+QERLT Q
Sbjct: 106 MVLVRDITVFSMCEHHMLPFMGKAHVAYIPNQKVIGLSKLARIVEMYARRLQVQERLTRQ 165

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA A++   D +GVAV+IE  HMCM MRG+++ G  TVT+A  G F  ++   + FL + 
Sbjct: 166 IAEAVQGVLDPQGVAVVIEASHMCMVMRGVQKPGSWTVTSAMVGVFQDEQKTREEFLNLI 225

Query: 202 HNQ 204
            +Q
Sbjct: 226 RHQ 228


>gi|254416103|ref|ZP_05029858.1| GTP cyclohydrolase I [Microcoleus chthonoplastes PCC 7420]
 gi|196177036|gb|EDX72045.1| GTP cyclohydrolase I [Microcoleus chthonoplastes PCC 7420]
          Length = 207

 Score =  184 bits (468), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 130/195 (66%), Gaps = 8/195 (4%)

Query: 15  KPTV--EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRF 71
           KP V  EE ++A+R +L  +G++PDREGL+DTP RV+K+ K L +GY Q +    + + F
Sbjct: 15  KPLVSDEEMRQAVRTLLLGLGENPDREGLQDTPKRVVKALKFLTSGYHQSLDELLNGAVF 74

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
                    +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y RR
Sbjct: 75  ----TEDANEMVLVRDIDIFSSCEHHILPILGRAHVAYIPNGKVIGLSKIARICEMYGRR 130

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD- 190
           LQ+QERLT QIA A+      +GVAV++E  H+CM MRG+++ G  TVT+A  G F+ D 
Sbjct: 131 LQVQERLTAQIADALTELLKPQGVAVVVEATHLCMVMRGVQKPGSWTVTSAVRGVFAEDA 190

Query: 191 KGKTDFFLKMTHNQR 205
           + + +F   + HN R
Sbjct: 191 RTRQEFMDLVRHNPR 205


>gi|15838577|ref|NP_299265.1| GTP cyclohydrolase I [Xylella fastidiosa 9a5c]
 gi|9107094|gb|AAF84785.1|AE004018_1 GTP cyclohydrolase I [Xylella fastidiosa 9a5c]
          Length = 206

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 126/183 (68%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV+++Y + F+GY++ P   D  +  F E 
Sbjct: 15  TQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDP--HDYLQRTFEEI 72

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           S Y +++++++I++ S+CEHH+ PI GK+H+ Y+P   V+G+SKL R++E Y+RR QIQE
Sbjct: 73  SGYDELIVLRNITYESHCEHHMAPIIGKVHIGYLPNGKVVGISKLARVVESYARRFQIQE 132

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+ +   +GV V+IEG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 133 KMTAQIAACIQETLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAE 192

Query: 197 FLK 199
           FL+
Sbjct: 193 FLQ 195


>gi|166366344|ref|YP_001658617.1| GTP cyclohydrolase I [Microcystis aeruginosa NIES-843]
 gi|166088717|dbj|BAG03425.1| GTP cyclohydrolase I [Microcystis aeruginosa NIES-843]
          Length = 232

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/190 (48%), Positives = 130/190 (68%), Gaps = 9/190 (4%)

Query: 16  PTVEEAKE----AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSR 70
           PT +E KE    A+R IL  +G+DP+REGL  TP RV ++ + L  GY+Q + T  + + 
Sbjct: 39  PTSDENKEQMMDAVRNILISVGEDPEREGLLKTPKRVAEAMQFLTQGYQQSLETLVNGAI 98

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
           F  G    + +MVL++DI FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+YSR
Sbjct: 99  FDEG----HNEMVLVRDIDFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSR 154

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ+QERLT QIA AI+   D +GVAV++E  HMCM MRG+++ G  TVT+A  G F  +
Sbjct: 155 RLQVQERLTRQIAEAIQEILDPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMLGVFQDE 214

Query: 191 KGKTDFFLKM 200
           +   + +L +
Sbjct: 215 QKTREEYLNL 224


>gi|312865353|ref|ZP_07725581.1| GTP cyclohydrolase I [Streptococcus downei F0415]
 gi|311099464|gb|EFQ57680.1| GTP cyclohydrolase I [Streptococcus downei F0415]
          Length = 187

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 89/183 (48%), Positives = 126/183 (68%), Gaps = 5/183 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A++AI  +L  IG+DP REGL +TP RV K Y E+FAG ++ P  Q T+ F    +  
Sbjct: 5   EKAEKAIYQLLEAIGEDPQREGLLETPKRVAKMYAEMFAGLEENPKDQFTAVF----SEN 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F+S CEHH++P +G  H+AY+P +  V GLSKL R +EV S+R Q+QER
Sbjct: 61  HEEVVLVKDIPFYSMCEHHLVPFYGVAHVAYLPSQSKVTGLSKLARAVEVASKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT Q+A A+E + D KGV V++E +HMCM+MRGIK+ G  TVTT   G F  D+ +    
Sbjct: 121 LTEQVAKALEEALDPKGVFVMVEAEHMCMTMRGIKKPGSKTVTTVARGLFKEDRDQRQEL 180

Query: 198 LKM 200
           L +
Sbjct: 181 LTL 183


>gi|229586652|ref|YP_002845153.1| GTP cyclohydrolase I [Rickettsia africae ESF-5]
 gi|259647324|sp|C3PNA0|GCH1_RICAE RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|228021702|gb|ACP53410.1| GTP cyclohydrolase I [Rickettsia africae ESF-5]
          Length = 189

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 126/190 (66%), Gaps = 5/190 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRF 71
           + KPT EEA EA+R +L++IG+DP REGL  TPDRVI SY E+F+GY K +    +T   
Sbjct: 1   MSKPTREEATEAVRTLLKFIGEDPSREGLLQTPDRVINSYVEIFSGYGKDVAEILNTK-- 58

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   +QD +L+ +I F S+CEHHILP  G + +AYIP   ++G+SKL RI+ +++RR
Sbjct: 59  -FYETCNFQDFILL-NIKFTSFCEHHILPFNGTVDIAYIPDNCIVGISKLARIVNIFARR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T+QIA +++ +    GVAV I   H CMSMRG+ +D     T  +TG F+  +
Sbjct: 117 LQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQ 176

Query: 192 GKTDFFLKMT 201
                FL +T
Sbjct: 177 KYRHEFLNLT 186


>gi|25090444|sp|Q9PC02|GCH1_XYLFA RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
          Length = 203

 Score =  184 bits (468), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 126/183 (68%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV+++Y + F+GY++ P   D  +  F E 
Sbjct: 12  TQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVVEAYGDWFSGYREDP--HDYLQRTFEEI 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           S Y +++++++I++ S+CEHH+ PI GK+H+ Y+P   V+G+SKL R++E Y+RR QIQE
Sbjct: 70  SGYDELIVLRNITYESHCEHHMAPIIGKVHIGYLPNGKVVGISKLARVVESYARRFQIQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+ +   +GV V+IEG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAACIQETLTPRGVGVVIEGAHACMTTRGIHKRGVSMVTSKMLGTFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|157828401|ref|YP_001494643.1| GTP cyclohydrolase I [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933111|ref|YP_001649900.1| GTP cyclohydrolase I [Rickettsia rickettsii str. Iowa]
 gi|166220283|sp|A8GRW0|GCH1_RICRS RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|189045194|sp|B0BXB8|GCH1_RICRO RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|157800882|gb|ABV76135.1| GTP cyclohydrolase I [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908198|gb|ABY72494.1| GTP cyclohydrolase I [Rickettsia rickettsii str. Iowa]
          Length = 189

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 127/190 (66%), Gaps = 5/190 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRF 71
           + KPT EEAKEA+R +L++IG+DP REGL  TPDRVI SY E+F+GY K +    +T   
Sbjct: 1   MSKPTREEAKEAVRTLLKFIGEDPSREGLLKTPDRVINSYAEIFSGYGKDVAEILNTK-- 58

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   ++D +L+ +I F S+CEHHILP  G + +AY+P   ++G+SKL RI+ +++RR
Sbjct: 59  -FYETCNFRDFILL-NIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T+QIA +++ +    GVAV I   H CMSMRG+ +D     T  +TG F+  +
Sbjct: 117 LQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQ 176

Query: 192 GKTDFFLKMT 201
                FL +T
Sbjct: 177 KYRHEFLNLT 186


>gi|75908170|ref|YP_322466.1| GTP cyclohydrolase I [Anabaena variabilis ATCC 29413]
 gi|75701895|gb|ABA21571.1| GTP cyclohydrolase I [Anabaena variabilis ATCC 29413]
          Length = 216

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 131/193 (67%), Gaps = 6/193 (3%)

Query: 14  KKPTVEEAK--EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           + PTV EA+  +A+R +L  +G++PDREGL DTP RV+K+ + L  GY +    +  +  
Sbjct: 23  QTPTVTEAEMVQAVRTLLIGLGENPDREGLLDTPKRVVKALQFLTKGYNE-SLDELLNGA 81

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E +   +MVLI+DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ R+ E+Y+RR
Sbjct: 82  VFTEDAN--EMVLIRDIDIFSSCEHHILPIIGRAHVAYIPNGKVIGLSKIARVCEMYARR 139

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT+QIA A++     +GVAV++E  HMCM MRG+++ G  TVT+A  G F+ D 
Sbjct: 140 LQVQERLTLQIADALQGLLKPQGVAVVVEATHMCMVMRGVQKPGSWTVTSAMRGVFAEDA 199

Query: 192 GKTDFFLKMT-HN 203
              + F+ +  HN
Sbjct: 200 RTREEFMNLVRHN 212


>gi|21233583|ref|NP_639500.1| GTP cyclohydrolase I [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66770549|ref|YP_245311.1| GTP cyclohydrolase I [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188993775|ref|YP_001905785.1| GTP cyclohydrolase I [Xanthomonas campestris pv. campestris str.
           B100]
 gi|21115446|gb|AAM43382.1| GTP cyclohydrolase I [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66575881|gb|AAY51291.1| GTP cyclohydrolase I [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167735535|emb|CAP53750.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 209

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 82/197 (41%), Positives = 127/197 (64%), Gaps = 2/197 (1%)

Query: 3   CLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQI 62
           C+R    +      T  +A+EA+R +LRW G+DP REGL DTP RV ++Y + F+GY++ 
Sbjct: 7   CMRMSQSDQPDSSVTQAQAEEAVRTLLRWAGEDPAREGLLDTPRRVAEAYGDWFSGYREE 66

Query: 63  PTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLV 122
           P       F   E + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL 
Sbjct: 67  PRAYLERTFE--EVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLA 124

Query: 123 RILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTA 182
           R++E Y+RR Q+QE++T QIA  I+     +GV V++EG H CM+ RGI + G++ VT+ 
Sbjct: 125 RVVESYARRFQVQEKMTAQIAQCIQDVLQPRGVGVVVEGAHECMTTRGIHKRGVSMVTSK 184

Query: 183 FTGEFSRDKGKTDFFLK 199
             G F  D      FL+
Sbjct: 185 MLGSFREDARTRAEFLQ 201


>gi|254413379|ref|ZP_05027150.1| GTP cyclohydrolase I [Microcoleus chthonoplastes PCC 7420]
 gi|196179999|gb|EDX74992.1| GTP cyclohydrolase I [Microcoleus chthonoplastes PCC 7420]
          Length = 224

 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 134/197 (68%), Gaps = 8/197 (4%)

Query: 12  KLKKP---TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQD 67
           KL+ P   + E+  +A+R +L  +G+DP+REGL  TP RV ++ + L  GY Q +    +
Sbjct: 28  KLQIPGEASTEDMMDAVRTLLLGVGEDPEREGLLKTPKRVAEAMRFLTGGYNQSLEELVN 87

Query: 68  TSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEV 127
            + F  G    + +MVL++DI+FFS CEHH+LP  G+ H+AYIP + V+GLSKL R++E+
Sbjct: 88  GAIFDEG----HNEMVLVRDINFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARVVEM 143

Query: 128 YSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           Y+RRLQ+QERLT QIA AI++  + +GVAV++E  HMCM MRG+++ G  TVT+A  G F
Sbjct: 144 YARRLQVQERLTRQIAEAIQTILEPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMVGVF 203

Query: 188 SRDKGKTDFFLKMTHNQ 204
             ++   + FL +  +Q
Sbjct: 204 QEEQKTREEFLNLIRHQ 220


>gi|239947221|ref|ZP_04698974.1| GTP cyclohydrolase I [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921497|gb|EER21521.1| GTP cyclohydrolase I [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 190

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 127/190 (66%), Gaps = 4/190 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRF 71
           + KPT EEAKEA+R +L++IG+DP+REGL  TP+RVI SY+E+F+GY K I     T   
Sbjct: 1   MSKPTREEAKEAVRTLLKFIGEDPNREGLLKTPERVINSYEEIFSGYEKDIAEILSTK-- 58

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F +   +QD + ++ I F S+CEHH+LP  G +++AYIP   +IG+SKL RI+ +++RR
Sbjct: 59  -FFDTCNFQDFISLEGIKFTSFCEHHMLPFNGTVYIAYIPDNCIIGISKLARIVNIFARR 117

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T+QIA +++ +    GVAV I   H CMSMRG+ +D     T   TG F+  +
Sbjct: 118 LQIQEKMTVQIAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSVMNTMHCTGIFAEQQ 177

Query: 192 GKTDFFLKMT 201
                FL +T
Sbjct: 178 KYRHEFLNLT 187


>gi|15892450|ref|NP_360164.1| GTP cyclohydrolase I [Rickettsia conorii str. Malish 7]
 gi|34580555|ref|ZP_00142035.1| GTP cyclohydrolase I [Rickettsia sibirica 246]
 gi|23821619|sp|Q92I93|GCH1_RICCN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|15619604|gb|AAL03065.1| GTP cyclohydrolase I [Rickettsia conorii str. Malish 7]
 gi|28261940|gb|EAA25444.1| GTP cyclohydrolase I [Rickettsia sibirica 246]
          Length = 189

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 127/190 (66%), Gaps = 5/190 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRF 71
           + KPT EEAKEA+R +L++IG+DP REGL  TPDRVI SY E+F+GY K +    +T   
Sbjct: 1   MSKPTREEAKEAVRTLLKFIGEDPSREGLLQTPDRVINSYVEIFSGYGKDVAEILNTK-- 58

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   ++D +L+ +I F S+CEHHILP  G + +AY+P   ++G+SKL RI+ +++RR
Sbjct: 59  -FYETCNFRDFILL-NIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T+QIA +++ +    GVAV I   H CMSMRG+ +D     T  +TG F+  +
Sbjct: 117 LQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQ 176

Query: 192 GKTDFFLKMT 201
                FL +T
Sbjct: 177 KYRHEFLNLT 186


>gi|166365027|ref|YP_001657300.1| GTP cyclohydrolase I [Microcystis aeruginosa NIES-843]
 gi|166087400|dbj|BAG02108.1| GTP cyclohydrolase I [Microcystis aeruginosa NIES-843]
          Length = 218

 Score =  184 bits (467), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 95/183 (51%), Positives = 125/183 (68%), Gaps = 7/183 (3%)

Query: 14  KKPTVE-EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRF 71
           K P  E E  +A+R +L  +G+DPDREGL+DTP RV+K+ K L +GY+Q +    + + F
Sbjct: 26  KSPVSEAEMMQAVRTLLLGLGEDPDREGLRDTPKRVVKALKFLTSGYQQSLDELLNGAVF 85

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
           H        +MVLI+DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y+RR
Sbjct: 86  H----ENANEMVLIRDIDIFSSCEHHILPIIGRAHVAYIPNGKVIGLSKIARICEMYARR 141

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT QIA A++     +GVAV+IE  HMCM MRG+++ G  T T+A  G F+ D 
Sbjct: 142 LQVQERLTAQIADALQGLLQPQGVAVVIEATHMCMVMRGVEKPGSWTSTSAVRGIFA-DS 200

Query: 192 GKT 194
            KT
Sbjct: 201 AKT 203


>gi|317499944|ref|ZP_07958180.1| GTP cyclohydrolase I [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331087833|ref|ZP_08336758.1| GTP cyclohydrolase 1 [Lachnospiraceae bacterium 3_1_46FAA]
 gi|316898661|gb|EFV20696.1| GTP cyclohydrolase I [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330409528|gb|EGG88969.1| GTP cyclohydrolase 1 [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 186

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 89/182 (48%), Positives = 124/182 (68%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+R++L  IG+D DREGL +TPDR+ +  +E++ GY++         FH     +
Sbjct: 5   EKVKKAVRLLLEGIGEDADREGLIETPDRIARMCEEIYGGYEEDAKEHLCKTFHV----E 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             DMV+ KDI+F+S CEHH+LP +GK H+AYIP   V GLSKL R +EV++RRLQ+QE+L
Sbjct: 61  NSDMVVEKDITFYSMCEHHLLPFYGKAHIAYIPDGKVAGLSKLARTVEVFARRLQLQEQL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA A+ +   +KG AV+IE +HMCM+MRGIK+ G  TVT A  G F  D    + F 
Sbjct: 121 TGQIADALMNELKAKGAAVVIEAEHMCMTMRGIKKPGSRTVTFAKRGLFETDPALEERFF 180

Query: 199 KM 200
           +M
Sbjct: 181 RM 182


>gi|159027457|emb|CAO89422.1| folE2 [Microcystis aeruginosa PCC 7806]
          Length = 218

 Score =  184 bits (466), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 125/183 (68%), Gaps = 7/183 (3%)

Query: 14  KKPTVE-EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRF 71
           K P  E E  +AIR +L  +G+DPDREGL+DTP RV+K+ K L +GY+Q +    + + F
Sbjct: 26  KSPVSEFEMMQAIRTLLLGLGEDPDREGLRDTPKRVVKALKFLTSGYQQSLDELLNGAVF 85

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
           H        +MVLI+DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y+RR
Sbjct: 86  H----EDANEMVLIRDIDIFSSCEHHILPIIGRAHVAYIPNGKVIGLSKIARICEMYARR 141

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT QIA A++     +GVAV+IE  HMCM MRG+++ G  T T+A  G F+ D 
Sbjct: 142 LQVQERLTAQIADALQGLLQPQGVAVVIEATHMCMVMRGVEKPGSWTSTSAVRGIFA-DS 200

Query: 192 GKT 194
            KT
Sbjct: 201 AKT 203


>gi|114326751|ref|YP_743908.1| GTP cyclohydrolase I [Granulibacter bethesdensis CGDNIH1]
 gi|114314925|gb|ABI60985.1| GTP cyclohydrolase I [Granulibacter bethesdensis CGDNIH1]
          Length = 217

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 81/189 (42%), Positives = 125/189 (66%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ +EA++A+R +LRW  DDP REGL++TP RV+++Y+E FAGY   P         F 
Sbjct: 23  RPSRQEAEQAVRTLLRWACDDPTREGLQETPSRVVRAYEEWFAGYHDDPV--KVLERTFS 80

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +++L++ I   S+CEHH+ PI G+ H+AY+P+  V+G+SKL R++E +S+RLQI
Sbjct: 81  ETEGYDEIILLRGIRIESFCEHHMAPIIGRAHVAYLPRHRVVGISKLARVVEAFSKRLQI 140

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE+LT QIA+ I+S     GVAV++E  H CM+ RG+ + G++ VT+   G F  +    
Sbjct: 141 QEKLTAQIANTIDSVLQPHGVAVIVEAAHQCMTTRGVHKTGVSMVTSRMLGVFRTNPETR 200

Query: 195 DFFLKMTHN 203
              + M +N
Sbjct: 201 RELMAMINN 209


>gi|238650931|ref|YP_002916787.1| GTP cyclohydrolase I [Rickettsia peacockii str. Rustic]
 gi|259647325|sp|C4K2D8|GCH1_RICPU RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|238625029|gb|ACR47735.1| GTP cyclohydrolase I [Rickettsia peacockii str. Rustic]
          Length = 189

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 126/190 (66%), Gaps = 5/190 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRF 71
           + KPT EEAKEA+R +L++IG+DP REGL  TPDRVI SY E+F+GY K +    +T   
Sbjct: 1   MSKPTREEAKEAVRTLLKFIGEDPSREGLLKTPDRVINSYAEIFSGYGKDVAEILNTK-- 58

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   ++D +L+ +I F S+CEHHILP  G + +AY+P   ++G+SKL RI+ +++RR
Sbjct: 59  -FYETCNFRDFILL-NIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T+QIA +++ +    GVAV I   H CMSMRG+ +D     T  +TG F+  +
Sbjct: 117 LQIQEKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQ 176

Query: 192 GKTDFFLKMT 201
                FL  T
Sbjct: 177 KYRHEFLNFT 186


>gi|299134491|ref|ZP_07027684.1| GTP cyclohydrolase I [Afipia sp. 1NLS2]
 gi|298591238|gb|EFI51440.1| GTP cyclohydrolase I [Afipia sp. 1NLS2]
          Length = 200

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 126/192 (65%), Gaps = 2/192 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           ++  P+ EE + A R I+RW GD+P+R GL +TP R  ++++E FAGY Q P  Q  ++ 
Sbjct: 11  EIAAPSREEVESAFRTIIRWAGDNPNRPGLVETPSRAARAFREYFAGYGQDPI-QILNKT 69

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   Y++MV+++DI+F S+CEHH+ PI GK  +AY+P   V+GLSKL R++E Y++R
Sbjct: 70  -FDETGGYEEMVILRDIAFESHCEHHLAPIVGKAWVAYVPNGRVVGLSKLARVVEAYAKR 128

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQERLT +IA A++     +GV V+I+  H CMS RG+ + G   +T+   G F  + 
Sbjct: 129 LQIQERLTSEIASAVQEVLKPQGVGVVIKATHHCMSSRGVHKVGSEMITSCMLGCFRDNA 188

Query: 192 GKTDFFLKMTHN 203
                FL MT+N
Sbjct: 189 STRHEFLAMTNN 200


>gi|295687960|ref|YP_003591653.1| GTP cyclohydrolase I [Caulobacter segnis ATCC 21756]
 gi|295429863|gb|ADG09035.1| GTP cyclohydrolase I [Caulobacter segnis ATCC 21756]
          Length = 211

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 123/178 (69%), Gaps = 2/178 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           ++P+ EEA  A+R +L W GD+P+REGL DTP RV+ +++E FAGY+  P  ++ SR  F
Sbjct: 23  ERPSREEAMAAVRTLLAWAGDNPEREGLIDTPKRVVDAFEEWFAGYQGDPA-KELSRT-F 80

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            +   Y DMV+++ I   S+CEHH+ P  GK  +AY+P   V+GLSKL R++E++++RLQ
Sbjct: 81  EDVQGYDDMVMLRGIDVQSHCEHHMAPFLGKAWVAYMPTGKVVGLSKLARLVEIFAKRLQ 140

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
            QE +TMQIA AIE    + GVAVLI+ +H CMS RG+    ++T+TT F G F  DK
Sbjct: 141 TQETMTMQIADAIEDHLSAAGVAVLIDAEHQCMSTRGVHHHDVSTITTQFRGVFKTDK 198


>gi|17232779|ref|NP_489327.1| GTP cyclohydrolase I [Nostoc sp. PCC 7120]
 gi|25090417|sp|Q8YLL1|GCH11_ANASP RecName: Full=GTP cyclohydrolase 1 1; AltName: Full=GTP
           cyclohydrolase I 1; Short=GTP-CH-I 1
 gi|17134426|dbj|BAB76986.1| GTP cyclohydrolase I [Nostoc sp. PCC 7120]
          Length = 235

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 134/197 (68%), Gaps = 8/197 (4%)

Query: 12  KLKKPTVEEAKE---AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQD 67
           +L +P+ E+ +    A+R IL  +G+DP+REGL  TP RV ++ + L +GY Q +    +
Sbjct: 39  ELHQPSEEDMESMMGAVRSILVGVGEDPEREGLLKTPKRVAEAMRFLTSGYNQSLEELLN 98

Query: 68  TSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEV 127
            + F  G    + +MVL++DI+FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+
Sbjct: 99  GAVFDEG----HNEMVLVRDINFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEM 154

Query: 128 YSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           YSRRLQ+QERLT QIA A+++  + +GVAV++E  HMCM MRG+++ G  TVT+A  G F
Sbjct: 155 YSRRLQVQERLTRQIAEAVQTILEPQGVAVVMEASHMCMVMRGVQKPGSWTVTSAMLGVF 214

Query: 188 SRDKGKTDFFLKMTHNQ 204
             ++   + F  +  +Q
Sbjct: 215 QEEQKTREEFFNLIRHQ 231


>gi|225174480|ref|ZP_03728479.1| GTP cyclohydrolase I [Dethiobacter alkaliphilus AHT 1]
 gi|225170265|gb|EEG79060.1| GTP cyclohydrolase I [Dethiobacter alkaliphilus AHT 1]
          Length = 190

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/168 (53%), Positives = 121/168 (72%), Gaps = 4/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+R+IL  IG+DPDREGL+DTP RV K Y E+F+G    P     + F+     K
Sbjct: 5   EKIQKAVRMILEGIGEDPDREGLQDTPARVAKMYGEVFSGLHCDPCDHLETCFY---EEK 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPK-KHVIGLSKLVRILEVYSRRLQIQER 137
           + +MVLIKDIS +S CEHH+LP +GK H+AYIP  + + GLSKLVR++E  SRR Q+QER
Sbjct: 62  HDEMVLIKDISIYSMCEHHLLPFYGKAHVAYIPNPEKITGLSKLVRVVETLSRRPQLQER 121

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA  I    D+KGV V+IE +H+CM++RG+K+ G TTVT+A  G
Sbjct: 122 LTTQIADTIVEKLDAKGVVVVIEAEHLCMTIRGVKKPGSTTVTSAVRG 169


>gi|254419931|ref|ZP_05033655.1| GTP cyclohydrolase I subfamily, putative [Brevundimonas sp. BAL3]
 gi|196186108|gb|EDX81084.1| GTP cyclohydrolase I subfamily, putative [Brevundimonas sp. BAL3]
          Length = 209

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/187 (45%), Positives = 125/187 (66%), Gaps = 2/187 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P+ E+A EA+R ++ W GD+PDR GL DTP RV+ +Y E F GY +    ++ SR  F 
Sbjct: 23  RPSREQALEAVRTLIAWAGDNPDRPGLIDTPKRVVDAYGEWFDGY-EADAAKELSRT-FE 80

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           + + Y DMV++++I   S+CEHH+ P  GK ++AY+P + V+G+SKL R++E+++RRLQ 
Sbjct: 81  DVTGYDDMVILREIEVESHCEHHLAPFLGKAYVAYLPGEKVVGISKLARVVEIFARRLQN 140

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE LT  I  AIES    +GVAV+I+  H CM+ RG+    ++TVTT FTG F  D    
Sbjct: 141 QETLTNDIIEAIESHLQPRGVAVMIDAAHQCMTTRGVHHRHVSTVTTRFTGAFKSDPALM 200

Query: 195 DFFLKMT 201
           D FLK+ 
Sbjct: 201 DRFLKLA 207


>gi|218440286|ref|YP_002378615.1| GTP cyclohydrolase I [Cyanothece sp. PCC 7424]
 gi|218173014|gb|ACK71747.1| GTP cyclohydrolase I [Cyanothece sp. PCC 7424]
          Length = 247

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 92/189 (48%), Positives = 126/189 (66%), Gaps = 9/189 (4%)

Query: 17  TVEEAKE----AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRF 71
           T EE KE    A+ +IL  +G+DP REGL  TP RV ++ + L  GY Q +    + + F
Sbjct: 55  TTEENKEKMMQAVEMILESVGEDPGREGLLKTPKRVAEAMQFLTQGYNQSLEELVNDAIF 114

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
             G    + +MVL++DI FFS CEHH+LP  GK H+AYIP + V+GLSKL RI+E+Y+RR
Sbjct: 115 DEG----HNEMVLVRDIDFFSLCEHHMLPFMGKAHVAYIPNQKVVGLSKLARIVEMYARR 170

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT QIA AI+   + +GVAV++E  HMCM MRG+++ G  TVT+A  G F  D+
Sbjct: 171 LQVQERLTRQIAEAIQEILNPQGVAVVMEATHMCMVMRGVQKPGSWTVTSAMLGAFQDDQ 230

Query: 192 GKTDFFLKM 200
              + FL +
Sbjct: 231 KTREEFLNL 239


>gi|146318798|ref|YP_001198510.1| GTP cyclohydrolase I [Streptococcus suis 05ZYH33]
 gi|146321007|ref|YP_001200718.1| GTP cyclohydrolase I [Streptococcus suis 98HAH33]
 gi|223933636|ref|ZP_03625615.1| GTP cyclohydrolase I [Streptococcus suis 89/1591]
 gi|253751887|ref|YP_003025028.1| GTP cyclohydrolase I [Streptococcus suis SC84]
 gi|253753710|ref|YP_003026851.1| GTP cyclohydrolase I [Streptococcus suis P1/7]
 gi|253755410|ref|YP_003028550.1| GTP cyclohydrolase I [Streptococcus suis BM407]
 gi|330832952|ref|YP_004401777.1| GTP cyclohydrolase I [Streptococcus suis ST3]
 gi|166220293|sp|A4W1S9|GCH1_STRS2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|166220295|sp|A4VVH1|GCH1_STRSY RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|145689604|gb|ABP90110.1| GTP cyclohydrolase I [Streptococcus suis 05ZYH33]
 gi|145691813|gb|ABP92318.1| GTP cyclohydrolase I [Streptococcus suis 98HAH33]
 gi|223897710|gb|EEF64092.1| GTP cyclohydrolase I [Streptococcus suis 89/1591]
 gi|251816176|emb|CAZ51803.1| GTP cyclohydrolase I [Streptococcus suis SC84]
 gi|251817874|emb|CAZ55629.1| GTP cyclohydrolase I [Streptococcus suis BM407]
 gi|251819956|emb|CAR46077.1| GTP cyclohydrolase I [Streptococcus suis P1/7]
 gi|319758248|gb|ADV70190.1| GTP cyclohydrolase I [Streptococcus suis JS14]
 gi|329307175|gb|AEB81591.1| GTP cyclohydrolase I [Streptococcus suis ST3]
          Length = 187

 Score =  183 bits (464), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 126/187 (67%), Gaps = 5/187 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++ I  +L  +G+DP+REGL DTP RV K Y E+F G ++ P  Q T+ F  G    
Sbjct: 5   EQIEQTIYQLLELLGEDPNREGLLDTPKRVAKMYLEMFNGLEEDPKDQFTAVFSEG---- 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F S CEHH++P +G  H+AYIP K  V GLSKL R +EV SRR Q+QER
Sbjct: 61  HEEVVLVKDIPFHSMCEHHLVPFYGIAHVAYIPSKGRVTGLSKLARAVEVASRRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT Q+AHA++ + + +GV V++E +HMCMSMRGI++ G  TVTT   G++  D       
Sbjct: 121 LTHQVAHALQDALEPEGVFVMVEAEHMCMSMRGIRKPGSKTVTTVALGKYKEDAILRREL 180

Query: 198 LKMTHNQ 204
           L M HN+
Sbjct: 181 LSMIHNK 187


>gi|119512536|ref|ZP_01631614.1| GTP cyclohydrolase I [Nodularia spumigena CCY9414]
 gi|119462797|gb|EAW43756.1| GTP cyclohydrolase I [Nodularia spumigena CCY9414]
          Length = 236

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 126/195 (64%), Gaps = 10/195 (5%)

Query: 14  KKPTVEEAK--EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           K+P V EA+  +A+R +L  +G+DPDREGLKDTP RV+K+ + L  GY     T      
Sbjct: 43  KQPKVTEAEMMQAVRTLLIGLGEDPDREGLKDTPKRVMKALQFLTKGY-----TDSLDEL 97

Query: 72  HFGEA--SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
             G        +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y 
Sbjct: 98  LNGAVFTEDANEMVLVRDIDIFSSCEHHILPIIGRAHVAYIPNGKVIGLSKIARICEMYG 157

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQ+QERLT QIA A++     +GVAV++E  HMCM MRG+++ G  TV++A  G F+ 
Sbjct: 158 RRLQVQERLTTQIADALQGLLKPQGVAVVVEATHMCMVMRGVQKPGSWTVSSAMRGVFAE 217

Query: 190 DKGKTDFFLKMT-HN 203
           D    + F+ +  HN
Sbjct: 218 DSRTREEFMNLIRHN 232


>gi|16124714|ref|NP_419278.1| GTP cyclohydrolase I [Caulobacter crescentus CB15]
 gi|221233428|ref|YP_002515864.1| GTP cyclohydrolase I [Caulobacter crescentus NA1000]
 gi|25090436|sp|Q9AAY3|GCH1_CAUCR RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|13421632|gb|AAK22446.1| GTP cyclohydrolase I [Caulobacter crescentus CB15]
 gi|220962600|gb|ACL93956.1| GTP cyclohydrolase I [Caulobacter crescentus NA1000]
          Length = 212

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 126/186 (67%), Gaps = 2/186 (1%)

Query: 6   TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT 65
           TG+    +++P+ +EA  A+R +L W GD+P+REGL DTP RV++++ E FAGY   P  
Sbjct: 17  TGLDLEPVQRPSKDEAMAAVRTLLAWAGDNPEREGLIDTPKRVVEAFDEWFAGYHGDPA- 75

Query: 66  QDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRIL 125
           ++ SR  F +   Y DMV+++ I   S+CEHH+ P  GK  +AY+P   V+GLSKL R++
Sbjct: 76  KELSRT-FEDVQGYDDMVMLRGIDVQSHCEHHMAPFLGKAWIAYMPTGKVVGLSKLARLV 134

Query: 126 EVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           E++++RLQ QE +TMQIA AIE    + GVAVLI+ +H CMS RG+    ++T+TT F G
Sbjct: 135 EIFAKRLQTQETMTMQIADAIEDHLSAAGVAVLIDAEHQCMSTRGVHHHDVSTITTQFRG 194

Query: 186 EFSRDK 191
            F  DK
Sbjct: 195 VFKTDK 200


>gi|57237199|ref|YP_178211.1| GTP cyclohydrolase I [Campylobacter jejuni RM1221]
 gi|81557608|sp|Q5HWX4|GCH1_CAMJR RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|57166003|gb|AAW34782.1| GTP cyclohydrolase I [Campylobacter jejuni RM1221]
 gi|315057631|gb|ADT71960.1| GTP cyclohydrolase I type 1 [Campylobacter jejuni subsp. jejuni S3]
          Length = 190

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 127/177 (71%), Gaps = 4/177 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++ ++ IL  IG++P+REGL  TP+RV K+Y+ L +GY Q    +D       E+S   +
Sbjct: 6   EDCVKTILEIIGENPNREGLIKTPNRVFKAYEFLASGYTQ--NVKDILNDALFESSN-NE 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL++DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++EV++RRLQIQE+LT Q
Sbjct: 63  MVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTEQ 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           IA A+  + D+KGV V+IE +HMC+ MRGI++   TT T+A  G F ++ K + +FF
Sbjct: 123 IAQALMENVDAKGVGVVIEARHMCVEMRGIQKANSTTTTSALRGIFLKNEKTREEFF 179


>gi|311030280|ref|ZP_07708370.1| GTP cyclohydrolase I [Bacillus sp. m3-13]
          Length = 188

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/170 (51%), Positives = 121/170 (71%), Gaps = 5/170 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+R+IL  IG+DP+REGL DTP RV K Y E+FAG  + P  ++  +  FGEA  +++
Sbjct: 10  EEAVRMILEAIGEDPNREGLLDTPKRVAKMYTEVFAGLNEDP--KEHFKTVFGEA--HEE 65

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           +VL+KDISFFS CEHH++P +GK H+AYIPK   V GLSKL R +E  ++R Q+QER+T 
Sbjct: 66  LVLVKDISFFSMCEHHLVPFFGKAHVAYIPKGGKVTGLSKLARAVEAVAKRPQLQERITS 125

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            IA +I  S D  GV V++E +HMCM+MRG+K+ G  T+T+A  G    D
Sbjct: 126 TIAESIVESLDPHGVMVVVEAEHMCMTMRGVKKPGAMTITSAVRGVLEND 175


>gi|86607689|ref|YP_476451.1| GTP cyclohydrolase I [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123504082|sp|Q2JPT8|GCH1_SYNJB RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|86556231|gb|ABD01188.1| GTP cyclohydrolase I [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 229

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 123/178 (69%), Gaps = 5/178 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDM 82
           A+  +LR IG+DP REGL+ TP+RV+ + K L +GY+Q +    +++ F  G    + +M
Sbjct: 49  AVETLLRGIGEDPQREGLRKTPERVVAALKFLTSGYRQSLEELLNSAIFDEG----HDEM 104

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           VL++D+S FS CEHH+LP  GK H+AYIPK+ V+GLSK+ RI+E+YSRRLQ+QERLT QI
Sbjct: 105 VLLRDVSLFSLCEHHLLPFIGKAHVAYIPKQKVVGLSKIARIVEMYSRRLQVQERLTRQI 164

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           A A+    D  GV V+IE  HMCM MRG+++ G  TVT++  G F  D    + FL +
Sbjct: 165 AEALMEVLDPYGVGVVIEATHMCMVMRGVQKAGSWTVTSSMVGVFQEDPRTREEFLSL 222


>gi|254422269|ref|ZP_05035987.1| GTP cyclohydrolase I [Synechococcus sp. PCC 7335]
 gi|196189758|gb|EDX84722.1| GTP cyclohydrolase I [Synechococcus sp. PCC 7335]
          Length = 249

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 125/183 (68%), Gaps = 5/183 (2%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQD 81
           +A+R +L  +G+DP+REGL  TP RV ++ + L  GY Q + T  + + F  G    + +
Sbjct: 65  DAVRTMLLSVGEDPEREGLLKTPHRVAEAMRFLTQGYSQSLETIVNDAIFDEG----HNE 120

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL++DI+FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+Y+RRLQ+QERL  Q
Sbjct: 121 MVLVRDINFFSLCEHHMLPFMGRAHVAYIPNQRVVGLSKLARIVEMYARRLQVQERLNRQ 180

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA A++   D  GVAV++E  HMCM+MRG+++ G  TVT+A  G F  D    + FL + 
Sbjct: 181 IAEAVQEVLDPLGVAVVMEASHMCMAMRGVQKPGSWTVTSAMVGVFDEDAKTREEFLSLI 240

Query: 202 HNQ 204
            +Q
Sbjct: 241 RHQ 243


>gi|326389100|ref|ZP_08210682.1| GTP cyclohydrolase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206700|gb|EGD57535.1| GTP cyclohydrolase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 217

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 120/185 (64%), Gaps = 2/185 (1%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE 75
           P  EE + AIR +LRW GD+PDREGL+DTP RV +++KE  +GY + P      R  F E
Sbjct: 31  PVPEEVRSAIRTLLRWTGDNPDREGLRDTPSRVARAWKEYCSGYTENPGLH--LRRTFSE 88

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
            + Y ++VL+KDI F S+CEHH+ PI G   +AY+P+  V+G+SKL R+L  +SRRLQIQ
Sbjct: 89  VAGYDEVVLLKDIPFQSHCEHHLAPITGCASIAYLPRHRVVGISKLARVLHGFSRRLQIQ 148

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           ER+T +IA  I ++    GVAV+IE QH CM+ RG++  G+  +T+   G F  D     
Sbjct: 149 ERMTSEIAQCIWNALQPHGVAVVIEAQHGCMTGRGVRTPGVAMITSRMLGCFLDDASSRK 208

Query: 196 FFLKM 200
             L +
Sbjct: 209 EVLAL 213


>gi|76788132|ref|YP_329822.1| GTP cyclohydrolase I [Streptococcus agalactiae A909]
 gi|77405852|ref|ZP_00782935.1| GTP cyclohydrolase I [Streptococcus agalactiae H36B]
 gi|77413021|ref|ZP_00789223.1| GTP cyclohydrolase I [Streptococcus agalactiae 515]
 gi|123601749|sp|Q3K0Y1|GCH1_STRA1 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|76563189|gb|ABA45773.1| GTP cyclohydrolase I [Streptococcus agalactiae A909]
 gi|77160919|gb|EAO72028.1| GTP cyclohydrolase I [Streptococcus agalactiae 515]
 gi|77175562|gb|EAO78348.1| GTP cyclohydrolase I [Streptococcus agalactiae H36B]
 gi|319745098|gb|EFV97423.1| GTP cyclohydrolase I [Streptococcus agalactiae ATCC 13813]
          Length = 187

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 122/177 (68%), Gaps = 5/177 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE 75
           P  E+ ++AI   L  +G++PDREGLKDTP RV K Y E+F+G  Q P  Q T+ F    
Sbjct: 2   PNQEKMEKAIYQFLEALGENPDREGLKDTPKRVAKMYIEMFSGLNQDPKEQFTAVF---- 57

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQI 134
           +  ++++V++KDI F+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+
Sbjct: 58  SENHEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDGRVTGLSKLARAVEVASKRPQL 117

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           QERLT Q+A A+E +   KG+ V+IE +HMCM+MRGIK+ G  T+TT   G +  D+
Sbjct: 118 QERLTAQVAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLYKDDR 174


>gi|114797723|ref|YP_761878.1| GTP cyclohydrolase I [Hyphomonas neptunium ATCC 15444]
 gi|123128362|sp|Q0BXB5|GCH1_HYPNA RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|114737897|gb|ABI76022.1| GTP cyclohydrolase I [Hyphomonas neptunium ATCC 15444]
          Length = 206

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 120/188 (63%), Gaps = 2/188 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +++P+ +EA+EA+R ++ W GDDP REGL DTP RV+ +YKE F GY + P    +  F 
Sbjct: 16  VRRPSQQEAEEAVRTLIAWAGDDPAREGLIDTPKRVVNAYKEWFEGYGEDPVKYLSRTFE 75

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
             +   Y D+V++++I   S+CEHHI P  GK  +AY P   V+G+SKL R++E++++RL
Sbjct: 76  --DVQGYDDIVMLRNIEVESHCEHHIAPFIGKAFIAYKPSTAVVGISKLARVVEIFAKRL 133

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           Q QE +T QI  AI  S    G AV IE +H CMS RG+    +TT+TT FTG F  D  
Sbjct: 134 QTQETMTAQICDAITESLAPMGTAVFIEAEHQCMSTRGVHHKHVTTITTQFTGVFKSDAD 193

Query: 193 KTDFFLKM 200
             + FL M
Sbjct: 194 LRNRFLNM 201


>gi|197103883|ref|YP_002129260.1| GTP cyclohydrolase I [Phenylobacterium zucineum HLK1]
 gi|196477303|gb|ACG76831.1| GTP cyclohydrolase I [Phenylobacterium zucineum HLK1]
          Length = 209

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 124/192 (64%), Gaps = 2/192 (1%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +K+PT EEA EA+R ++ W GDDP REG+ DTP RV+ +Y E F GY   P  ++ SR  
Sbjct: 20  VKRPTREEAMEAVRTLIAWAGDDPRREGVIDTPKRVVDAYAEWFEGYSLDPA-KELSRT- 77

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F +   Y D+V+++DI   S+CEHH+ P  GK ++AY+P   V+G+SKL +++E+++RRL
Sbjct: 78  FEDVQGYDDIVMLRDIEVESHCEHHMAPFLGKAYVAYMPTNRVVGISKLAKVVEIFARRL 137

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           Q QE +T QIA AI  S    GVAVLI+  H CM+ RG+    ++T+TT FTG F  D  
Sbjct: 138 QTQETMTQQIADAITDSLRPAGVAVLIDAAHQCMTTRGVHHRHVSTITTQFTGVFKTDPT 197

Query: 193 KTDFFLKMTHNQ 204
               FL   + +
Sbjct: 198 LRQRFLDFVNRR 209


>gi|25011234|ref|NP_735629.1| GTP cyclohydrolase I [Streptococcus agalactiae NEM316]
 gi|76797903|ref|ZP_00780165.1| GTP cyclohydrolase I [Streptococcus agalactiae 18RS21]
 gi|41017194|sp|Q8E549|GCH1_STRA3 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|23095658|emb|CAD46842.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76586740|gb|EAO63236.1| GTP cyclohydrolase I [Streptococcus agalactiae 18RS21]
          Length = 187

 Score =  182 bits (462), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/177 (48%), Positives = 121/177 (68%), Gaps = 5/177 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE 75
           P  E+ ++AI   L  +G++PDREGLKDTP RV K Y E+F+G  Q P  Q T+ F    
Sbjct: 2   PNQEKMEKAIYQFLEALGENPDREGLKDTPKRVAKMYIEMFSGLNQDPKEQFTAVF---- 57

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQI 134
           +  ++++V++KDI F+S CEHH++P +GK H+AY+P    V GLSKL R  EV S+R Q+
Sbjct: 58  SENHEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDGRVTGLSKLARAFEVASKRPQL 117

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           QERLT Q+A A+E +   KG+ V+IE +HMCM+MRGIK+ G  T+TT   G +  D+
Sbjct: 118 QERLTAQVAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLYKDDR 174


>gi|319788606|ref|YP_004148081.1| GTP cyclohydrolase I [Pseudoxanthomonas suwonensis 11-1]
 gi|317467118|gb|ADV28850.1| GTP cyclohydrolase I [Pseudoxanthomonas suwonensis 11-1]
          Length = 197

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 125/189 (66%), Gaps = 2/189 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T E+A+EA+R +LRW G+DP REGL DTP RV ++Y + F+GY+  P  ++     F E 
Sbjct: 11  TREQAEEAVRTLLRWAGEDPSREGLLDTPRRVAEAYGDWFSGYRDDP--REYLARTFKEV 68

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y +M++++DI + S+CEHH+ PI G++H+ Y+P   V+G+SKL R+++ Y+RR Q+QE
Sbjct: 69  AGYDEMIVLRDIEYESHCEHHMAPIIGRVHVGYLPAGKVVGISKLARVVDAYARRFQVQE 128

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+ +    GV V++EG H CM+ RG+ + G++ VT+   G F  D      
Sbjct: 129 KMTAQIAQCIQETLHPLGVGVVVEGAHECMTTRGVHKRGVSMVTSCMLGSFREDARTRSE 188

Query: 197 FLKMTHNQR 205
           FL+    +R
Sbjct: 189 FLRFIEGRR 197


>gi|160940413|ref|ZP_02087758.1| hypothetical protein CLOBOL_05303 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436993|gb|EDP14760.1| hypothetical protein CLOBOL_05303 [Clostridium bolteae ATCC
           BAA-613]
          Length = 185

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 123/180 (68%), Gaps = 4/180 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R++L  +G+DP REGL DTP+RV + Y+EL++G  + P       F     ++  D
Sbjct: 8   EQAVRLLLEGMGEDPSREGLIDTPERVARMYEELYSGMDEHPGMYLEKTFR----AENND 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +++ KDI+F+S CEHH+LP +GK+H+AY+P K V GLSKL R +EV+SRRLQIQE+LT Q
Sbjct: 64  LIVEKDITFYSVCEHHLLPFYGKVHVAYVPDKKVAGLSKLARTVEVFSRRLQIQEQLTAQ 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA A+      +GV V++E +HMCM+MRGIK+ G  TVT    G F + +   + F +M 
Sbjct: 124 IADALMDGLAPRGVMVMMEAEHMCMTMRGIKKPGSRTVTVVKRGCFCQRENLVNLFFQMV 183


>gi|300726842|ref|ZP_07060272.1| GTP cyclohydrolase I [Prevotella bryantii B14]
 gi|299775955|gb|EFI72535.1| GTP cyclohydrolase I [Prevotella bryantii B14]
          Length = 198

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 121/180 (67%), Gaps = 2/180 (1%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           ++E     + +L+ +G++PDREGL  TP RV K+ + L  GY Q P    T      E  
Sbjct: 11  LDELANHYKEVLKLLGENPDREGLAKTPMRVAKAMQILTRGYTQDPHKVLTDALF--EEE 68

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
           KY  MV++KDI FFS CEHHILP +GK+H+AYIP K++ GLSK+ R+++++S RLQ+QER
Sbjct: 69  KYNQMVIVKDIDFFSMCEHHILPFYGKVHVAYIPNKYITGLSKVARVVDIFSHRLQVQER 128

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QI   I+++   +GV V+IE +HMCM MRG+++    T T+AF+G F + K + +F 
Sbjct: 129 LTQQIKDCIQNTLHPQGVMVVIEAKHMCMQMRGVEKQNSITTTSAFSGAFEQAKTREEFM 188


>gi|157825652|ref|YP_001493372.1| GTP cyclohydrolase I [Rickettsia akari str. Hartford]
 gi|166220281|sp|A8GN89|GCH1_RICAH RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|157799610|gb|ABV74864.1| GTP cyclohydrolase I [Rickettsia akari str. Hartford]
          Length = 190

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 126/190 (66%), Gaps = 4/190 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRF 71
           + KPT EEA EA+R +L++IG+DP REGL  TPDRVI SY E+F+GY K +    +T   
Sbjct: 1   MSKPTREEATEAVRTLLKFIGEDPTREGLLKTPDRVINSYTEIFSGYGKDVEEILNTK-- 58

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F +   +QD + ++ I F S+CEHH+LP  G +H+AYIP   ++G+SKL RI+ ++++R
Sbjct: 59  -FYDTCNFQDFISLEGIKFTSFCEHHMLPFNGTVHIAYIPDNCIVGISKLARIVNIFAKR 117

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T+QIA +++ +    GVAV I   H CMSMRG+ +D     T  +TG F+  +
Sbjct: 118 LQIQEKMTVQIAESVQENLKPLGVAVKIAALHSCMSMRGVMQDHSIMNTMHYTGIFAEQQ 177

Query: 192 GKTDFFLKMT 201
                FL +T
Sbjct: 178 KYRHEFLNLT 187


>gi|298491971|ref|YP_003722148.1| GTP cyclohydrolase I ['Nostoc azollae' 0708]
 gi|298233889|gb|ADI65025.1| GTP cyclohydrolase I ['Nostoc azollae' 0708]
          Length = 235

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 130/189 (68%), Gaps = 5/189 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGE 75
           ++E+  EA+R +L  +G+DP+REGL  TP RV ++   L  GY Q +    + + F  G 
Sbjct: 47  SMEQMMEAVRTMLIGVGEDPEREGLLKTPKRVAEAMMFLTGGYNQSLEELVNGAIFDEG- 105

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
              + +MVL++DI+FF+ CEHH+LP  G+ H+AYIP + V+GLSK+ RI+E+YSRRLQ+Q
Sbjct: 106 ---HNEMVLVRDINFFTLCEHHMLPFMGRAHVAYIPNQKVVGLSKMARIVEMYSRRLQVQ 162

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           ERLT QIA A+++  + KGVAV++E  HMCM MRG+++ G  TVT++  G F  ++   +
Sbjct: 163 ERLTRQIAEAVQTILEPKGVAVVMEATHMCMVMRGVQKPGSWTVTSSMVGVFQDEQKTRE 222

Query: 196 FFLKMTHNQ 204
            FL +  +Q
Sbjct: 223 EFLNLIRHQ 231


>gi|25090402|sp|Q8P3B0|GCH1_XANCP RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
          Length = 200

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 123/183 (67%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV ++Y + F+GY++ P       F   E 
Sbjct: 12  TQAQAEEAVRTLLRWAGEDPAREGLLDTPRRVAEAYGDWFSGYREEPRAYLERTFE--EV 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R++E Y+RR Q+QE
Sbjct: 70  AGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVESYARRFQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+     +GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAQCIQDVLQPRGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|332981737|ref|YP_004463178.1| GTP cyclohydrolase I [Mahella australiensis 50-1 BON]
 gi|332699415|gb|AEE96356.1| GTP cyclohydrolase I [Mahella australiensis 50-1 BON]
          Length = 186

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 123/178 (69%), Gaps = 6/178 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R+++  IG+DP+REGLKDTP RV + Y ELF+G ++ P       F+      +++
Sbjct: 8   EQAMRMMIEAIGEDPEREGLKDTPKRVARMYAELFSGIEENPRKYLEVWFN----EDHEE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           MVL+KDI F+S CEHH LP  GK H+AYIP K  V GLSKL R++E  +RR Q+QERLT 
Sbjct: 64  MVLVKDIPFYSMCEHHFLPFVGKAHVAYIPTKGKVTGLSKLARVVESVARRPQLQERLTS 123

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           QIA  +    D +GV V+IE +HMCMSMRG+K+ G TTVT+A  G F RD K + + F
Sbjct: 124 QIADILMECLDPQGVVVVIEAEHMCMSMRGVKKPGTTTVTSAVRGIFRRDAKSRAEAF 181


>gi|75908751|ref|YP_323047.1| GTP cyclohydrolase I [Anabaena variabilis ATCC 29413]
 gi|75702476|gb|ABA22152.1| GTP cyclohydrolase I [Anabaena variabilis ATCC 29413]
          Length = 235

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 128/182 (70%), Gaps = 6/182 (3%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQD 81
           +A+R IL  +G+DP+REGL  TP RV ++ + L +GY Q +    + + F  G    + +
Sbjct: 53  DAVRSILVGVGEDPEREGLLKTPKRVAEAMRFLTSGYNQSLEELLNGAVFDEG----HNE 108

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL++DI+FFS CEHH+LP  G+ H+AYIP + V+GLSKL RI+E+YSRRLQ+QERLT Q
Sbjct: 109 MVLVRDINFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQ 168

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFFLKM 200
           IA A+++  + +GVAV++E  HMCM MRG+++ G  TVT+A  G F  + K + +FF  +
Sbjct: 169 IAEAVQTILEPQGVAVVMEASHMCMVMRGVQKPGSWTVTSAMLGVFQEEQKTREEFFNLI 228

Query: 201 TH 202
            H
Sbjct: 229 RH 230


>gi|226323767|ref|ZP_03799285.1| hypothetical protein COPCOM_01542 [Coprococcus comes ATCC 27758]
 gi|225207951|gb|EEG90305.1| hypothetical protein COPCOM_01542 [Coprococcus comes ATCC 27758]
          Length = 184

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 121/179 (67%), Gaps = 4/179 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++AIR++L  IG+DPDREGL +TPDR+ + Y+E+  G  +         F     ++  +
Sbjct: 8   EQAIRLLLEGIGEDPDREGLAETPDRIARMYEEICGGMNEDAAEHLKKTF----TAENNE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+ KDI+F+S CEHH+LP +GK+H+AYIP   V+GLSKL R +EV++RRLQ+QE++T Q
Sbjct: 64  MVVEKDITFYSMCEHHMLPFYGKVHIAYIPDGKVVGLSKLARTVEVFARRLQLQEQMTAQ 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           IA A+  +   KGV VL E +HMCM+MRGIK+ G  TV+    G F  ++   + F +M
Sbjct: 124 IADALMENLHPKGVMVLAEAEHMCMTMRGIKKPGSKTVSVVTRGAFEENEKLQNMFFRM 182


>gi|229496776|ref|ZP_04390487.1| GTP cyclohydrolase I [Porphyromonas endodontalis ATCC 35406]
 gi|229316322|gb|EEN82244.1| GTP cyclohydrolase I [Porphyromonas endodontalis ATCC 35406]
          Length = 200

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 124/192 (64%), Gaps = 3/192 (1%)

Query: 5   RTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPT 64
           R   F+ +L    + E K   R IL  IG+DPDREGL  TP+RV KS + L  GY++ P 
Sbjct: 3   RQSTFDPQLSPEEMAEMKNLQRRILELIGEDPDREGLIKTPERVAKSLRFLTKGYREDPE 62

Query: 65  TQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRI 124
               S   F E  +Y+ MV++KDI FFS CEHH+LP +GK H+ YIP K++ GLSK+ R+
Sbjct: 63  EILRSAM-FRE--EYRQMVIVKDIDFFSMCEHHMLPFFGKAHVGYIPNKYITGLSKIPRV 119

Query: 125 LEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFT 184
           ++V++RRLQ+QERLT QI   I+++ +  G  V+IE QHMCM MRG+++    T T+ FT
Sbjct: 120 VDVFARRLQVQERLTTQIKDCIQATLNPLGTIVVIEAQHMCMQMRGVEKQNSLTTTSDFT 179

Query: 185 GEFSRDKGKTDF 196
           G F     + +F
Sbjct: 180 GAFEEASTREEF 191


>gi|254518399|ref|ZP_05130455.1| GTP cyclohydrolase I [Clostridium sp. 7_2_43FAA]
 gi|226912148|gb|EEH97349.1| GTP cyclohydrolase I [Clostridium sp. 7_2_43FAA]
          Length = 184

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 122/172 (70%), Gaps = 4/172 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+  E +++IL  IG+DP+REGL DTPDR+ + Y+E+F+G  +    + +  F      +
Sbjct: 5   EKILEGVKLILEGIGEDPNREGLLDTPDRIARMYEEIFSGIGKEAEDELSKTF----TVE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             D+VL KDI+F+S CEHH++P +GK H+AYIPK  V GLSKL R +EVY+++ Q+QERL
Sbjct: 61  GNDLVLEKDITFYSMCEHHLVPFYGKAHIAYIPKGRVAGLSKLARCVEVYAKKPQLQERL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           T ++A AI    +++GV V+IEG+HMCM+MRG+K+ G  TVTT + G F  D
Sbjct: 121 TTEVADAIMKYLNAEGVMVVIEGEHMCMTMRGVKKPGTKTVTTTYRGCFKED 172


>gi|86607394|ref|YP_476157.1| GTP cyclohydrolase I [Synechococcus sp. JA-3-3Ab]
 gi|123504784|sp|Q2JR69|GCH1_SYNJA RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|86555936|gb|ABD00894.1| GTP cyclohydrolase I [Synechococcus sp. JA-3-3Ab]
          Length = 229

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 123/178 (69%), Gaps = 5/178 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDM 82
           A+  +LR IG+DP REGLK TP+RV+ + K L +GY+Q +    + + F  G    + +M
Sbjct: 49  AVETLLRGIGEDPQREGLKKTPERVVAALKFLTSGYRQSLEDLINGAIFDEG----HDEM 104

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           VL++DI+ FS CEHH+LP  GK H+AYIP++ V+GLSK+ RI+E+YSRRLQ+QERLT QI
Sbjct: 105 VLLRDITLFSLCEHHLLPFIGKAHVAYIPRQKVVGLSKIARIVEMYSRRLQVQERLTRQI 164

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           A A+ +  D  GV V+IE  HMCM MRG+++ G  TVT++  G F  D    + FL +
Sbjct: 165 AEALMTMLDPYGVGVVIEATHMCMVMRGVQKPGSWTVTSSMVGVFQEDPRTREEFLSL 222


>gi|146339620|ref|YP_001204668.1| GTP cyclohydrolase I [Bradyrhizobium sp. ORS278]
 gi|146192426|emb|CAL76431.1| GTP cyclohydrolase I [Bradyrhizobium sp. ORS278]
          Length = 206

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 124/187 (66%), Gaps = 2/187 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T ++ ++AIR IL WIG+DP REGL +TP RV ++YK  FAGY Q P  +D  R  F E 
Sbjct: 18  TQDDVEDAIRTILTWIGEDPSREGLSETPARVARAYKSYFAGYDQNP--EDYLRKTFEET 75

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y +MVL+++I F S+CEHH+ PI G+  + Y+P+  V+G+SKL R++E Y+ RLQIQE
Sbjct: 76  AGYDEMVLLRNIPFQSHCEHHMAPIIGRAWVGYVPRNRVVGISKLARVVEAYAARLQIQE 135

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+T +IA+ I+     +GVAV+I+  H C+S RG+K+ G+   T+   G F  D      
Sbjct: 136 RMTAEIANIIDEVLQPEGVAVVIKAAHHCISSRGVKKHGVDLTTSRMLGCFRSDPMSRQE 195

Query: 197 FLKMTHN 203
           FL M ++
Sbjct: 196 FLAMVNS 202


>gi|260892495|ref|YP_003238592.1| GTP cyclohydrolase I [Ammonifex degensii KC4]
 gi|260864636|gb|ACX51742.1| GTP cyclohydrolase I [Ammonifex degensii KC4]
          Length = 190

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 121/174 (69%), Gaps = 4/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+R++L  IG+DP+REGL+DTP+RV + Y E+FAG ++ P       F       
Sbjct: 5   EKIKQAVRLLLEAIGEDPEREGLRDTPERVARMYAEIFAGLQEDPAVHLEKYF----TEN 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           +++MVL++DI  +S CEHH+LP +G  H+AYIP+  V GLSKL R+++ ++RR Q+QERL
Sbjct: 61  HEEMVLVRDIPVYSVCEHHLLPFFGVAHVAYIPRGVVTGLSKLARVVDGFARRPQLQERL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           T QIA  I    + +GV V+IE +HMCM+MRG+K+ G  TVT+A  G F ++  
Sbjct: 121 TTQIADTIMEKLNPRGVLVVIEAEHMCMTMRGVKKPGAKTVTSAVRGIFQQNAA 174


>gi|157414503|ref|YP_001481759.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 81116]
 gi|172047016|sp|A8FJZ5|GCH1_CAMJ8 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|157385467|gb|ABV51782.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 81116]
 gi|307747145|gb|ADN90415.1| GTP cyclohydrolase 1 [Campylobacter jejuni subsp. jejuni M1]
 gi|315932001|gb|EFV10954.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 327]
          Length = 190

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 127/178 (71%), Gaps = 6/178 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQ 80
           ++ ++ IL  IG++P+REGL  TP+RV K+Y+ L +GY Q +    + + F     S   
Sbjct: 6   EDCVKTILEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILNDALFE----SSNN 61

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTM 140
           +MVL++DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++EV++RRLQIQE+LT 
Sbjct: 62  EMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTE 121

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           QIA A+  + D+KGV V+IE +HMC+ MRG+++   TT T+A  G F ++ K + +FF
Sbjct: 122 QIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFF 179


>gi|18310001|ref|NP_561935.1| GTP cyclohydrolase I [Clostridium perfringens str. 13]
 gi|23821605|sp|Q8XLM2|GCH1_CLOPE RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|18144680|dbj|BAB80725.1| GTP cyclohydrolase [Clostridium perfringens str. 13]
          Length = 185

 Score =  181 bits (460), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 125/180 (69%), Gaps = 5/180 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ KE +++IL  IG+D +REGL +TPDR+ + Y+E+F+G         +  F       
Sbjct: 5   EKIKEGMKLILEAIGEDVNREGLIETPDRIARMYEEIFSGIGMNAKEHLSKTFEV----H 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             D+VL KDI+F+S CEHH++P +GK+H+AYIP   V+GLSKL R +EVYS++ Q+QERL
Sbjct: 61  SNDLVLEKDITFYSMCEHHLVPFYGKVHIAYIPNGRVVGLSKLARCVEVYSKKPQLQERL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFF 197
           T +IA +I    D++GV V++EG+HMCM+MRG+++ G  TVTT + G+F  D+  K D F
Sbjct: 121 TKEIADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVF 180


>gi|154493817|ref|ZP_02033137.1| hypothetical protein PARMER_03160 [Parabacteroides merdae ATCC
           43184]
 gi|154086430|gb|EDN85475.1| hypothetical protein PARMER_03160 [Parabacteroides merdae ATCC
           43184]
          Length = 197

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 123/186 (66%), Gaps = 2/186 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           EE     + I+  +G+D DREGL  TP+RV K+ + L  GY + P      R    +   
Sbjct: 14  EELAGHYKSIINLLGEDVDREGLLKTPERVAKAMQFLTKGYHEDPAA--VLRGAMFKEED 71

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y+ MV++KDI FFS CEHH+LP +GK H+AYIPKK++ GLSK+ R++++++RRLQIQERL
Sbjct: 72  YKQMVIVKDIDFFSLCEHHMLPFFGKAHVAYIPKKYITGLSKIPRVVDIFARRLQIQERL 131

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           TMQI   I+ + D  GV V+IE QHMCM MRG+++    T T+ FTG F + K + +F  
Sbjct: 132 TMQIKDCIQETLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFFQQAKTREEFMN 191

Query: 199 KMTHNQ 204
            + HN+
Sbjct: 192 LIKHNR 197


>gi|166710092|ref|ZP_02241299.1| GTP cyclohydrolase I [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 200

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 126/183 (68%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A++A+R++LRW G+DP REGL DTP RV ++Y + F+GY++ P  ++     F E 
Sbjct: 12  TQTQAEDAVRILLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYREEP--REYLERTFEEV 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R++E Y+RR Q+QE
Sbjct: 70  AGYDELIVLRDISYASHCEHHMAPIIGKVHVGYLPRCKVVGISKLARVVESYARRFQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+     +GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAQCIQDVLQPRGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|325918100|ref|ZP_08180257.1| GTP cyclohydrolase I [Xanthomonas vesicatoria ATCC 35937]
 gi|325535686|gb|EGD07525.1| GTP cyclohydrolase I [Xanthomonas vesicatoria ATCC 35937]
          Length = 200

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 125/183 (68%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A++A+R +LRW G+DP REGL DTP RV ++Y + F+GY++ P  ++     F E 
Sbjct: 12  TQAQAEDAVRTLLRWAGEDPSREGLLDTPRRVAEAYGDWFSGYREEP--REYLERTFEEV 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R++E Y+RR Q+QE
Sbjct: 70  AGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVESYARRFQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+     +GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAQCIQDVLQPRGVGVVVEGSHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|24379410|ref|NP_721365.1| GTP cyclohydrolase I [Streptococcus mutans UA159]
 gi|41017191|sp|Q8DUG2|GCH1_STRMU RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|24377341|gb|AAN58671.1|AE014936_11 putative GTP cyclohydrolase I [Streptococcus mutans UA159]
          Length = 192

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 90/184 (48%), Positives = 123/184 (66%), Gaps = 5/184 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+  +L  +G+DP+REGL DTP RV K Y+E+FAG  + P  Q T+ F    + +++D
Sbjct: 13  EEAVYQLLEALGEDPNREGLLDTPKRVAKMYQEMFAGLNEDPKDQFTAVF----SEEHED 68

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQERLTM 140
           +VL+KDI F+S CEHH++P  G  H+AYIP    V GLSKL R +EV S+R Q+QERLT+
Sbjct: 69  VVLVKDIPFYSMCEHHLVPFHGLAHVAYIPSDGCVTGLSKLARAVEVVSKRPQLQERLTV 128

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           QIA+A+E +   KGV V+IE +HMCM+MRGIK+ G  TVT    G    DK      + M
Sbjct: 129 QIANALEEALKPKGVLVMIEAEHMCMTMRGIKKPGSKTVTRVVRGICQSDKETRQEIIAM 188

Query: 201 THNQ 204
            H+ 
Sbjct: 189 IHHN 192


>gi|269218253|ref|ZP_06162107.1| GTP cyclohydrolase I [Actinomyces sp. oral taxon 848 str. F0332]
 gi|269212381|gb|EEZ78721.1| GTP cyclohydrolase I [Actinomyces sp. oral taxon 848 str. F0332]
          Length = 222

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 81/166 (48%), Positives = 119/166 (71%), Gaps = 6/166 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EAIR +LR +G++P+R+GL DTP R+ +S+KE+FAG +Q P     ++F  G    +Q+
Sbjct: 44  EEAIRALLRAVGENPERDGLVDTPGRMARSFKEIFAGLRQDPADVLEAKFDIG----HQE 99

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERLT 139
           M+++KDI F+S CEHH+LP  G  H+AYIP     V GLSK+ R+++ Y+RR Q+QER+ 
Sbjct: 100 MIIVKDIPFYSTCEHHLLPFHGHAHVAYIPNADGKVTGLSKIARLVDGYARRPQVQERIA 159

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
            Q+A A+ES   ++GV V+IE +HMCMSMRG+ + G  TVT+A  G
Sbjct: 160 TQVAEALESRLGARGVLVVIEAEHMCMSMRGVNKPGSRTVTSAVRG 205


>gi|325923512|ref|ZP_08185162.1| GTP cyclohydrolase I [Xanthomonas gardneri ATCC 19865]
 gi|325546009|gb|EGD17213.1| GTP cyclohydrolase I [Xanthomonas gardneri ATCC 19865]
          Length = 200

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 122/183 (66%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV ++Y + F+GY++ P       F   E 
Sbjct: 12  TQAQAEEAVRTLLRWAGEDPAREGLLDTPRRVAEAYGDWFSGYREEPRAYLERTFE--EV 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P   V+G+SKL R++E Y+RR Q+QE
Sbjct: 70  AGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPSGKVVGISKLARVVESYARRFQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+     +GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAQCIQDVLQPRGVGVVVEGSHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|153814140|ref|ZP_01966808.1| hypothetical protein RUMTOR_00349 [Ruminococcus torques ATCC 27756]
 gi|145848536|gb|EDK25454.1| hypothetical protein RUMTOR_00349 [Ruminococcus torques ATCC 27756]
          Length = 186

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 123/182 (67%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+R++L  IG+D DREGL +TPDR+ +  +E++ GY++         FH     +
Sbjct: 5   EKVKKAVRLLLEGIGEDADREGLIETPDRIARMCEEIYGGYEEDAKEHLCKTFHV----E 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             DMV+ KDI+F+S CEHH+LP +GK H+AYIP   V GLSKL R +E ++RRLQ+QE+L
Sbjct: 61  NSDMVVEKDITFYSMCEHHLLPFYGKAHIAYIPDGKVAGLSKLARTVEGFARRLQLQEQL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA A+ +   +KG AV+IE +HMCM+MRGIK+ G  TVT A  G F  D    + F 
Sbjct: 121 TGQIADALMNELKAKGAAVVIEAEHMCMTMRGIKKPGSRTVTFAKRGLFETDPALEERFF 180

Query: 199 KM 200
           +M
Sbjct: 181 RM 182


>gi|22537274|ref|NP_688125.1| GTP cyclohydrolase I [Streptococcus agalactiae 2603V/R]
 gi|77410557|ref|ZP_00786918.1| GTP cyclohydrolase I [Streptococcus agalactiae CJB111]
 gi|41017192|sp|Q8DZI5|GCH1_STRA5 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|22534143|gb|AAM99997.1|AE014243_4 GTP cyclohydrolase I [Streptococcus agalactiae 2603V/R]
 gi|77163505|gb|EAO74455.1| GTP cyclohydrolase I [Streptococcus agalactiae CJB111]
          Length = 187

 Score =  181 bits (459), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 122/177 (68%), Gaps = 5/177 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE 75
           P  E+ ++AI   L  +G++P+REGLKDTP RV K Y E+F+G  Q P  Q T+ F    
Sbjct: 2   PNQEKMEKAIYQFLEALGENPNREGLKDTPKRVAKMYIEMFSGLNQDPKEQFTAVF---- 57

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQI 134
           +  ++++V++KDI F+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+
Sbjct: 58  SENHEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDGRVTGLSKLARAVEVASKRPQL 117

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           QERLT Q+A A+E +   KG+ V+IE +HMCM+MRGIK+ G  T+TT   G +  D+
Sbjct: 118 QERLTAQVAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLYKDDR 174


>gi|218265081|ref|ZP_03478677.1| hypothetical protein PRABACTJOHN_04387 [Parabacteroides johnsonii
           DSM 18315]
 gi|218221606|gb|EEC94256.1| hypothetical protein PRABACTJOHN_04387 [Parabacteroides johnsonii
           DSM 18315]
          Length = 197

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 124/186 (66%), Gaps = 2/186 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           EE     + I+  +G++ DREGL  TP+RV K+ + L  GY++ P      R    +   
Sbjct: 14  EELAGHYKSIINLLGEEVDREGLLKTPERVAKAMQFLTKGYREDPAA--VLRGAMFKEED 71

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y+ MV++KDI FFS CEHH+LP +GK H+AYIPKK++ GLSK+ R++++++RRLQIQERL
Sbjct: 72  YKQMVIVKDIDFFSLCEHHMLPFFGKAHVAYIPKKYITGLSKIPRVVDIFARRLQIQERL 131

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           TMQI   I+ + D  GV V+IE QHMCM MRG+++    T T+ FTG F + K + +F  
Sbjct: 132 TMQIKDCIQETLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFFQQAKTREEFMN 191

Query: 199 KMTHNQ 204
            + HN+
Sbjct: 192 LIKHNR 197


>gi|156740323|ref|YP_001430452.1| GTP cyclohydrolase I [Roseiflexus castenholzii DSM 13941]
 gi|156231651|gb|ABU56434.1| GTP cyclohydrolase I [Roseiflexus castenholzii DSM 13941]
          Length = 225

 Score =  181 bits (459), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 127/186 (68%), Gaps = 9/186 (4%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQ-DTSRFHFGEASKYQ 80
           ++A+RVIL+ IG++P+REGL+ TP RV K Y EL AGY   P    + + F  G    Y 
Sbjct: 46  EDAVRVILKQIGENPEREGLQKTPSRVAKMYAELTAGYHIDPDALINEAVFSVG----YD 101

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTM 140
           +MVL+K+I F S CEHH+LP  G++H+AYIP   V+GLSK+ RI+E+++RRLQ+QER+T+
Sbjct: 102 EMVLVKNIEFSSLCEHHMLPFMGRVHVAYIPNGRVVGLSKIPRIVEMFARRLQVQERMTV 161

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFFLK 199
           QIA  I    +  GVAV+ EG HMC  MRG+K+ G T VT+A  G F  D K +++F   
Sbjct: 162 QIADFINQRLEPLGVAVVAEGVHMCAVMRGVKKAGATMVTSAMRGVFRDDPKTRSEF--- 218

Query: 200 MTHNQR 205
           M H +R
Sbjct: 219 MAHIER 224


>gi|290580579|ref|YP_003484971.1| putative GTP cyclohydrolase I [Streptococcus mutans NN2025]
 gi|254997478|dbj|BAH88079.1| putative GTP cyclohydrolase I [Streptococcus mutans NN2025]
          Length = 187

 Score =  181 bits (458), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 90/184 (48%), Positives = 123/184 (66%), Gaps = 5/184 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+  +L  +G+DP+REGL DTP RV K Y+E+FAG  + P  Q T+ F    + +++D
Sbjct: 8   EEAVYQLLEALGEDPNREGLLDTPKRVAKMYQEMFAGLNEDPKDQFTAVF----SEEHED 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQERLTM 140
           +VL+KDI F+S CEHH++P  G  H+AYIP    V GLSKL R +EV S+R Q+QERLT+
Sbjct: 64  VVLVKDIPFYSMCEHHLVPFHGLAHVAYIPSDGCVTGLSKLARAVEVASKRPQLQERLTV 123

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           QIA+A+E +   KGV V+IE +HMCM+MRGIK+ G  TVT    G    DK      + M
Sbjct: 124 QIANALEEALKPKGVLVMIEAEHMCMTMRGIKKPGSKTVTRVVRGICQSDKETRQEIIAM 183

Query: 201 THNQ 204
            H+ 
Sbjct: 184 IHHN 187


>gi|285019891|ref|YP_003377602.1| GTP cyclohydrolaseIprotein [Xanthomonas albilineans GPE PC73]
 gi|283475109|emb|CBA17608.1| probable gtp cyclohydrolaseIprotein [Xanthomonas albilineans]
          Length = 200

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 126/183 (68%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW GDDP REGL DTP RV+++Y + F+GY++ P  ++     F E 
Sbjct: 13  TQAQAEEAVRTLLRWSGDDPTREGLLDTPRRVVEAYGDWFSGYREDP--REYMLRTFEEV 70

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DI + S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R+++ Y+RR Q+QE
Sbjct: 71  AGYDELIVLRDIDYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVDAYARRFQVQE 130

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+ + +  GV V++EG H CM+ RG+ + G++ VT+   G F  D      
Sbjct: 131 KMTAQIAECIQDALEPLGVGVVVEGSHECMTTRGVHKRGVSMVTSKMLGTFREDARTRAE 190

Query: 197 FLK 199
           FL+
Sbjct: 191 FLR 193


>gi|220905844|ref|YP_002481155.1| GTP cyclohydrolase I [Cyanothece sp. PCC 7425]
 gi|219862455|gb|ACL42794.1| GTP cyclohydrolase I [Cyanothece sp. PCC 7425]
          Length = 235

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 93/198 (46%), Positives = 131/198 (66%), Gaps = 9/198 (4%)

Query: 12  KLKKPTVEEAKE----AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQ 66
           +++ P  E AKE    A+R IL  +G++P+REGL  TP RV ++   L  GY Q +    
Sbjct: 39  EIQLPPEERAKEEMMDAVRSILLGVGENPEREGLLKTPKRVAEAMMFLTGGYSQSLEELV 98

Query: 67  DTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILE 126
           + + F  G    + +MVL++DI  FS CEHH+LP  GK H+AYIP + VIGLSKL RI+E
Sbjct: 99  NGAIFDEG----HDEMVLVRDIHAFSLCEHHMLPFIGKAHVAYIPNQKVIGLSKLARIVE 154

Query: 127 VYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGE 186
           +YSRRLQ+QERLT QIA A+++  + KGVAV++E  HMCM MRG+++ G  TVT++  G 
Sbjct: 155 MYSRRLQVQERLTRQIAEAVQTVLEPKGVAVVMEASHMCMVMRGVQKPGSWTVTSSMLGV 214

Query: 187 FSRDKGKTDFFLKMTHNQ 204
           F  D+   + FL +  +Q
Sbjct: 215 FKEDQKTREEFLNLIRHQ 232


>gi|315928126|gb|EFV07444.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni DFVF1099]
          Length = 194

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 84/187 (44%), Positives = 132/187 (70%), Gaps = 6/187 (3%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRF 71
           ++K   ++ ++ ++ +L  IG++P+REGL  TP+RV K+Y+ L +GY Q +    + + F
Sbjct: 1   MEKNVQKKFEDCVKTMLEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILNDALF 60

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
                S   +MVL++DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++EV++RR
Sbjct: 61  E----SSNNEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD- 190
           LQIQE+LT QIA A+  + D+KGV V+IE +HMC+ MRG+++   TT T+A  G F ++ 
Sbjct: 117 LQIQEQLTEQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNE 176

Query: 191 KGKTDFF 197
           K + +FF
Sbjct: 177 KTREEFF 183


>gi|260587767|ref|ZP_05853680.1| GTP cyclohydrolase I [Blautia hansenii DSM 20583]
 gi|331083770|ref|ZP_08332879.1| GTP cyclohydrolase 1 [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260542032|gb|EEX22601.1| GTP cyclohydrolase I [Blautia hansenii DSM 20583]
 gi|330403195|gb|EGG82755.1| GTP cyclohydrolase 1 [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 185

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 118/183 (64%), Gaps = 4/183 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E +R+IL  IG+D +REGL +TPDR+ + Y+EL AGY    +     RFH        D
Sbjct: 7   EEGVRLILEGIGEDINREGLLETPDRIARMYEELAAGYTDNASEHLKKRFHVDN----ND 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+ KDI F+S+CEHH+LP +GK  +AYIP   V+GLSK+ R LEV+++R Q+QERLT Q
Sbjct: 63  MVMEKDIPFYSFCEHHMLPFYGKAAVAYIPNGEVVGLSKIARTLEVFAKRFQLQERLTAQ 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA          GV VLIE +HMCM+MRGIK+ G  TVT    G F+ D+   + F +M 
Sbjct: 123 IADVFMEELKPYGVMVLIEAEHMCMTMRGIKKPGAKTVTVVTRGVFNEDEKLQNQFYRML 182

Query: 202 HNQ 204
            ++
Sbjct: 183 ESR 185


>gi|148926359|ref|ZP_01810043.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni CG8486]
 gi|145844751|gb|EDK21856.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni CG8486]
          Length = 194

 Score =  181 bits (458), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 127/178 (71%), Gaps = 6/178 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQ 80
           ++ ++ +L  IG++P+REGL  TP+RV K+Y+ L +GY Q +    + + F     S   
Sbjct: 10  EDCVKTMLEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILNDALFE----SSNN 65

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTM 140
           +MVL++DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++EV++RRLQIQE+LT 
Sbjct: 66  EMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTE 125

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           QIA A+  + D+KGV V+IE +HMC+ MRG+++   TT T+A  G F ++ K + +FF
Sbjct: 126 QIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFF 183


>gi|209883411|ref|YP_002287268.1| GTP cyclohydrolase I [Oligotropha carboxidovorans OM5]
 gi|209871607|gb|ACI91403.1| GTP cyclohydrolase I [Oligotropha carboxidovorans OM5]
          Length = 210

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 88/189 (46%), Positives = 121/189 (64%), Gaps = 6/189 (3%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT--QDTSRFH 72
           +P   E + A+R I+RW GDDP R+GL +TP RV ++++E F GY Q PTT  Q T    
Sbjct: 22  RPDRAEVEAAVRTIIRWAGDDPKRDGLIETPSRVARAFEEFFIGYSQNPTTILQKT---- 77

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
           F E   Y +M+ ++ + F S+CEHH+ PI GK  +AYIP   V+G+SKL R++EVY++RL
Sbjct: 78  FEEIDGYDEMITLRAVRFESHCEHHMAPIVGKAWVAYIPNGRVVGISKLARVVEVYAKRL 137

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           QIQE++T QIA+ I      +GVAVLI+ QH CM+ RGI + G   VT+   G F  +  
Sbjct: 138 QIQEKMTAQIANTINEVLKPQGVAVLIKAQHHCMTTRGIHKPGTDLVTSRMLGCFRDNAT 197

Query: 193 KTDFFLKMT 201
               FL MT
Sbjct: 198 TRQEFLSMT 206


>gi|197103269|ref|YP_002128647.1| GTP cyclohydrolase I [Phenylobacterium zucineum HLK1]
 gi|196480545|gb|ACG80072.1| GTP cyclohydrolase I [Phenylobacterium zucineum HLK1]
          Length = 260

 Score =  180 bits (457), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 120/189 (63%), Gaps = 2/189 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT  EA++A+RV+LRW GDDPDREGL +TP RV +SY+E+  GY   P +     F   
Sbjct: 72  RPTQAEAEQAVRVLLRWAGDDPDREGLIETPARVARSYREILGGYDTDPRSYLERVFE-- 129

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y ++V+++DI   S+CEHH+LP  GK H+ Y+P   V+G+SKL R++  ++RRLQI
Sbjct: 130 EIGGYDELVVLRDIPIASFCEHHMLPFTGKAHIGYLPSHRVVGISKLARVVHGFARRLQI 189

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE+LT QIA  I+     KGV V+I  +H CM+MRG+   G   +T+   G    D    
Sbjct: 190 QEKLTAQIAETIQEVLQPKGVGVVIISEHSCMTMRGVNTPGSRLITSHLLGAVRDDPRTR 249

Query: 195 DFFLKMTHN 203
           + FL + H+
Sbjct: 250 EEFLALIHS 258


>gi|153953587|ref|YP_001394352.1| GTP cyclohydrolase I [Clostridium kluyveri DSM 555]
 gi|219854209|ref|YP_002471331.1| hypothetical protein CKR_0866 [Clostridium kluyveri NBRC 12016]
 gi|229487994|sp|A5N6S3|GCH1_CLOK5 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|254791039|sp|B9E092|GCH1_CLOK1 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|146346468|gb|EDK33004.1| FolE [Clostridium kluyveri DSM 555]
 gi|219567933|dbj|BAH05917.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 185

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 87/175 (49%), Positives = 119/175 (68%), Gaps = 7/175 (4%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           K+A+R+I+  IG++P+REGL +TPDR+ + Y E+F+G K+ P       F         D
Sbjct: 7   KDAVRMIIEAIGENPEREGLAETPDRIARMYTEIFSGLKEKPEEHLKKVFTVNN----DD 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL KDI F+S CEHH +P +GK H+AYIP   V+GLSKL R +EV+++RLQ+QER+T+Q
Sbjct: 63  IVLEKDIQFYSMCEHHFMPFYGKTHVAYIPNGKVVGLSKLARTVEVFAKRLQLQERMTVQ 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           IA +I      KGV V+IE +HMCM+MRGIK+ G  TVT A  G F   K K +F
Sbjct: 123 IADSIMDYLKVKGVMVVIEAEHMCMTMRGIKKPGSKTVTVATRGIF---KNKIEF 174


>gi|21245014|ref|NP_644596.1| GTP cyclohydrolase I [Xanthomonas axonopodis pv. citri str. 306]
 gi|21110741|gb|AAM39132.1| GTP cyclohydrolase I [Xanthomonas axonopodis pv. citri str. 306]
          Length = 204

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 126/196 (64%), Gaps = 2/196 (1%)

Query: 4   LRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP 63
           LR    N      T  +A+EA+R +LRW G+DP REGL DTP RV ++Y + F+GY+  P
Sbjct: 3   LRMSQSNQPDSPVTQTQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRDEP 62

Query: 64  TTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVR 123
             ++     F E + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R
Sbjct: 63  --REYLERTFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLAR 120

Query: 124 ILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAF 183
           ++E Y+RR Q+QE++T QIA  I+      GV V++EG H CM+ RGI + G++ VT+  
Sbjct: 121 VVESYARRFQVQEKMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKM 180

Query: 184 TGEFSRDKGKTDFFLK 199
            G F  D      FL+
Sbjct: 181 LGSFREDARTRAEFLQ 196


>gi|295109696|emb|CBL23649.1| GTP cyclohydrolase I [Ruminococcus obeum A2-162]
          Length = 185

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 124/185 (67%), Gaps = 4/185 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           ++ ++AIR++L  IG+D +REGLKDTPDR+ +   E++ G  +        +F      +
Sbjct: 5   QKVEQAIRLLLEGIGEDTEREGLKDTPDRIARMCMEIYGGLDEEADQHLAKQFKV----E 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MVL KDI+F+S CEHH++P +GK H+AYIP   V GLSKL R ++VY+RR QIQERL
Sbjct: 61  NNEMVLEKDITFYSMCEHHLMPFYGKAHIAYIPNGRVTGLSKLARTVDVYARRPQIQERL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T+QIA A+E + + +GV V++E +H CM+MRGIK+ G  T+TT   G+F  D+     FL
Sbjct: 121 TVQIADALERALNPRGVMVMLEAEHTCMTMRGIKKPGSKTITTVTRGDFKTDRELQKQFL 180

Query: 199 KMTHN 203
            M  +
Sbjct: 181 SMVKD 185


>gi|86149737|ref|ZP_01067967.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86153777|ref|ZP_01071980.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88597293|ref|ZP_01100528.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 84-25]
 gi|218561873|ref|YP_002343652.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|283955635|ref|ZP_06373128.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 1336]
 gi|9297103|sp|P51594|GCH1_CAMJE RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|85840005|gb|EAQ57264.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85842738|gb|EAQ59950.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88190354|gb|EAQ94328.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359579|emb|CAL34363.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|283792860|gb|EFC31636.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 1336]
 gi|284925486|gb|ADC27838.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315930202|gb|EFV09317.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 305]
          Length = 190

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 127/178 (71%), Gaps = 6/178 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQ 80
           ++ ++ +L  IG++P+REGL  TP+RV K+Y+ L +GY Q +    + + F     S   
Sbjct: 6   EDCVKTMLEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILNDALFE----SSNN 61

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTM 140
           +MVL++DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++EV++RRLQIQE+LT 
Sbjct: 62  EMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTE 121

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           QIA A+  + D+KGV V+IE +HMC+ MRG+++   TT T+A  G F ++ K + +FF
Sbjct: 122 QIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFF 179


>gi|168210711|ref|ZP_02636336.1| GTP cyclohydrolase I [Clostridium perfringens B str. ATCC 3626]
 gi|170711171|gb|EDT23353.1| GTP cyclohydrolase I [Clostridium perfringens B str. ATCC 3626]
          Length = 185

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 123/177 (69%), Gaps = 5/177 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           KE +++IL  IG+D +REGL +TPDR+ + Y+E+F+G         +  F         D
Sbjct: 8   KEGMKLILEAIGEDVNREGLIETPDRIARMYEEIFSGIGMNAKEHLSKTFEV----HSND 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL KDI+F+S CEHH++P +GK+H+AYIP   V+GLSKL R +EVYS++ Q+QERLT +
Sbjct: 64  LVLEKDITFYSMCEHHLVPFYGKVHIAYIPNGRVVGLSKLARCVEVYSKKPQLQERLTTE 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFF 197
           IA +I    D++GV V++EG+HMCM+MRG+++ G  TVTT + G+F  D+  K D F
Sbjct: 124 IADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVF 180


>gi|86151275|ref|ZP_01069490.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 260.94]
 gi|121612522|ref|YP_999913.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167004873|ref|ZP_02270631.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315123793|ref|YP_004065797.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|166218214|sp|A1VXS2|GCH1_CAMJJ RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|85841622|gb|EAQ58869.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 260.94]
 gi|87250462|gb|EAQ73420.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315017515|gb|ADT65608.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 190

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 127/178 (71%), Gaps = 6/178 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQ 80
           ++ ++ +L  IG++P+REGL  TP+RV K+Y+ L +GY Q +    + + F     S   
Sbjct: 6   EDCVKTMLEIIGENPNREGLIKTPNRVFKTYEFLTSGYTQNVKEILNDALFE----SSNN 61

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTM 140
           +MVL++DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++EV++RRLQIQE+LT 
Sbjct: 62  EMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTE 121

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           QIA A+  + D+KGV V+IE +HMC+ MRG+++   TT T+A  G F ++ K + +FF
Sbjct: 122 QIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFF 179


>gi|166032338|ref|ZP_02235167.1| hypothetical protein DORFOR_02041 [Dorea formicigenerans ATCC
           27755]
 gi|166028061|gb|EDR46818.1| hypothetical protein DORFOR_02041 [Dorea formicigenerans ATCC
           27755]
          Length = 185

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/182 (46%), Positives = 124/182 (68%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+R++L  IG+D +REGL DTPDR+ + Y+E++ G ++   T  +  F    +  
Sbjct: 5   EKVEQAVRLLLEGIGEDVNREGLIDTPDRIARMYEEIYGGMEEDAATHLSKTFTVDSS-- 62

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MV+ KDI+F+S CEHH+LP +GK+H+ YIP   V+GLSKL R +EV++RRLQ+QE+L
Sbjct: 63  --EMVVEKDITFYSTCEHHLLPFYGKVHIGYIPDGKVVGLSKLARTVEVFARRLQLQEQL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA A+     +KG  V+IE +HMCM+MRGIK+ G  TVT A  G F  D    + F 
Sbjct: 121 TGQIADALMEHMQAKGAIVMIEAEHMCMTMRGIKKPGSQTVTLARRGVFETDPALEERFF 180

Query: 199 KM 200
           +M
Sbjct: 181 RM 182


>gi|21673611|ref|NP_661676.1| GTP cyclohydrolase I [Chlorobium tepidum TLS]
 gi|25090397|sp|Q8KEA8|GCH1_CHLTE RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|21646726|gb|AAM72018.1| GTP cyclohydrolase I [Chlorobium tepidum TLS]
          Length = 224

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 125/181 (69%), Gaps = 3/181 (1%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDM 82
           +A+  +L+ +G+DP+REGL  TP+RV KS + L  GY+Q P  Q   +  F E+  Y +M
Sbjct: 46  DAVYSLLKGVGEDPEREGLLLTPERVAKSLRFLTKGYRQDPE-QLLKKAVFTES--YDEM 102

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           VL+KDI  +S CEHH+LP +GK H+AYIP   ++GLSK+ R++EV++RRLQ+QERLT QI
Sbjct: 103 VLVKDIDIYSMCEHHMLPFFGKAHVAYIPDGKIVGLSKIPRVVEVFARRLQVQERLTQQI 162

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTH 202
             AI++  + +GVAV+IE  HMCM MRG+++    T T+A +G+F   +     FL++  
Sbjct: 163 RDAIQNVLNPRGVAVVIEATHMCMVMRGVEKQNAVTTTSAMSGDFMTSQSTRSEFLRLIG 222

Query: 203 N 203
           N
Sbjct: 223 N 223


>gi|325295223|ref|YP_004281737.1| GTP cyclohydrolase 1 [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065671|gb|ADY73678.1| GTP cyclohydrolase 1 [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 186

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 128/187 (68%), Gaps = 14/187 (7%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH---FGE 75
           E  ++A+R IL  IG+DPDREGLKDTP RV K Y+E+ AGY       D++  H   F E
Sbjct: 6   ERIEKAVREILIAIGEDPDREGLKDTPKRVAKMYEEILAGY------NDSAENHLVLFTE 59

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP-KKHVIGLSKLVRILEVYSRRLQI 134
             KY +M++++DI  +S CEHH+LP +GK H+AYIP +  V GLSKL RI++VY++RLQ+
Sbjct: 60  --KYDEMIIVRDIPIYSLCEHHMLPFFGKAHVAYIPGEDKVTGLSKLARIVDVYAKRLQL 117

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T QIA AI     +KGV V++E QH+CM MRG+K+ G  TVT+A  G   ++  + 
Sbjct: 118 QERMTEQIADAIMEKLGAKGVMVVVEAQHLCMIMRGVKKPGSYTVTSAVKGAMRKEPTRM 177

Query: 195 D--FFLK 199
           +  F +K
Sbjct: 178 EALFLIK 184


>gi|182626681|ref|ZP_02954424.1| GTP cyclohydrolase I [Clostridium perfringens D str. JGS1721]
 gi|177908011|gb|EDT70594.1| GTP cyclohydrolase I [Clostridium perfringens D str. JGS1721]
          Length = 185

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 123/177 (69%), Gaps = 5/177 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           KE +++IL  IG+D +REGL +TPDR+ + Y+E+F+G         +  F         D
Sbjct: 8   KEGMKLILEAIGEDVNREGLIETPDRIARMYEEIFSGIGMNAKDHLSKTFEV----HSND 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL KDI+F+S CEHH++P +GK+H+AYIP   V+GLSKL R +EVYS++ Q+QERLT +
Sbjct: 64  LVLEKDITFYSMCEHHLVPFYGKVHIAYIPNGRVVGLSKLARCVEVYSKKPQLQERLTTE 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFF 197
           IA +I    D++GV V++EG+HMCM+MRG+++ G  TVTT + G+F  D+  K D F
Sbjct: 124 IADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVF 180


>gi|78049958|ref|YP_366133.1| GTP cyclohydrolase I [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|325927213|ref|ZP_08188473.1| GTP cyclohydrolase I [Xanthomonas perforans 91-118]
 gi|123583730|sp|Q3BM80|GCH1_XANC5 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|78038388|emb|CAJ26133.1| GTP cyclohydrolase I [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|325542411|gb|EGD13893.1| GTP cyclohydrolase I [Xanthomonas perforans 91-118]
          Length = 200

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 124/183 (67%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV ++Y + F+GY++ P  ++     F E 
Sbjct: 12  TQTQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYREEP--REYLERTFEEV 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R++E Y+RR Q+QE
Sbjct: 70  AGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVESYARRFQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGTFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|110803811|ref|YP_698418.1| GTP cyclohydrolase I [Clostridium perfringens SM101]
 gi|122956744|sp|Q0STY9|GCH1_CLOPS RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|110684312|gb|ABG87682.1| GTP cyclohydrolase I [Clostridium perfringens SM101]
          Length = 185

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 123/177 (69%), Gaps = 5/177 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E +++IL  IG+D +REGL +TPDR+ + Y+E+F+G         +  F         D
Sbjct: 8   REGMKLILEAIGEDANREGLIETPDRIARMYEEIFSGIGMNAKEHLSKTFEV----HSND 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL KDI+F+S CEHH++P +GK+H+AYIP   V+GLSKL R +EVYS++ Q+QERLT +
Sbjct: 64  LVLEKDITFYSMCEHHLVPFYGKVHIAYIPNGRVVGLSKLARCVEVYSKKPQLQERLTTE 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFF 197
           IA +I    D++GV V++EG+HMCM+MRG+++ G  TVTT + G+F  D+  K D F
Sbjct: 124 IADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVF 180


>gi|302392277|ref|YP_003828097.1| GTP cyclohydrolase I [Acetohalobium arabaticum DSM 5501]
 gi|302204354|gb|ADL13032.1| GTP cyclohydrolase I [Acetohalobium arabaticum DSM 5501]
          Length = 186

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 129/183 (70%), Gaps = 5/183 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ +EA+ +IL  IG+DPDREGL +TPDRV + Y+E+F+G  + P   D  +  F +A  
Sbjct: 5   EQIREAVGMILDAIGEDPDREGLLETPDRVARMYEEVFSGLHKDPA--DDLQIFFNQA-- 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDISF+S CEHH+LP +GK H+ YIP+   V GLSKL R+++ +++R Q+QER
Sbjct: 61  HEELVLVKDISFYSMCEHHLLPFYGKAHVGYIPENGKVTGLSKLARVVDSFAKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT Q+A  I  + +++GV V++E +HMCM+MRGIK+ G  T T+A  G    D+   +  
Sbjct: 121 LTSQVADLIMKNVEARGVIVVVEAEHMCMTMRGIKKPGSLTTTSAVRGILQNDQAAREEA 180

Query: 198 LKM 200
           LK+
Sbjct: 181 LKL 183


>gi|77408725|ref|ZP_00785457.1| GTP cyclohydrolase I [Streptococcus agalactiae COH1]
 gi|77172700|gb|EAO75837.1| GTP cyclohydrolase I [Streptococcus agalactiae COH1]
          Length = 187

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 121/174 (69%), Gaps = 5/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++AI   L  +G++PDREGLKDTP RV K Y E+F+G  Q P  Q T+ F    +  
Sbjct: 5   EKMEKAIYQFLEALGENPDREGLKDTPKRVAKMYIEMFSGLNQDPKEQFTAVF----SEN 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++V++KDI F+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 61  HEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDGRVTGLSKLARAVEVASKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LT Q+A A+E +   KG+ V+IE +HMCM+MRGIK+ G  T+TT   G +  D+
Sbjct: 121 LTAQVAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLYKDDR 174


>gi|283955376|ref|ZP_06372875.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 414]
 gi|283793136|gb|EFC31906.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. jejuni 414]
          Length = 190

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 127/178 (71%), Gaps = 6/178 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQ 80
           ++ I+ +L  IG++P+REGL  TP+RV ++Y+ L +GY Q +    + + F     S   
Sbjct: 6   EDCIKTMLETIGENPNREGLIKTPNRVFRAYEFLTSGYTQNVKEILNDALFE----SSNN 61

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTM 140
           +MVL++DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++EV++RRLQIQE+LT 
Sbjct: 62  EMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTE 121

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           QIA A+  + D+KGV V+IE +HMC+ MRG+++   TT T+A  G F ++ K + +FF
Sbjct: 122 QIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFF 179


>gi|167758804|ref|ZP_02430931.1| hypothetical protein CLOSCI_01146 [Clostridium scindens ATCC 35704]
 gi|167663544|gb|EDS07674.1| hypothetical protein CLOSCI_01146 [Clostridium scindens ATCC 35704]
          Length = 186

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 122/179 (68%), Gaps = 4/179 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           K+A+ ++L  IG+D  REGL DTPDR+ + Y+E++ G ++   T  +  FH   +    +
Sbjct: 8   KQAVTLLLEGIGEDVTREGLIDTPDRIARMYEEIYGGMEEDAATHLSKVFHVDSS----E 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+ KDI F+S CEHH+LP +GK+H+AYIP   V+GLSKL R +EV++RRLQ+QE+LT Q
Sbjct: 64  MVIEKDIPFYSTCEHHMLPFYGKVHIAYIPDGKVVGLSKLARTVEVFARRLQLQEQLTGQ 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           I  A+ +    KGV V++E +H+CM+MRGIK+ G  TVT A  GEF  +    + F +M
Sbjct: 124 IVDALMTHMQPKGVMVMVEAEHLCMTMRGIKKPGSQTVTVARRGEFETNPVLEELFFRM 182


>gi|153811105|ref|ZP_01963773.1| hypothetical protein RUMOBE_01496 [Ruminococcus obeum ATCC 29174]
 gi|149832993|gb|EDM88076.1| hypothetical protein RUMOBE_01496 [Ruminococcus obeum ATCC 29174]
          Length = 185

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 124/185 (67%), Gaps = 4/185 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           ++ ++AIR++L  IG+D +REGLKDTPDR+ +   E++ G  +        +F      +
Sbjct: 5   QKVEQAIRLLLEGIGEDTEREGLKDTPDRIARMCMEIYGGLDEEADHHLAKQFEV----E 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MVL KDI+F+S CEHH++P +GK H+AYIP   V GLSKL R ++VY+RR QIQERL
Sbjct: 61  NNEMVLEKDITFYSMCEHHLMPFYGKAHVAYIPNGKVTGLSKLARTVDVYARRPQIQERL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T+QIA A+E + + KG+ V++E +H CM+MRGIK+ G  T+TT   G+F  D+     FL
Sbjct: 121 TVQIADALERTLNPKGIMVMLEAEHTCMTMRGIKKPGSKTITTVTRGDFKTDRELQKQFL 180

Query: 199 KMTHN 203
            M  +
Sbjct: 181 SMVKD 185


>gi|148254406|ref|YP_001238991.1| GTP cyclohydrolase [Bradyrhizobium sp. BTAi1]
 gi|146406579|gb|ABQ35085.1| GTP cyclohydrolase I [Bradyrhizobium sp. BTAi1]
          Length = 206

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 123/186 (66%), Gaps = 2/186 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T ++ ++AIR IL WIG+DP REGL +TP RV ++YK  FAGY Q P  ++  R  F E 
Sbjct: 18  TQDDVEDAIRTILTWIGEDPSREGLSETPARVARAYKSYFAGYDQNP--EEYLRKTFEET 75

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y +MVL+++I F S+CEHH+ PI G+  + Y+P+  V+G+SKL R++E Y+ RLQIQE
Sbjct: 76  AGYDEMVLLRNIPFQSHCEHHMAPIIGRAWVGYVPRSRVVGISKLARVVEAYASRLQIQE 135

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+T +IA+ I+     +GVAV+I+  H C+S RG+K+ G+   T+   G F  D      
Sbjct: 136 RMTAEIANIIDEVLQPQGVAVVIKAAHHCISSRGVKKHGVDLTTSRMLGCFRNDPMSRQE 195

Query: 197 FLKMTH 202
           FL M +
Sbjct: 196 FLAMVN 201


>gi|282877709|ref|ZP_06286524.1| GTP cyclohydrolase I [Prevotella buccalis ATCC 35310]
 gi|281300281|gb|EFA92635.1| GTP cyclohydrolase I [Prevotella buccalis ATCC 35310]
          Length = 197

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 116/170 (68%), Gaps = 3/170 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+DP REGL+ TP RV K+ + L  GY Q P  Q      F E  KY  MV++KD
Sbjct: 21  ILSLLGEDPQREGLQKTPMRVAKAMQVLTRGYAQDPK-QVLLDALFDE--KYNQMVIVKD 77

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I FFS CEHH+LP +GK+H+AYIP  H+ GLSK+ R++++YS RLQ+QERLT QI   I+
Sbjct: 78  IDFFSMCEHHMLPFYGKVHVAYIPNGHITGLSKIARVVDIYSHRLQVQERLTQQIGDCIQ 137

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           S+    GV V+IE +HMCM MRG+++    T T+AF+G F++ K + +F 
Sbjct: 138 SALKPLGVMVVIEAKHMCMQMRGVEKQNSITTTSAFSGAFNQAKTREEFM 187


>gi|153951136|ref|YP_001397441.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. doylei 269.97]
 gi|166218213|sp|A7H1R1|GCH1_CAMJD RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|152938582|gb|ABS43323.1| GTP cyclohydrolase I [Campylobacter jejuni subsp. doylei 269.97]
          Length = 190

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 127/178 (71%), Gaps = 6/178 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQ 80
           ++ ++ +L  IG++P+REGL  TP+RV K+Y+ L +GY Q +    + + F     S   
Sbjct: 6   EDCVKTMLEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILNDALFE----SSNN 61

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTM 140
           +MVL++DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++EV++RRLQIQE+LT 
Sbjct: 62  EMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTE 121

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           QIA A+  + D+KGV V+IE +HMC+ MRG+++   TT T+A  G F ++ K + +FF
Sbjct: 122 QIAQALMENADAKGVGVIIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKIREEFF 179


>gi|254420817|ref|ZP_05034541.1| GTP cyclohydrolase I [Brevundimonas sp. BAL3]
 gi|196186994|gb|EDX81970.1| GTP cyclohydrolase I [Brevundimonas sp. BAL3]
          Length = 196

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 122/187 (65%), Gaps = 2/187 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+ A+R ++ W GDDPDREGL +TP RV +SY+ELF+GY+  P +     F   E 
Sbjct: 12  TQADAEAAVRTLIEWAGDDPDREGLLETPARVARSYRELFSGYEVDPLSYLEKTFE--ET 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             Y  +V++KDI F S+CEHH+LP+ GK H+AY+P   V+G+SKL R++  ++RRLQIQE
Sbjct: 70  GGYDQLVVLKDIRFVSFCEHHMLPVVGKAHVAYLPTDRVVGISKLARVVRGFARRLQIQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T +IA AI++    +GV V+IE +H CM++RG+   G +  T+   G    D    + 
Sbjct: 130 KMTAEIAEAIQTVLKPQGVGVVIEAEHSCMTLRGVNAPGASLSTSHLIGVVRDDPRTREE 189

Query: 197 FLKMTHN 203
           FL++   
Sbjct: 190 FLRLVRG 196


>gi|83589276|ref|YP_429285.1| GTP cyclohydrolase [Moorella thermoacetica ATCC 39073]
 gi|83572190|gb|ABC18742.1| GTP cyclohydrolase I [Moorella thermoacetica ATCC 39073]
          Length = 185

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 120/174 (68%), Gaps = 4/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+R+I+  +G+DPDREGL++TP R+   Y+E+FAG  + P  + T  F       
Sbjct: 4   EKIRQAVRMIIEAVGEDPDREGLRETPRRIADMYEEIFAGINRDPGEELTVVFD----EH 59

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           +++MVL+KDI  +S CEHH LP  G+ H+AYIP+  + GLSKL R++++ +RR Q+QERL
Sbjct: 60  HEEMVLVKDIPLYSICEHHFLPFLGRAHVAYIPRGKITGLSKLARVVDIAARRPQVQERL 119

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           T QIA  I    +  GV V+IE +H+CMSMRGIK+ G  T+T+A  G F RD+ 
Sbjct: 120 TSQIADIIMEKLNPYGVVVVIEAEHLCMSMRGIKKPGSLTITSAVRGLFRRDQA 173


>gi|158338727|ref|YP_001519904.1| GTP cyclohydrolase I [Acaryochloris marina MBIC11017]
 gi|158308968|gb|ABW30585.1| GTP cyclohydrolase I [Acaryochloris marina MBIC11017]
          Length = 232

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/188 (46%), Positives = 128/188 (68%), Gaps = 5/188 (2%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFH 72
           ++ + EE   A+  +L  +G+DP+REGL  TP RV ++ + L +GY+Q +    + + F 
Sbjct: 42  RQASKEEMMGAVETMLLGVGEDPEREGLLKTPKRVAEAMRFLTSGYQQSLEDLVNNAIFD 101

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
            G    + +MVL++DI  FS CEHH+LP  GK H+AYIP + VIGLSKL RI+E+YSRRL
Sbjct: 102 EG----HDEMVLVRDIDAFSLCEHHMLPFIGKAHVAYIPNQKVIGLSKLARIVEMYSRRL 157

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           Q+QERLT QIA A++++ + KGVAV++E  HMCM MRG+++ G  TVT++  G F  D  
Sbjct: 158 QVQERLTRQIAEAVQTALEPKGVAVVMEASHMCMVMRGVQKPGSWTVTSSMIGVFQDDHK 217

Query: 193 KTDFFLKM 200
             + FL +
Sbjct: 218 TREEFLNL 225


>gi|313159724|gb|EFR59081.1| GTP cyclohydrolase I [Alistipes sp. HGB5]
          Length = 202

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/190 (47%), Positives = 124/190 (65%), Gaps = 4/190 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T+E  K     ILR +G+DP REGL  TP+RV K+   L  GY++ P     S   F E 
Sbjct: 16  TIEALKLHYAEILRLLGEDPSREGLLKTPERVAKAMAFLTKGYEENPLEIIRSAT-FRE- 73

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
            +Y+ MVL+KDI  +S CEHH+LP +GK H+AYIP  H+ GLSK+ R++E Y+RRLQ+QE
Sbjct: 74  -EYKQMVLVKDIELYSLCEHHMLPFYGKAHVAYIPNGHITGLSKIARVVECYARRLQVQE 132

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTD 195
           RLT+QI   I+ + +  GVAV+IE  HMCM MRGI++    T T+AFTG F  D + + +
Sbjct: 133 RLTVQIRDCIQEALNPMGVAVVIEASHMCMQMRGIEKQQSATTTSAFTGIFLSDHRTREE 192

Query: 196 FFLKMTHNQR 205
           F   ++H  R
Sbjct: 193 FMTLISHKYR 202


>gi|304320110|ref|YP_003853753.1| GTP cyclohydrolase I [Parvularcula bermudensis HTCC2503]
 gi|303299013|gb|ADM08612.1| GTP cyclohydrolase I [Parvularcula bermudensis HTCC2503]
          Length = 192

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 124/189 (65%), Gaps = 2/189 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           K  +P+  +A+EA+R IL +IG+DP REGL DTP R I +Y + F GY + P  ++    
Sbjct: 3   KANRPSRADAEEAVRTILSYIGEDPQREGLIDTPKRFIGAYDDWFKGYSEDP--EEFLSR 60

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   Y D+VL+++I   S+CEHH+ PI G  H+ Y+P   V+GLSK+ R+++ YS+R
Sbjct: 61  TFEEVEGYDDIVLLRNIRVESHCEHHVAPIIGTAHVGYLPSDRVVGLSKIARVVDAYSKR 120

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ QE LT QIA A++     +GVAV+I+ +H C+S RGI +D ++ VT +FTG+F  D 
Sbjct: 121 LQSQETLTNQIAGALDRVLQPRGVAVIIDAEHQCISTRGIHKDDISCVTRSFTGDFKADP 180

Query: 192 GKTDFFLKM 200
              D F ++
Sbjct: 181 RMEDRFYRL 189


>gi|253579084|ref|ZP_04856355.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850027|gb|EES77986.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 185

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/179 (48%), Positives = 119/179 (66%), Gaps = 4/179 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R++L  IG+D  REGL DTPDR+ +  +E++ G           +F      +  +
Sbjct: 8   EQAVRLLLEGIGEDITREGLIDTPDRIARMCEEIYGGLGHEADQHLLKQF----PVENNE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL KDI+F+S CEHH++P +GK HLAYIP   V GLSKL R +EVYSRR QIQERLT+Q
Sbjct: 64  IVLEKDITFYSMCEHHLMPFYGKAHLAYIPNGKVTGLSKLARTVEVYSRRPQIQERLTVQ 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           IA A+E + D KG+ V++E +H CM+MRGIK+ G  T+TT   G F+ DK     FL M
Sbjct: 124 IADALERTLDPKGIMVMLEAEHTCMTMRGIKKPGSKTITTVTRGAFTEDKELQKMFLSM 182


>gi|253680931|ref|ZP_04861734.1| GTP cyclohydrolase I [Clostridium botulinum D str. 1873]
 gi|253562780|gb|EES92226.1| GTP cyclohydrolase I [Clostridium botulinum D str. 1873]
          Length = 185

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 118/172 (68%), Gaps = 4/172 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+ +I+  IG+DP REGLK+TPDR+ + Y+E+F+G K+ P    +  F       
Sbjct: 5   EKIKKAVVMIIEAIGEDPSREGLKETPDRIARMYEEIFSGLKETPEKHLSKVFKVNN--- 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             D+V+ KDI F+S CEHH LP +GK+H+AYIP + V+GLSKL R +EV+S+R Q+QERL
Sbjct: 62  -DDVVIEKDIQFYSMCEHHFLPFFGKVHIAYIPNEEVVGLSKLARTMEVFSKRPQLQERL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           T QIA ++    + KGV V+IE +H+CMSMRG+K+ G  T T    G F  D
Sbjct: 121 TSQIADSLMKYLNCKGVMVVIEAEHLCMSMRGVKKWGAKTTTIVTRGIFQDD 172


>gi|168206508|ref|ZP_02632513.1| GTP cyclohydrolase I [Clostridium perfringens E str. JGS1987]
 gi|168215067|ref|ZP_02640692.1| GTP cyclohydrolase I [Clostridium perfringens CPE str. F4969]
 gi|168217514|ref|ZP_02643139.1| GTP cyclohydrolase I [Clostridium perfringens NCTC 8239]
 gi|169342378|ref|ZP_02863444.1| GTP cyclohydrolase I [Clostridium perfringens C str. JGS1495]
 gi|169299498|gb|EDS81562.1| GTP cyclohydrolase I [Clostridium perfringens C str. JGS1495]
 gi|170662031|gb|EDT14714.1| GTP cyclohydrolase I [Clostridium perfringens E str. JGS1987]
 gi|170713515|gb|EDT25697.1| GTP cyclohydrolase I [Clostridium perfringens CPE str. F4969]
 gi|182380460|gb|EDT77939.1| GTP cyclohydrolase I [Clostridium perfringens NCTC 8239]
          Length = 185

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 123/177 (69%), Gaps = 5/177 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E +++IL  IG+D +REGL +TPDR+ + Y+E+F+G         +  F         D
Sbjct: 8   REGMKLILEAIGEDVNREGLIETPDRIARMYEEIFSGIGMNAKEHLSKTFEV----HSND 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL KDI+F+S CEHH++P +GK+H+AYIP   V+GLSKL R +EVYS++ Q+QERLT +
Sbjct: 64  LVLEKDITFYSMCEHHLVPFYGKVHIAYIPNGRVVGLSKLARCVEVYSKKPQLQERLTTE 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFF 197
           IA +I    D++GV V++EG+HMCM+MRG+++ G  TVTT + G+F  D+  K D F
Sbjct: 124 IADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVF 180


>gi|294665811|ref|ZP_06731081.1| GTP cyclohydrolase I [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|25090410|sp|Q8PEP3|GCH1_XANAC RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|292604418|gb|EFF47799.1| GTP cyclohydrolase I [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 200

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 123/183 (67%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV ++Y + F+GY+  P  ++     F E 
Sbjct: 12  TQTQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRDEP--REYLERTFEEV 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R++E Y+RR Q+QE
Sbjct: 70  AGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVESYARRFQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|189346388|ref|YP_001942917.1| GTP cyclohydrolase I [Chlorobium limicola DSM 245]
 gi|189340535|gb|ACD89938.1| GTP cyclohydrolase I [Chlorobium limicola DSM 245]
          Length = 219

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/178 (47%), Positives = 123/178 (69%), Gaps = 3/178 (1%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDM 82
           +A+  +L  +G+DP+REGL  TP+RV +S + L  GY+Q P  +   +  F EA  Y +M
Sbjct: 42  DAVSSMLDGVGEDPEREGLVKTPERVARSMRFLTRGYRQDPE-EVLKKAVFTEA--YDEM 98

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           VL++DI  FS CEHH+LP +GK H+AYIP   ++GLSK+ R++EVY+RRLQ+QERLT QI
Sbjct: 99  VLVRDIDIFSMCEHHLLPFFGKAHVAYIPDGKIVGLSKIARVVEVYARRLQVQERLTQQI 158

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
             AI++  + +GVAV+IE +HMCM MRG+++    T T+A +GEF         FL++
Sbjct: 159 RDAIQNVLNPRGVAVVIEARHMCMVMRGVEKLNSITTTSAMSGEFLASPSTRSEFLRL 216


>gi|329963074|ref|ZP_08300854.1| GTP cyclohydrolase I [Bacteroides fluxus YIT 12057]
 gi|328529115|gb|EGF56045.1| GTP cyclohydrolase I [Bacteroides fluxus YIT 12057]
          Length = 195

 Score =  179 bits (454), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 125/189 (66%), Gaps = 5/189 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P+++E KE  + IL  +G+DP REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PSLDELKEHYQRILTLLGEDPGREGLLKTPERVAKAMLSLTKGYYMDPHEVLRSAKFQ-- 67

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 68  --EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTHN 203
           +F   + HN
Sbjct: 186 EFMNLIRHN 194


>gi|218128548|ref|ZP_03457352.1| hypothetical protein BACEGG_00118 [Bacteroides eggerthii DSM 20697]
 gi|317475636|ref|ZP_07934897.1| GTP cyclohydrolase I [Bacteroides eggerthii 1_2_48FAA]
 gi|329957255|ref|ZP_08297775.1| GTP cyclohydrolase I [Bacteroides clarus YIT 12056]
 gi|217989272|gb|EEC55586.1| hypothetical protein BACEGG_00118 [Bacteroides eggerthii DSM 20697]
 gi|316908206|gb|EFV29899.1| GTP cyclohydrolase I [Bacteroides eggerthii 1_2_48FAA]
 gi|328522968|gb|EGF50071.1| GTP cyclohydrolase I [Bacteroides clarus YIT 12056]
          Length = 195

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 124/189 (65%), Gaps = 5/189 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P+++E KE    IL  +G+DP+REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PSLDELKEHYHRILTLLGEDPEREGLLKTPERVAKAMLTLTKGYSMDPHEVLRSAKF--- 66

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
               Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 67  -KEDYNQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTHN 203
           +F   + HN
Sbjct: 186 EFMNLIRHN 194


>gi|150009291|ref|YP_001304034.1| GTP cyclohydrolase I [Parabacteroides distasonis ATCC 8503]
 gi|166220280|sp|A6LFE8|GCH1_PARD8 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|149937715|gb|ABR44412.1| GTP cyclohydrolase I [Parabacteroides distasonis ATCC 8503]
          Length = 196

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/188 (45%), Positives = 127/188 (67%), Gaps = 6/188 (3%)

Query: 21  AKEAI----RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           A+EA+    + +L  +G+D +REGL  TP+RV K+ + L  GY + P  +   R    + 
Sbjct: 11  AREALAGHYKEVLGLLGEDVEREGLLKTPERVAKAMQFLTKGYHEDP--EAVLRSAMFQE 68

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             Y+ MV++KDI FFS CEHH+LP +GK H+AYIPKK++ GLSK+ R++++++RRLQIQE
Sbjct: 69  EDYKQMVIVKDIDFFSLCEHHMLPFFGKAHVAYIPKKYITGLSKIPRVVDIFARRLQIQE 128

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+TMQI   I+ + D  GV V+IE QHMCM MRG+++    T T+ FTG F + K + +F
Sbjct: 129 RMTMQIKDCIQRTLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFFQQAKTREEF 188

Query: 197 FLKMTHNQ 204
              + HN+
Sbjct: 189 MNLIKHNR 196


>gi|298376920|ref|ZP_06986874.1| GTP cyclohydrolase I [Bacteroides sp. 3_1_19]
 gi|298265904|gb|EFI07563.1| GTP cyclohydrolase I [Bacteroides sp. 3_1_19]
          Length = 197

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/188 (45%), Positives = 127/188 (67%), Gaps = 6/188 (3%)

Query: 21  AKEAI----RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           A+EA+    + +L  +G+D +REGL  TP+RV K+ + L  GY + P  +   R    + 
Sbjct: 12  AREALAGHYKEVLGLLGEDVEREGLLKTPERVAKAMQFLTKGYHEDP--EAVLRSAMFQE 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             Y+ MV++KDI FFS CEHH+LP +GK H+AYIPKK++ GLSK+ R++++++RRLQIQE
Sbjct: 70  EDYKQMVIVKDIDFFSLCEHHMLPFFGKAHVAYIPKKYITGLSKIPRVVDIFARRLQIQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+TMQI   I+ + D  GV V+IE QHMCM MRG+++    T T+ FTG F + K + +F
Sbjct: 130 RMTMQIKDCIQRTLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFFQQAKTREEF 189

Query: 197 FLKMTHNQ 204
              + HN+
Sbjct: 190 MNLIKHNR 197


>gi|83859157|ref|ZP_00952678.1| GTP cyclohydrolase I [Oceanicaulis alexandrii HTCC2633]
 gi|83852604|gb|EAP90457.1| GTP cyclohydrolase I [Oceanicaulis alexandrii HTCC2633]
          Length = 209

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 121/191 (63%), Gaps = 2/191 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +PT EEA+EA+R +LRW GDDP REGL +TP RV+ +Y + F GY + P      RF   
Sbjct: 20  RPTREEAEEAVRTLLRWAGDDPRREGLLETPKRVVNAYNDWFRGYDEDPHKILGKRFE-- 77

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           +   Y DMV++ +I   S+CEHH+ PI G   +AY+P + V+G+SK+ +++E +S+RLQ 
Sbjct: 78  DVQGYDDMVMLTNIDVESHCEHHMAPILGTACVAYLPDRAVVGISKIAKVVEAFSKRLQT 137

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA AIE +    GVA+ ++ +H CM+ RG+    ++T+TT F GEF  +    
Sbjct: 138 QETMTAQIADAIEDAMSPLGVAIFVDAKHQCMTTRGVHHPNVSTITTMFRGEFKANAELR 197

Query: 195 DFFLKMTHNQR 205
             F+ +    +
Sbjct: 198 QRFMNLCEQSK 208


>gi|305432741|ref|ZP_07401901.1| GTP cyclohydrolase I [Campylobacter coli JV20]
 gi|304444250|gb|EFM36903.1| GTP cyclohydrolase I [Campylobacter coli JV20]
          Length = 200

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 128/181 (70%), Gaps = 6/181 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           E+ +  ++ +L  +G++P REGL  TP+RV K+Y+ L +GYK+ +    + + F     S
Sbjct: 13  EKFENCVKTMLEIMGENPTREGLVKTPNRVFKAYEFLTSGYKKNVKEILNNALFE----S 68

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              +MVL++DI F+S CEHH+LP +G++H+AYIP + V+GLSK+ R++EVY+RRLQIQE+
Sbjct: 69  SNNEMVLVRDIEFYSLCEHHLLPFFGRVHVAYIPDQKVVGLSKIPRLVEVYARRLQIQEQ 128

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDF 196
           LT QIA A+  +  +KGV V+IE +HMC+ MRG+++   TT T+A  G F ++ K + +F
Sbjct: 129 LTEQIAEALMENVGAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGLFLKNEKTREEF 188

Query: 197 F 197
           F
Sbjct: 189 F 189


>gi|110801052|ref|YP_695720.1| GTP cyclohydrolase I [Clostridium perfringens ATCC 13124]
 gi|122958935|sp|Q0TRM0|GCH1_CLOP1 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|110675699|gb|ABG84686.1| GTP cyclohydrolase I [Clostridium perfringens ATCC 13124]
          Length = 185

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 123/177 (69%), Gaps = 5/177 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E +++IL  IG+D +REGL +TPDR+ + Y+E+F+G         +  F         D
Sbjct: 8   REGMKLILEAIGEDINREGLIETPDRIARMYEEIFSGIGMNAKEHLSKTFEV----HSND 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL KDI+F+S CEHH++P +GK+H+AYIP   V+GLSKL R +EVYS++ Q+QERLT +
Sbjct: 64  LVLEKDITFYSMCEHHLVPFYGKVHIAYIPNGRVVGLSKLARCVEVYSKKPQLQERLTTE 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFF 197
           IA +I    D++GV V++EG+HMCM+MRG+++ G  TVTT + G+F  D+  K D F
Sbjct: 124 IADSIMEYLDAQGVMVVVEGEHMCMTMRGVRKPGAKTVTTTYRGKFLEDESLKNDVF 180


>gi|329939452|ref|ZP_08288788.1| GTP cyclohydrolase I [Streptomyces griseoaurantiacus M045]
 gi|329301681|gb|EGG45575.1| GTP cyclohydrolase I [Streptomyces griseoaurantiacus M045]
          Length = 201

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 119/169 (70%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  IG+DPDREGL+DTP RV ++Y+E+FAG +Q P    T+ F  G    + 
Sbjct: 21  AENAVRELLLAIGEDPDREGLRDTPGRVARAYQEIFAGLRQRPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  FS CEHH++P  G  H+ YIP  +  + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPSANGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    + +GV V++E +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TTQIAESLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRGQL 185


>gi|255015899|ref|ZP_05288025.1| GTP cyclohydrolase I [Bacteroides sp. 2_1_7]
          Length = 196

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/188 (45%), Positives = 127/188 (67%), Gaps = 6/188 (3%)

Query: 21  AKEAI----RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           A+EA+    + +L  +G+D +REGL  TP+RV K+ + L  GY + P  +   R    + 
Sbjct: 11  AREALAGHYKEVLGLLGEDVEREGLLKTPERVAKAMQFLTKGYHEDP--EAVLRSAMFQE 68

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             Y+ MV++KDI FFS CEHH+LP +GK H+AYIPKK++ GLSK+ R++++++RRLQIQE
Sbjct: 69  EDYKQMVIVKDIDFFSLCEHHMLPFFGKAHVAYIPKKYITGLSKIPRVVDIFARRLQIQE 128

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+TMQI   I+ + D  GV V+IE QHMCM MRG+++    T T+ FTG F + K + +F
Sbjct: 129 RMTMQIKDCIQRTLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFFQQAKTREEF 188

Query: 197 FLKMTHNQ 204
              + HN+
Sbjct: 189 MNLIKHNR 196


>gi|110598452|ref|ZP_01386723.1| GTP cyclohydrolase I [Chlorobium ferrooxidans DSM 13031]
 gi|110339902|gb|EAT58406.1| GTP cyclohydrolase I [Chlorobium ferrooxidans DSM 13031]
          Length = 223

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 119/178 (66%), Gaps = 3/178 (1%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDM 82
           EA+  +L  IG+DP REGL  TP+RV +S + L  GY Q P  +      F E+  Y +M
Sbjct: 46  EAVTAMLEGIGEDPRREGLLKTPERVARSMRFLTRGYSQDPE-ELLKNAVFTES--YDEM 102

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           VL+KDI  FS CEHH+LP +GK H+AYIP   ++GLSKL R+ EV+SRRLQ+QERLT QI
Sbjct: 103 VLVKDIDIFSMCEHHMLPFFGKAHIAYIPDGKIVGLSKLARVAEVFSRRLQVQERLTQQI 162

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
             AI+S  + KGV V+IE +HMCM MRG+++    T T+A +G+F   +     FL++
Sbjct: 163 RDAIQSVLNPKGVGVVIEARHMCMVMRGVEKLNSVTTTSAMSGQFITSQSTRSEFLRL 220


>gi|325109457|ref|YP_004270525.1| GTP cyclohydrolase I [Planctomyces brasiliensis DSM 5305]
 gi|324969725|gb|ADY60503.1| GTP cyclohydrolase I [Planctomyces brasiliensis DSM 5305]
          Length = 231

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 124/191 (64%), Gaps = 10/191 (5%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR---FHFG 74
           +E  K+A+RVIL+ +G+DPDR+GL +TP RV K Y E+FAG  +     D  R     F 
Sbjct: 48  LESIKDAVRVILKAVGEDPDRDGLLETPRRVAKMYAEMFAGLHK-----DAGRHLEVTFP 102

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MVL++DISF S CEHH+LP  G  H+AY+P   V GLSKL R++E  SRR Q+
Sbjct: 103 ET--YDEMVLVRDISFTSMCEHHLLPFSGVAHVAYLPDGAVTGLSKLARVVEEVSRRPQV 160

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T  +A  IE+  + +GVAV++E +H CM++RGI++ G  T+T+A  GEF  +    
Sbjct: 161 QERMTQTVAELIETRLECRGVAVVVEAEHSCMTIRGIRKPGSKTITSALRGEFKTNPASR 220

Query: 195 DFFLKMTHNQR 205
              + + + +R
Sbjct: 221 AEVMSLINERR 231


>gi|53721079|ref|YP_110064.1| GTP cyclohydrolase I [Burkholderia pseudomallei K96243]
 gi|52211493|emb|CAH37483.1| GTP cyclohydrolase I [Burkholderia pseudomallei K96243]
          Length = 184

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 81/177 (45%), Positives = 116/177 (65%), Gaps = 2/177 (1%)

Query: 27  VILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIK 86
           ++LRW GDDP REGL DTP RV+++Y+E FAGY   P  +D     F E   Y +M+++K
Sbjct: 1   MLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEP--RDILARTFSEVDGYDEMIVLK 58

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI F SYCEHH++PI G+ H+AY+P   V+G+SKL R+++ +++RLQIQE++T+QIA  +
Sbjct: 59  DIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRLQIQEKMTVQIADTL 118

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHN 203
                 KGV V++E  H C+S RGI + G+  VT+   G F  D      FL +  N
Sbjct: 119 FDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDPATRREFLSIVAN 175


>gi|58584223|ref|YP_203239.1| GTP cyclohydrolase I [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58428817|gb|AAW77854.1| GTP cyclohydrolase I [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 209

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 125/183 (68%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A++A+R++LRW G+DP REGL DTP RV ++Y + F+GY+  P  ++     F E 
Sbjct: 21  TQTQAEDAVRILLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRIEP--REYLERTFEEV 78

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P++ V+G+SKL R++E Y+RR Q+QE
Sbjct: 79  AGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRRKVVGISKLARVVESYARRFQVQE 138

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 139 KMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAE 198

Query: 197 FLK 199
           FL+
Sbjct: 199 FLQ 201


>gi|299133076|ref|ZP_07026271.1| GTP cyclohydrolase I [Afipia sp. 1NLS2]
 gi|298593213|gb|EFI53413.1| GTP cyclohydrolase I [Afipia sp. 1NLS2]
          Length = 208

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 121/190 (63%), Gaps = 6/190 (3%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT--QDTSRF 71
           ++P   E ++A R I+RW GDDP R+GL +TP RV ++++E F GY Q P T  Q T   
Sbjct: 19  ERPDRAEVEDAFRTIIRWTGDDPKRDGLIETPSRVARAFEEFFIGYSQNPVTVLQKT--- 75

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   Y +M+ ++ + F S+CEHH+ PI GK  +AYIP   V+G+SKL R++E+Y++R
Sbjct: 76  -FEEIEGYDEMITLRGVRFESHCEHHMAPIVGKAWVAYIPNGRVVGISKLARVVEIYAKR 134

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T QIA+ I      +GVAVLI+ QH CM+ RGI + G   VT+   G F  + 
Sbjct: 135 LQIQEKMTAQIANTINDVLKPQGVAVLIKAQHHCMTTRGIHKPGTDLVTSRMLGCFRDNP 194

Query: 192 GKTDFFLKMT 201
                FL MT
Sbjct: 195 ATRQEFLSMT 204


>gi|194336907|ref|YP_002018701.1| GTP cyclohydrolase I [Pelodictyon phaeoclathratiforme BU-1]
 gi|194309384|gb|ACF44084.1| GTP cyclohydrolase I [Pelodictyon phaeoclathratiforme BU-1]
          Length = 218

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 122/177 (68%), Gaps = 3/177 (1%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+  +L  IG+DP REGL  TP+RV KS + L  GY++ P  +   +  F EA  Y +MV
Sbjct: 42  AVSAMLEGIGEDPQREGLLKTPERVAKSLRFLTKGYREDPE-ELLKKAVFTEA--YDEMV 98

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           L++DI  FS CEHH+LP +GK H+AYIP   ++GLSKL R++EV++RRLQ+QERLT QI 
Sbjct: 99  LVRDIDLFSMCEHHMLPFFGKAHVAYIPDGKIVGLSKLARVVEVFARRLQVQERLTQQIR 158

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
            AI++  + KGVAV+IE +H+CM MRG+++    T T+A +G+F   +     FL++
Sbjct: 159 DAIQNVLNPKGVAVVIEAKHLCMVMRGVEKINSVTTTSAMSGQFITSQSTRSEFLRL 215


>gi|56963648|ref|YP_175379.1| GTP cyclohydrolase I [Bacillus clausii KSM-K16]
 gi|56909891|dbj|BAD64418.1| GTP cyclohydrolase I [Bacillus clausii KSM-K16]
          Length = 189

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 124/170 (72%), Gaps = 5/170 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R+IL  IG+DP+REGL DTP RV + Y+E+F+G  + P+  +  +  FGE  ++++
Sbjct: 8   QQAVRMILEAIGEDPEREGLADTPRRVAQMYEEMFSGLHEDPS--EHLKTVFGE--EHEE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVI-GLSKLVRILEVYSRRLQIQERLTM 140
           +VL+KDI FFS CEHH++P +GK H+AYIPK  ++ GLSKL R ++  +RR Q+QER+T 
Sbjct: 64  LVLVKDIPFFSMCEHHLVPFFGKAHIAYIPKNGIVTGLSKLARTVDGIARRPQVQERMTK 123

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            +A  + S+ D+KG  V++  +HMCM+MRGIK+ G  TVTTA  G F+ D
Sbjct: 124 TLADVLMSTLDAKGAMVVLSAEHMCMAMRGIKKPGSKTVTTAVRGSFAND 173


>gi|148654866|ref|YP_001275071.1| GTP cyclohydrolase I [Roseiflexus sp. RS-1]
 gi|148566976|gb|ABQ89121.1| GTP cyclohydrolase [Roseiflexus sp. RS-1]
          Length = 226

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 125/191 (65%), Gaps = 10/191 (5%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE 75
           P +E+A   +RVIL+ IG++P+REGL  TP RV K Y EL AGY   P            
Sbjct: 44  PAIEDA---VRVILKQIGENPEREGLLKTPSRVAKMYAELTAGYHIDPDALINDAIF--- 97

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
           +  Y +MVL+K+I F S CEHH+LP  G++H+AYIP   V+GLSK+ RI+E+++RRLQ+Q
Sbjct: 98  SVSYDEMVLVKNIEFASLCEHHMLPFMGRVHVAYIPNGKVVGLSKIPRIVEMFARRLQVQ 157

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKT 194
           ER+T+QIA  I    +  GVAV+ EG HMC  MRG+K+ G T VT+A  G F  D K ++
Sbjct: 158 ERMTVQIADFINQRLEPLGVAVVAEGVHMCAVMRGVKKAGATMVTSAMRGVFRDDPKTRS 217

Query: 195 DFFLKMTHNQR 205
           +F   M H +R
Sbjct: 218 EF---MAHIER 225


>gi|167648024|ref|YP_001685687.1| GTP cyclohydrolase I [Caulobacter sp. K31]
 gi|167350454|gb|ABZ73189.1| GTP cyclohydrolase I [Caulobacter sp. K31]
          Length = 197

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/173 (49%), Positives = 117/173 (67%), Gaps = 2/173 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ +EAIR ++RW G+DP REGL DTP RV +++KE   GY + P  Q  SR  F E   
Sbjct: 15  EDVQEAIRTLIRWTGEDPSREGLVDTPSRVARAWKEYCEGYGEDPA-QHLSRV-FEEVGG 72

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y D+VL+KD+ F S+CEHH+ PI GK H+AY+P+  V+G+SKL R+L  ++RRLQIQERL
Sbjct: 73  YDDIVLLKDVPFQSHCEHHMAPIIGKAHIAYLPRDRVVGISKLARVLHGFARRLQIQERL 132

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           T +IA  +  +    GVAV+IE  H CMS RG++  G+T  T+   G F  D+
Sbjct: 133 TAEIADCLWDNLQPLGVAVVIEASHACMSGRGVRTPGVTMKTSRMMGVFRDDE 185


>gi|296273938|ref|YP_003656569.1| GTP cyclohydrolase I [Arcobacter nitrofigilis DSM 7299]
 gi|296098112|gb|ADG94062.1| GTP cyclohydrolase I [Arcobacter nitrofigilis DSM 7299]
          Length = 190

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 124/180 (68%), Gaps = 3/180 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++AI+ +L ++G+D  REGL+ TP RV K++  + +GYKQ P     S       S   +
Sbjct: 8   EDAIKSVLEYVGEDVTREGLEKTPSRVRKAFDFMCSGYKQDPKEIINSALF---TSSNDE 64

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+IKDI F+S CEHH+LPI GK H+AYIP   V+GLSK+ R+++V++RRLQIQE++T Q
Sbjct: 65  MVVIKDIEFYSMCEHHMLPIIGKAHVAYIPNGKVVGLSKIPRVVDVFARRLQIQEQMTEQ 124

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           I  A+  + + KGVAV+I+ +HMCM MRG+++   TTVT+A  G F ++K   D FL + 
Sbjct: 125 ICDALHEALNPKGVAVMIDARHMCMEMRGVEKICSTTVTSALRGLFKKEKKTKDEFLSIV 184


>gi|205356559|ref|ZP_03223322.1| GTP-cyclohydrolase I [Campylobacter jejuni subsp. jejuni CG8421]
 gi|757796|emb|CAA59929.1| GTP cyclohydrolase i [Campylobacter jejuni]
 gi|205345564|gb|EDZ32204.1| GTP-cyclohydrolase I [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 179

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 123/172 (71%), Gaps = 6/172 (3%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           +L  IG++P+REGL  TP+RV K+Y+ L +GY Q +    + + F     S   +MVL++
Sbjct: 1   MLEIIGENPNREGLIKTPNRVFKAYEFLTSGYTQNVKEILNDALFE----SSNNEMVLVR 56

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++EV++RRLQIQE+LT QIA A+
Sbjct: 57  DIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLTEQIAQAL 116

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
             + D+KGV V+IE +HMC+ MRG+++   TT T+A  G F ++ K + +FF
Sbjct: 117 MENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFF 168


>gi|189500520|ref|YP_001959990.1| GTP cyclohydrolase I [Chlorobium phaeobacteroides BS1]
 gi|189495961|gb|ACE04509.1| GTP cyclohydrolase I [Chlorobium phaeobacteroides BS1]
          Length = 223

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 85/191 (44%), Positives = 126/191 (65%), Gaps = 3/191 (1%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           N    +  +    EA+  +L  IG++P+REGLK TP+RV +S + L  GY + P  +   
Sbjct: 33  NCDTDQEIISSMSEAVYTMLEGIGENPEREGLKKTPERVARSMRFLTKGYLEDPE-EMLK 91

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
           +  F E+  Y +MVL+K+I  FS CEHH+LP +GK H+AYIP   ++GLSKL R+++VY+
Sbjct: 92  KAVFTES--YDEMVLVKEIELFSMCEHHMLPFFGKAHVAYIPDGKIVGLSKLGRVVDVYA 149

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQ+QERLT QI  AI++  + +GV V+IE +HMCM MRG+++    T T+A +GEF  
Sbjct: 150 RRLQVQERLTQQIRDAIQNVLNPRGVGVVIEAKHMCMVMRGVEKQNSITTTSAMSGEFLS 209

Query: 190 DKGKTDFFLKM 200
            +     FL++
Sbjct: 210 SQSTRSEFLRL 220


>gi|87200023|ref|YP_497280.1| GTP cyclohydrolase [Novosphingobium aromaticivorans DSM 12444]
 gi|87135704|gb|ABD26446.1| GTP cyclohydrolase I [Novosphingobium aromaticivorans DSM 12444]
          Length = 204

 Score =  178 bits (452), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 83/178 (46%), Positives = 118/178 (66%), Gaps = 2/178 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K P  ++ ++AIR ++RW GDDP+REGL DTP RV +++KE   GY + P    + +F  
Sbjct: 17  KVPVPQDVQDAIRTLIRWSGDDPEREGLLDTPKRVARAWKEYCQGYGEDPAVHLSRQFE- 75

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y ++VL+KDI F S+CEHH+ PI GK  +AY+P+  V+G+SKL R+L  ++RRLQ
Sbjct: 76  -EVGGYDEIVLLKDIPFQSHCEHHMAPIIGKAAIAYLPRDKVVGISKLARVLHGFARRLQ 134

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           IQERLT ++A  I  +    GVAV+IE QH CM+ RG++  G+  VT+   G F  D 
Sbjct: 135 IQERLTAEVAQCIWDNLRPHGVAVVIEAQHACMTARGVRTPGVGMVTSRLMGTFLDDN 192


>gi|262384180|ref|ZP_06077316.1| GTP cyclohydrolase I [Bacteroides sp. 2_1_33B]
 gi|262295078|gb|EEY83010.1| GTP cyclohydrolase I [Bacteroides sp. 2_1_33B]
          Length = 197

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/188 (45%), Positives = 126/188 (67%), Gaps = 6/188 (3%)

Query: 21  AKEAI----RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           A+EA+    + +L  +G+D  REGL  TP+RV K+ + L  GY + P  +   R    + 
Sbjct: 12  AREALAGHYKEVLGLLGEDAGREGLLKTPERVAKAMQFLTKGYHEDP--EAVLRSAMFQE 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             Y+ MV++KDI FFS CEHH+LP +GK H+AYIPKK++ GLSK+ R++++++RRLQIQE
Sbjct: 70  EDYKQMVIVKDIDFFSLCEHHMLPFFGKAHVAYIPKKYITGLSKIPRVVDIFARRLQIQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+TMQI   I+ + D  GV V+IE QHMCM MRG+++    T T+ FTG F + K + +F
Sbjct: 130 RMTMQIKDCIQRTLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFFQQAKTREEF 189

Query: 197 FLKMTHNQ 204
              + HN+
Sbjct: 190 MNLIKHNR 197


>gi|57168631|ref|ZP_00367763.1| GTP cyclohydrolase I [Campylobacter coli RM2228]
 gi|57019912|gb|EAL56592.1| GTP cyclohydrolase I [Campylobacter coli RM2228]
          Length = 190

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 128/181 (70%), Gaps = 6/181 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           E+ +  ++ +L  +G++P REGL  TP+RV K+Y+ L +GYK+ +    + + F     S
Sbjct: 3   EKFENCVKTMLEIMGENPTREGLVKTPNRVFKAYEFLTSGYKKNVKEILNNALFE----S 58

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              +MVL++DI F+S CEHH+LP +G++H+AYIP + V+GLSK+ R++EVY+RRLQIQE+
Sbjct: 59  SNNEMVLVRDIEFYSLCEHHLLPFFGRVHVAYIPDQKVVGLSKIPRLVEVYARRLQIQEQ 118

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDF 196
           LT QIA A+  +  +KGV V+IE +HMC+ MRG+++   TT T+A  G F ++ K + +F
Sbjct: 119 LTEQIAEALMENVGAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGLFLKNEKTREEF 178

Query: 197 F 197
           F
Sbjct: 179 F 179


>gi|85373831|ref|YP_457893.1| GTP cyclohydrolase I [Erythrobacter litoralis HTCC2594]
 gi|84786914|gb|ABC63096.1| GTP cyclohydrolase I [Erythrobacter litoralis HTCC2594]
          Length = 203

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 90/192 (46%), Positives = 127/192 (66%), Gaps = 3/192 (1%)

Query: 1   MKCLRTGVFNMKLKKPTVEE-AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY 59
           M C    V +  +KKP V E  ++AIR ++ W GDDP REGL DTP RV +++ E   GY
Sbjct: 1   MACEADYVEDPAIKKPDVPEHVQDAIRTLIEWSGDDPAREGLLDTPKRVGRAWLEYCQGY 60

Query: 60  KQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLS 119
           K+ P     SR  F E   Y ++VL+KDI F S+CEHH+ PI GK  +AY+P+  V+G+S
Sbjct: 61  KEDPAIH-LSRV-FEEVGGYDEIVLLKDIPFQSHCEHHMAPITGKAAIAYLPRDKVVGIS 118

Query: 120 KLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTV 179
           KL R+L  ++RRLQIQERLT ++A+ I  + + +GVAV+IE QH CM+ RG++  G++ V
Sbjct: 119 KLARVLHGFARRLQIQERLTAEVANCIWDNLEPEGVAVVIEAQHGCMTGRGVRTPGVSMV 178

Query: 180 TTAFTGEFSRDK 191
           T+   G F  D+
Sbjct: 179 TSKLCGCFLDDE 190


>gi|145219889|ref|YP_001130598.1| GTP cyclohydrolase I [Prosthecochloris vibrioformis DSM 265]
 gi|189045193|sp|A4SF37|GCH1_PROVI RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|145206053|gb|ABP37096.1| GTP cyclohydrolase I [Chlorobium phaeovibrioides DSM 265]
          Length = 223

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 124/189 (65%), Gaps = 3/189 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           +L    +E   E++  +L  +G+DP+REGL  TP+RV +S   L  GY+Q P  +   + 
Sbjct: 35  QLPAEIMESMSESVYTLLEGVGEDPEREGLLKTPERVARSLAFLTRGYRQDPE-EMLKKA 93

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E+  Y +MVL+KDI  FS CEHH+LP +GK H+AYIP   ++GLSKL R++EV++RR
Sbjct: 94  VFTES--YDEMVLVKDIDIFSMCEHHMLPFFGKAHVAYIPDGKIVGLSKLARVVEVFARR 151

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT QI  AI+     KGV V+IE +HMCM MRG+++    T T+A +GEF   +
Sbjct: 152 LQVQERLTQQIRDAIQDVLHPKGVGVVIEAKHMCMVMRGVEKLNSVTTTSAMSGEFISSE 211

Query: 192 GKTDFFLKM 200
                FL++
Sbjct: 212 STRGEFLRL 220


>gi|256841859|ref|ZP_05547365.1| GTP cyclohydrolase I [Parabacteroides sp. D13]
 gi|256736753|gb|EEU50081.1| GTP cyclohydrolase I [Parabacteroides sp. D13]
          Length = 196

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 86/188 (45%), Positives = 126/188 (67%), Gaps = 6/188 (3%)

Query: 21  AKEAI----RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           A+EA+    + +L  +G+D  REGL  TP+RV K+ + L  GY + P  +   R    + 
Sbjct: 11  AREALAGHYKEVLGLLGEDAGREGLLKTPERVAKAMQFLTKGYHEDP--EAVLRSAMFQE 68

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             Y+ MV++KDI FFS CEHH+LP +GK H+AYIPKK++ GLSK+ R++++++RRLQIQE
Sbjct: 69  EDYKQMVIVKDIDFFSLCEHHMLPFFGKAHVAYIPKKYITGLSKIPRVVDIFARRLQIQE 128

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+TMQI   I+ + D  GV V+IE QHMCM MRG+++    T T+ FTG F + K + +F
Sbjct: 129 RMTMQIKDCIQRTLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFFQQAKTREEF 188

Query: 197 FLKMTHNQ 204
              + HN+
Sbjct: 189 MNLIKHNR 196


>gi|113478001|ref|YP_724062.1| GTP cyclohydrolase I [Trichodesmium erythraeum IMS101]
 gi|110169049|gb|ABG53589.1| GTP cyclohydrolase [Trichodesmium erythraeum IMS101]
          Length = 212

 Score =  178 bits (451), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 93/190 (48%), Positives = 127/190 (66%), Gaps = 6/190 (3%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  E  +A+R +L  +G++PDREGL DTP RV+K+ K L +GY Q    +  +   F E 
Sbjct: 24  TEAEMVQAVRTLLIGLGENPDREGLLDTPKRVVKALKFLTSGYNQ-SLDELLNGAVFSED 82

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           +   +MVL++DI  FS CEHHILPI G+ H+AYIP   VIGLSK+ RI E+Y+RRLQ+QE
Sbjct: 83  TS--EMVLVRDIDLFSSCEHHILPIIGRAHVAYIPNGKVIGLSKIARICEMYARRLQVQE 140

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTD 195
           RLT QIA A++      GVAV++E  HMCM MRG+++ G  T T+A  G F+ D K + +
Sbjct: 141 RLTAQIADALQGLLRPLGVAVVVEATHMCMVMRGVQKTGSWTTTSAMRGVFADDVKTRQE 200

Query: 196 F--FLKMTHN 203
           F   +K +HN
Sbjct: 201 FMSLIKHSHN 210


>gi|307722060|ref|YP_003893200.1| GTP cyclohydrolase I [Sulfurimonas autotrophica DSM 16294]
 gi|306980153|gb|ADN10188.1| GTP cyclohydrolase I [Sulfurimonas autotrophica DSM 16294]
          Length = 194

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 127/179 (70%), Gaps = 4/179 (2%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKY 79
           E + A++V++  +G+DP REGL DTP RV K+Y+ ++ GYK+ P  +   +  F   +  
Sbjct: 8   EFENAVKVMMHHVGEDPQREGLIDTPSRVRKAYEFIYGGYKEDPA-EILKKALF--TTSN 64

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            +MVL+KDI F+S CEHH+LPI G++H+AYIP   V+GLSK+ R++ V++RR+QIQE+LT
Sbjct: 65  DEMVLVKDIEFYSTCEHHLLPIIGRVHVAYIPDGKVVGLSKIPRVVNVFARRMQIQEQLT 124

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
            QIA AI  +   KGV V+I+ +HMCM MRG+++   TT ++A  G F +D K +++FF
Sbjct: 125 EQIADAIMDTIAPKGVGVVIQARHMCMEMRGVEKINSTTTSSALRGLFKKDEKTRSEFF 183


>gi|158312161|ref|YP_001504669.1| GTP cyclohydrolase I [Frankia sp. EAN1pec]
 gi|158107566|gb|ABW09763.1| GTP cyclohydrolase I [Frankia sp. EAN1pec]
          Length = 257

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 125/190 (65%), Gaps = 12/190 (6%)

Query: 6   TGVFNMKLKKPTV------EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY 59
            GV   +LK+P +      E    A+R +L  IG+DPDREGL+ TPDRV ++Y+E   G 
Sbjct: 55  NGVEARRLKRPEMVRPFDHERVARAVRELLIGIGEDPDREGLRKTPDRVARAYQEAVEGL 114

Query: 60  KQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIG 117
            + P    T+ F  G    + +MVL++DI F S CEHH++   GK H+AYIP  K  + G
Sbjct: 115 GRDPAEVLTTVFDEG----HDEMVLVRDIDFSSLCEHHLVVFAGKAHVAYIPNEKGQITG 170

Query: 118 LSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLT 177
           LSKL R++++Y+RR Q+QERLT Q+A A+    D +GV V++E +H+CMSMRG+++ G T
Sbjct: 171 LSKLARLVDLYARRPQVQERLTSQVADALVDVLDPRGVMVVVEAEHLCMSMRGVRKPGAT 230

Query: 178 TVTTAFTGEF 187
           TVT+A  G+F
Sbjct: 231 TVTSAVRGQF 240


>gi|319899966|ref|YP_004159694.1| GTP cyclohydrolase I [Bacteroides helcogenes P 36-108]
 gi|319414997|gb|ADV42108.1| GTP cyclohydrolase I [Bacteroides helcogenes P 36-108]
          Length = 195

 Score =  177 bits (450), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 124/189 (65%), Gaps = 5/189 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P+++E KE    IL  +G+DP REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PSLDELKEHYHRILTLLGEDPSREGLLKTPERVAKAMLSLTKGYFMDPHEVLRSAKFQ-- 67

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 68  --EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKDCIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTHN 203
           +F   + HN
Sbjct: 186 EFMNLIRHN 194


>gi|222824464|ref|YP_002576038.1| GTP cyclohydrolase I [Campylobacter lari RM2100]
 gi|254791036|sp|B9KDZ8|GCH1_CAMLR RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|222539685|gb|ACM64786.1| GTP cyclohydrolase I [Campylobacter lari RM2100]
          Length = 190

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 128/181 (70%), Gaps = 6/181 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEAS 77
           E+ +++++ +L  IG++P REGL  TP RV K+++ L +GYKQ P    + + F     S
Sbjct: 3   EKFEQSVKNMLEIIGENPQREGLLKTPTRVFKAFEFLNSGYKQDPKQILNDALFE----S 58

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              +MVL++DI F+S CEHH+LP +G++H+AYIP K V+GLSK+ R++EV++RRLQIQE+
Sbjct: 59  SNNEMVLVRDIEFYSLCEHHLLPFFGRVHVAYIPDKKVVGLSKIPRLVEVFARRLQIQEQ 118

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR-DKGKTDF 196
           LT QIA A+     +KGV V+IE +HMC+ MRG+++   TT T+A  G F + +K + +F
Sbjct: 119 LTEQIAEALMEHVGAKGVGVVIEARHMCVEMRGVQKANSTTSTSALRGSFLKSEKTRKEF 178

Query: 197 F 197
           F
Sbjct: 179 F 179


>gi|113474764|ref|YP_720825.1| GTP cyclohydrolase [Trichodesmium erythraeum IMS101]
 gi|110165812|gb|ABG50352.1| GTP cyclohydrolase [Trichodesmium erythraeum IMS101]
          Length = 243

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 86/187 (45%), Positives = 127/187 (67%), Gaps = 5/187 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           E  KEA+R IL  + ++P+REGL +TP R  ++ + L +GY Q +    + + F  G   
Sbjct: 57  ERMKEAVRTILLSVEENPEREGLLNTPKRFAEAMQFLTSGYSQSLEEIVNGAIFDEG--- 113

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
            + +MVL++DI+FFS CEHH+LP  GK H+AYIP + V+GLSKL R++++YSRRLQ+QER
Sbjct: 114 -HNEMVLVRDINFFSLCEHHMLPFMGKAHIAYIPNQKVVGLSKLARVVDMYSRRLQVQER 172

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           L  QIA AI++  + KGVAV+IE  H+ M MRG+++ G  TVT+A  G F  D+   + +
Sbjct: 173 LNRQIAEAIQTILEPKGVAVVIEATHISMVMRGVQKPGSWTVTSAMVGLFKEDQKTREEY 232

Query: 198 LKMTHNQ 204
           L +  +Q
Sbjct: 233 LNLIRHQ 239


>gi|118443646|ref|YP_878869.1| GTP cyclohydrolase I [Clostridium novyi NT]
 gi|166220269|sp|A0Q2L7|GCH1_CLONN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|118134102|gb|ABK61146.1| GTP cyclohydrolase I [Clostridium novyi NT]
          Length = 185

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 117/174 (67%), Gaps = 4/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+ +I+  IG+DP+REGLK+TPDR+ + Y+E+F+G ++ P    +  F       
Sbjct: 5   EKIKKAVIMIIEAIGEDPNREGLKETPDRIARMYEEIFSGIRETPEKHLSKVFKVNN--- 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             D+V+ KDI F+S CEHH LP +GK+H+AYIP   V+GLSKL R  EV+S+R Q+QERL
Sbjct: 62  -DDVVVEKDIQFYSMCEHHFLPFFGKVHIAYIPNGKVVGLSKLARTTEVFSKRPQLQERL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           T QIA ++      KG  V+IE +H+CMSMRG+K+ G  T T    GEF +D  
Sbjct: 121 TSQIADSLMEYLKCKGAMVIIEAEHLCMSMRGVKKWGSKTTTIVTRGEFQKDNS 174


>gi|255534030|ref|YP_003094402.1| GTP cyclohydrolase I [Pedobacter heparinus DSM 2366]
 gi|255347014|gb|ACU06340.1| GTP cyclohydrolase I [Pedobacter heparinus DSM 2366]
          Length = 210

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 120/176 (68%), Gaps = 3/176 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+DP+REGL  TP+RV K+ + L  GY   P     S   F E   Y  MV++KD
Sbjct: 36  ILGQLGEDPNREGLIKTPERVAKALQYLTHGYDLNPAEILRSAM-FKE--DYSQMVVVKD 92

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  FS CEHH+LP +GK H+AYIP  H++GLSK+ RI++ ++RRLQ+QERLT +I   I+
Sbjct: 93  IEVFSMCEHHMLPFFGKAHIAYIPNGHIVGLSKIPRIVDAFARRLQVQERLTNEIRDCIQ 152

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHN 203
            +    GVAV+IE +H+CM+MRGI++    T T+AFTGEF++DK + +F   +T N
Sbjct: 153 DTLMPAGVAVVIECKHLCMAMRGIQKQNSVTTTSAFTGEFAKDKTRAEFLRLITAN 208


>gi|301311094|ref|ZP_07217023.1| GTP cyclohydrolase I [Bacteroides sp. 20_3]
 gi|300831157|gb|EFK61798.1| GTP cyclohydrolase I [Bacteroides sp. 20_3]
          Length = 196

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 126/188 (67%), Gaps = 6/188 (3%)

Query: 21  AKEAI----RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           A+EA+    + +L  +G+D  REGL  TP+RV K+ + L  GY + P  +   R    + 
Sbjct: 11  AREALAGHYKEVLGLLGEDAGREGLLKTPERVAKAMQFLTKGYHEDP--EAVLRSAMFQE 68

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             Y+ MV+++DI FFS CEHH+LP +GK H+AYIPKK++ GLSK+ R++++++RRLQIQE
Sbjct: 69  EDYKQMVIVRDIDFFSLCEHHMLPFFGKAHVAYIPKKYITGLSKIPRVVDIFARRLQIQE 128

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+TMQI   I+ + D  GV V+IE QHMCM MRG+++    T T+ FTG F + K + +F
Sbjct: 129 RMTMQIKDCIQRTLDPLGVMVVIEAQHMCMQMRGVEKQNSLTTTSDFTGFFQQAKTREEF 188

Query: 197 FLKMTHNQ 204
              + HN+
Sbjct: 189 MNLIKHNR 196


>gi|14253168|emb|CAC39312.1| GTP Cyclohydrolase [Streptococcus pyogenes]
          Length = 202

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+FAG  + P  + T+ F       
Sbjct: 20  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFAGLNKDPKEEFTAVF----TEH 75

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 76  HEDVVIVKDISFYSMCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 135

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  +    GV VL+E +HMCM+MRGIK+ G  T+TT   G +  D+ +
Sbjct: 136 LTAQIADALVEALHPTGVLVLVEAEHMCMTMRGIKKPGSKTITTTARGLYKEDRSE 191


>gi|294508825|ref|YP_003572884.1| GTP cyclohydrolase I [Salinibacter ruber M8]
 gi|294345154|emb|CBH25932.1| GTP cyclohydrolase I [Salinibacter ruber M8]
          Length = 218

 Score =  177 bits (448), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 120/181 (66%), Gaps = 3/181 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T E   E I  IL  +G+D DREGL DTP+RV ++Y+ L  GY   P  +D  R    E 
Sbjct: 35  TSEALSEHIEAILDILGEDADREGLADTPERVARAYQFLMHGYALDP--KDILRQALFEE 92

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y +M+L+KDI  +S CEHH+LP +GK H+AYIP   ++GLSK+ R +EV++RRLQ+QE
Sbjct: 93  A-YDEMILVKDIEVYSMCEHHMLPFYGKAHVAYIPDGQIVGLSKIPRTVEVFARRLQVQE 151

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT+QI +AI+   D  G AV+IE +H+CM MRG ++    T T++ +GEF+    + +F
Sbjct: 152 RLTLQIRNAIDEVVDPMGTAVVIEAKHLCMMMRGAEKQNSATTTSSVSGEFNNHATRDEF 211

Query: 197 F 197
            
Sbjct: 212 M 212


>gi|114566932|ref|YP_754086.1| GTP cyclohydrolase I [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114337867|gb|ABI68715.1| GTP cyclohydrolase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 192

 Score =  177 bits (448), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 130/189 (68%), Gaps = 8/189 (4%)

Query: 13  LKKPTVEEAK--EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR 70
           ++K  ++EAK  EA+ +IL  IG+DP+REGL++TP RV + Y+E+FAG    P  ++  +
Sbjct: 1   MQKKVIDEAKIEEAVHMILEAIGEDPEREGLQNTPKRVARMYREIFAGMNSNP--REFLQ 58

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             F E   + ++VL+KDI  +S CEHH+LP +GK H+AYIP+   V+G+SKL R+ E Y+
Sbjct: 59  VSFTEF--HDELVLVKDIPLYSMCEHHLLPFYGKAHVAYIPRGGKVVGISKLTRVAEAYA 116

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-S 188
            R Q+QERLT QIA  I  S    GVAV+IE +HMCM+MRG+++ G  TVT+A  G F +
Sbjct: 117 MRPQLQERLTSQIADCINDSLKPFGVAVVIEAEHMCMTMRGVRKPGALTVTSAVRGIFET 176

Query: 189 RDKGKTDFF 197
           R + + + F
Sbjct: 177 RPETRAEVF 185


>gi|146275860|ref|YP_001166020.1| GTP cyclohydrolase [Novosphingobium aromaticivorans DSM 12444]
 gi|145322551|gb|ABP64494.1| GTP cyclohydrolase [Novosphingobium aromaticivorans DSM 12444]
          Length = 192

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 120/182 (65%), Gaps = 3/182 (1%)

Query: 11  MKLKKPTV-EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           M+  KP V  E +EAI  ++RW GDDP REGL DTP RV ++++E  +GY + P    + 
Sbjct: 1   MEQGKPHVPREVEEAIATLIRWAGDDPTREGLLDTPRRVARAWRECCSGYAEDPAHHLSR 60

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
           +F   E   Y ++VL+KDI F S+CEHH+ PI GK  +AY+P++ V+G+SKL R+L  Y+
Sbjct: 61  QFE--EVGGYDEIVLLKDIPFQSHCEHHMAPIIGKAAIAYLPREKVVGISKLARVLHAYA 118

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RRLQIQERLT ++A  I  +    GVAV+IE QH CM+ RG++  G+  VT+   G F  
Sbjct: 119 RRLQIQERLTSEVAQCIWDNLRPHGVAVVIEAQHGCMTGRGVRTPGVGMVTSRMMGTFLD 178

Query: 190 DK 191
           D 
Sbjct: 179 DN 180


>gi|119356804|ref|YP_911448.1| GTP cyclohydrolase I [Chlorobium phaeobacteroides DSM 266]
 gi|119354153|gb|ABL65024.1| GTP cyclohydrolase I [Chlorobium phaeobacteroides DSM 266]
          Length = 219

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 123/177 (69%), Gaps = 3/177 (1%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+ ++L+ IG++PDREGL  TP+RV +S + L  GY+Q P  +   +  F E+  Y +MV
Sbjct: 43  AVSMLLQGIGENPDREGLLKTPERVARSMRFLTRGYRQNPE-ELLKKAVFTES--YDEMV 99

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           L++DI  FS CEHH+LP +GK H+AYIP   ++GLSK+ R++EV++RRLQ+QERLT QI 
Sbjct: 100 LVRDIDIFSMCEHHLLPFFGKAHVAYIPDGKIVGLSKIGRVVEVFARRLQVQERLTQQIR 159

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
            AI+   + KGVAV+IE +H+CM MRG+++    T T+A +GEF         FL++
Sbjct: 160 DAIQDVLNPKGVAVVIEAKHLCMVMRGVEKLNSVTTTSAMSGEFISSPSTRSEFLRL 216


>gi|84625993|ref|YP_453365.1| GTP cyclohydrolase I [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|84369933|dbj|BAE71091.1| GTP cyclohydrolase I [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 209

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 124/183 (67%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A++A+R++LRW G+DP REGL DTP RV ++Y + F+GY+  P  ++     F E 
Sbjct: 21  TQTQAEDAVRILLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRIEP--REYLERTFEEV 78

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R++E Y+RR Q+QE
Sbjct: 79  AGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRCKVVGISKLARVVESYARRFQVQE 138

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 139 KMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAE 198

Query: 197 FLK 199
           FL+
Sbjct: 199 FLQ 201


>gi|15614209|ref|NP_242512.1| GTP cyclohydrolase I [Bacillus halodurans C-125]
 gi|20138370|sp|Q9KCC7|GCH1_BACHD RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|10174263|dbj|BAB05365.1| GTP cyclohydrolase I [Bacillus halodurans C-125]
          Length = 188

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 120/173 (69%), Gaps = 5/173 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+ +IL  IG+DP REGL+DTP RV K Y+E+FAG  Q P     + F  GE   
Sbjct: 7   EKIQQAVVMILEAIGEDPAREGLEDTPKRVAKMYEEVFAGLNQDPKEHFATIF--GE--D 62

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI FFS CEHH++P +GK H+ YIPK   V GLSKL R +E  +RR Q+QER
Sbjct: 63  HEELVLVKDIPFFSMCEHHLVPFFGKAHVGYIPKGGKVTGLSKLARAVEAVARRPQLQER 122

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +T  +A A+  + +  GV V++E +HMCM+MRG+K+ G  TVT+A  G F+ D
Sbjct: 123 ITSTVADALVETLEPHGVIVVVEAEHMCMTMRGVKKPGAATVTSAVRGTFAND 175


>gi|254524514|ref|ZP_05136569.1| GTP cyclohydrolase I [Stenotrophomonas sp. SKA14]
 gi|219722105|gb|EED40630.1| GTP cyclohydrolase I [Stenotrophomonas sp. SKA14]
          Length = 203

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 121/183 (66%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T ++A++A+R++LRW G+DP REGL DTP RV ++Y + F+GY+  P       F   E 
Sbjct: 15  TQDQAEDAVRILLRWAGEDPSREGLLDTPRRVAEAYGDWFSGYRDDPRAYMERTFE--EV 72

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DI + S+CEHH+ PI G++H+ Y+P   V+G+SKL R++E Y+RR Q+QE
Sbjct: 73  AGYDELIVLRDIEYESHCEHHMAPIIGRVHVGYLPAGKVVGISKLARVVEAYARRFQVQE 132

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 133 KMTAQIAQCIQDVLQPIGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFRDDARTRAE 192

Query: 197 FLK 199
           FL+
Sbjct: 193 FLR 195


>gi|188579217|ref|YP_001916146.1| GTP cyclohydrolase I [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188523669|gb|ACD61614.1| GTP cyclohydrolase I [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 190

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 124/183 (67%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A++A+R++LRW G+DP REGL DTP RV ++Y + F+GY+  P  ++     F E 
Sbjct: 2   TQTQAEDAVRILLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRIEP--REYLERTFEEV 59

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R++E Y+RR Q+QE
Sbjct: 60  AGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRCKVVGISKLARVVESYARRFQVQE 119

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 120 KMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAE 179

Query: 197 FLK 199
           FL+
Sbjct: 180 FLQ 182


>gi|302380332|ref|ZP_07268802.1| GTP cyclohydrolase I [Finegoldia magna ACS-171-V-Col3]
 gi|302311822|gb|EFK93833.1| GTP cyclohydrolase I [Finegoldia magna ACS-171-V-Col3]
          Length = 184

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 118/172 (68%), Gaps = 4/172 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+ +I+  IG+DP+REGL +TP RV + Y+E+F+G  Q   T  +  F   +   
Sbjct: 4   EKIEQAVSMIIEAIGEDPNREGLVETPQRVARMYEEIFSGLNQDAKTHLSKSFEIVD--- 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MV+ KDI F+S CEHH+LP WGK+++AYIP K V GLSKL R ++VYS++ Q+QERL
Sbjct: 61  -DNMVIEKDIPFYSMCEHHLLPFWGKVNIAYIPNKRVAGLSKLARTVDVYSKKPQLQERL 119

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            ++IA A+    + KG  V IE +HMCM+MRG+K+ G +T+T+   G F  D
Sbjct: 120 NIEIADALMEYLNCKGCLVTIEAEHMCMNMRGVKKPGTSTMTSVARGAFEED 171


>gi|313886519|ref|ZP_07820235.1| GTP cyclohydrolase I [Porphyromonas asaccharolytica PR426713P-I]
 gi|332300327|ref|YP_004442248.1| GTP cyclohydrolase 1 [Porphyromonas asaccharolytica DSM 20707]
 gi|312924065|gb|EFR34858.1| GTP cyclohydrolase I [Porphyromonas asaccharolytica PR426713P-I]
 gi|332177390|gb|AEE13080.1| GTP cyclohydrolase 1 [Porphyromonas asaccharolytica DSM 20707]
          Length = 207

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 121/186 (65%), Gaps = 5/186 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRF 71
           L +  +E  K+ ++ +L  +G+DP REGL  TP+RV K+   L  GY++ P      + F
Sbjct: 20  LPETQLERMKDHVKELLTELGEDPTREGLLKTPERVSKALHFLTKGYQEDPLAILRAATF 79

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
                  YQ MV+++DI F+S CEHH+LP +GK+H+ YIP K++ GLSK+ RI+EV++RR
Sbjct: 80  R----EDYQQMVIVRDIDFYSLCEHHMLPFFGKVHVGYIPNKYITGLSKIPRIVEVFARR 135

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT QI   I+ +    GV V+IE QHMCM MRG+++    T T+ FTG F   K
Sbjct: 136 LQVQERLTTQIKDCIQQALSPLGVIVVIEAQHMCMQMRGVQKQNSLTTTSDFTGAFKESK 195

Query: 192 GKTDFF 197
            + +FF
Sbjct: 196 TREEFF 201


>gi|225374477|ref|ZP_03751698.1| hypothetical protein ROSEINA2194_00092 [Roseburia inulinivorans DSM
           16841]
 gi|225213715|gb|EEG96069.1| hypothetical protein ROSEINA2194_00092 [Roseburia inulinivorans DSM
           16841]
          Length = 184

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 115/170 (67%), Gaps = 4/170 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E +++IL  IG++PDREGL DTPDR+ + Y+E+F G  Q      +  FH  + +    
Sbjct: 7   QEGVKLILEGIGENPDREGLLDTPDRIARMYEEIFGGLTQTAEEPLSKTFHVKDNA---- 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL KDI+F+S CEHH +P +GK H+AYIP   V+GLSKL R +EVY++R QIQE+LT Q
Sbjct: 63  MVLEKDITFYSTCEHHFMPFYGKAHIAYIPDGKVVGLSKLARTVEVYAKRPQIQEQLTAQ 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           IA A+      +G  V++E +HMCM+MRG+K+ G  TVT    G F +D+
Sbjct: 123 IADALMEYLKPQGAMVMLEAEHMCMTMRGVKKPGSKTVTFVTRGVFEQDE 172


>gi|76363880|sp|P0C0C1|GCH1_STRPY RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|3242315|emb|CAA04237.1| GTP cyclohydrolase [Streptococcus pyogenes]
          Length = 194

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+FAG K+ P  + T+ F       
Sbjct: 12  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFAGLKKDPKEEFTAVF----TEH 67

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH +P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 68  HEDVVIVKDISFYSMCEHHQVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  +    GV VL+E +HMCM+MRGIK+ G  T+TT   G +  D+ +
Sbjct: 128 LTAQIADALVEALHPTGVLVLVEAEHMCMTMRGIKKPGSKTITTTARGLYKEDRSE 183


>gi|160890815|ref|ZP_02071818.1| hypothetical protein BACUNI_03260 [Bacteroides uniformis ATCC 8492]
 gi|270295811|ref|ZP_06202011.1| GTP cyclohydrolase I [Bacteroides sp. D20]
 gi|317479750|ref|ZP_07938872.1| GTP cyclohydrolase I [Bacteroides sp. 4_1_36]
 gi|156859814|gb|EDO53245.1| hypothetical protein BACUNI_03260 [Bacteroides uniformis ATCC 8492]
 gi|270273215|gb|EFA19077.1| GTP cyclohydrolase I [Bacteroides sp. D20]
 gi|316904120|gb|EFV25952.1| GTP cyclohydrolase I [Bacteroides sp. 4_1_36]
          Length = 195

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 81/189 (42%), Positives = 124/189 (65%), Gaps = 5/189 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P+++E KE    IL  +G+D  REGL+ TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PSLDELKEHYHRILTLLGEDAGREGLQKTPERVAKAMLSLTKGYHMDPHEVLRSAKFQ-- 67

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 68  --EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTHN 203
           +F   + HN
Sbjct: 186 EFMNLIRHN 194


>gi|169824580|ref|YP_001692191.1| GTP cyclohydrolase I [Finegoldia magna ATCC 29328]
 gi|303233707|ref|ZP_07320361.1| GTP cyclohydrolase I [Finegoldia magna BVS033A4]
 gi|229487967|sp|B0S1R1|GCH1_FINM2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|167831385|dbj|BAG08301.1| GTP cyclohydrolase I [Finegoldia magna ATCC 29328]
 gi|302495141|gb|EFL54893.1| GTP cyclohydrolase I [Finegoldia magna BVS033A4]
          Length = 184

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 118/172 (68%), Gaps = 4/172 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+ +I+  IG+DP+REGL +TP RV + Y+E+F+G  Q   T  +  F   +   
Sbjct: 4   EKIEQAVSMIIEAIGEDPNREGLLETPQRVARMYEEIFSGLNQDAKTHLSKSFEIVD--- 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MV+ KDI F+S CEHH+LP WGK+++AYIP K V GLSKL R ++VYS++ Q+QERL
Sbjct: 61  -DNMVIEKDIPFYSMCEHHLLPFWGKVNIAYIPNKRVAGLSKLARTVDVYSKKPQLQERL 119

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            ++IA A+    + KG  V IE +HMCM+MRG+K+ G +T+T+   G F  D
Sbjct: 120 NIEIADALMEYLNCKGCLVTIEAEHMCMNMRGVKKPGTSTMTSVARGAFEED 171


>gi|83815479|ref|YP_446886.1| GTP cyclohydrolase I [Salinibacter ruber DSM 13855]
 gi|83756873|gb|ABC44986.1| GTP cyclohydrolase I [Salinibacter ruber DSM 13855]
          Length = 199

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 120/181 (66%), Gaps = 3/181 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T E   E I  IL  +G+D DREGL DTP+RV ++Y+ L  GY   P  +D  R    E 
Sbjct: 16  TSEALSEHIEAILDILGEDADREGLADTPERVARAYQFLMHGYALDP--KDILRQALFEE 73

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y +M+L+KDI  +S CEHH+LP +GK H+AYIP   ++GLSK+ R +EV++RRLQ+QE
Sbjct: 74  A-YDEMILVKDIEVYSMCEHHMLPFYGKAHVAYIPDGQIVGLSKIPRTVEVFARRLQVQE 132

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT+QI +AI+   D  G AV+IE +H+CM MRG ++    T T++ +GEF+    + +F
Sbjct: 133 RLTLQIRNAIDEVVDPMGTAVVIEAKHLCMMMRGAEKQNSATTTSSVSGEFNNHATRDEF 192

Query: 197 F 197
            
Sbjct: 193 M 193


>gi|332885886|gb|EGK06130.1| GTP cyclohydrolase 1 [Dysgonomonas mossii DSM 22836]
          Length = 187

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/175 (45%), Positives = 121/175 (69%), Gaps = 3/175 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E  + ++  +G+DP+REGL  TP RV K+ + L  GY + P     ++  F E   Y+ 
Sbjct: 11  EEHYKNVISLLGEDPEREGLLMTPHRVAKAMRFLTKGYSESPEA-ILNKALFKE--DYRQ 67

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV++KDI F+S CEHH+LP WGK H+AYIP  ++ GLSK+ R+++V++RRLQ+QER+T+Q
Sbjct: 68  MVIVKDIDFYSLCEHHMLPFWGKAHVAYIPNGYITGLSKIARVVDVFARRLQVQERMTLQ 127

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           I   I+ + +  GV V+IE QHMCM MRG+++   TT T+ FTG F++ K + +F
Sbjct: 128 IKECIQQTLNPLGVMVVIEAQHMCMQMRGVEKQNSTTTTSDFTGVFNQAKTREEF 182


>gi|296283889|ref|ZP_06861887.1| GTP cyclohydrolase [Citromicrobium bathyomarinum JL354]
          Length = 202

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 87/187 (46%), Positives = 119/187 (63%), Gaps = 3/187 (1%)

Query: 15  KPTV-EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           KP V E+ + AIR ++ W GDDP REGL DTP RV +++KE   GY + P      R  F
Sbjct: 15  KPAVPEDVQAAIRTLIEWAGDDPAREGLLDTPKRVARAWKEYCVGYTEDPAVH-LGRV-F 72

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y D+VL+KDI F S+CEHH+ PI G  H+AY+P   V+G+SKL R+L  ++RRLQ
Sbjct: 73  EEVGGYNDIVLLKDIPFQSHCEHHMAPIIGVAHIAYLPTDFVVGISKLARVLHGFARRLQ 132

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           +QERLT ++A  I  +   +GVAV+IE  H CM+ RG++  G+T VT+   G F  D   
Sbjct: 133 VQERLTAEVAECIWDNLKPEGVAVVIEASHACMTARGVRTPGVTMVTSRMMGVFRDDPRS 192

Query: 194 TDFFLKM 200
            +  LK+
Sbjct: 193 REEVLKL 199


>gi|193212943|ref|YP_001998896.1| GTP cyclohydrolase I [Chlorobaculum parvum NCIB 8327]
 gi|193086420|gb|ACF11696.1| GTP cyclohydrolase I [Chlorobaculum parvum NCIB 8327]
          Length = 230

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 123/177 (69%), Gaps = 3/177 (1%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+  +L+ IG+DP+REGL  TP+RV KS + L  GY+Q P  +   +  F E+  Y +MV
Sbjct: 53  AVYSLLQGIGEDPEREGLLMTPERVAKSLRFLTKGYEQDPE-ELLMKALFTES--YDEMV 109

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           L+KDI  +S CEHH+LP +GK H+AYIP   ++GLSK+ R++EV++RRLQ+QERLT QI 
Sbjct: 110 LVKDIDLYSMCEHHMLPFFGKAHVAYIPDGKIVGLSKIPRVVEVFARRLQVQERLTQQIR 169

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
            AI++  + +GVAV+IE  HMCM MRG+++    T T+A +G+F   +     FL++
Sbjct: 170 DAIQNVLNPRGVAVVIEATHMCMVMRGVEKQNSVTTTSAMSGDFMTSQSTRSEFLRL 226


>gi|282866361|ref|ZP_06275406.1| GTP cyclohydrolase I [Streptomyces sp. ACTE]
 gi|282558757|gb|EFB64314.1| GTP cyclohydrolase I [Streptomyces sp. ACTE]
          Length = 201

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 123/183 (67%), Gaps = 13/183 (7%)

Query: 7   GVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQ 66
           GVF+ K        A+ A+R +L  +G+DPDREGL++TP RV ++YKE+FAG  Q P   
Sbjct: 14  GVFDEK-------RAEAAVRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLHQEPEDV 66

Query: 67  DTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRI 124
            T+ F  G    + +MVL+KDI  FS CEHH++P  G  H+ YIP     + GLSKL R+
Sbjct: 67  LTTTFDLG----HDEMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPATSGKITGLSKLARL 122

Query: 125 LEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFT 184
           ++VY+RR Q+QERLT Q+A ++ S  + +GV V++E +HMCMSMRGI++ G  T+T+A  
Sbjct: 123 VDVYARRPQVQERLTTQVAESLMSILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVR 182

Query: 185 GEF 187
           G+ 
Sbjct: 183 GQL 185


>gi|313683645|ref|YP_004061383.1| GTP cyclohydrolase i [Sulfuricurvum kujiense DSM 16994]
 gi|313156505|gb|ADR35183.1| GTP cyclohydrolase I [Sulfuricurvum kujiense DSM 16994]
          Length = 192

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 127/176 (72%), Gaps = 6/176 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEASKYQDM 82
           A++ ++  +G+D +REGL  TP+RV+K+Y+ +F GYK+ P +  +++ F     S   +M
Sbjct: 10  AVKTMIAHVGEDVEREGLLKTPERVLKAYEFMFGGYKEDPQSILNSAMFE----SSNDEM 65

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           VLIKDI F+S CEHH+LPI G+ H+AYIP   V+GLSK+ R+++V++RR+QIQE+LT QI
Sbjct: 66  VLIKDIEFYSTCEHHLLPIIGRAHVAYIPDGKVVGLSKIPRVVDVFARRMQIQEQLTEQI 125

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           A A+  +   KGVAV+++ +HMCM MRG+++   TT ++A  G F RD K + +FF
Sbjct: 126 ADALMHAIAPKGVAVVVQARHMCMEMRGVEKISSTTTSSALRGLFKRDEKTRMEFF 181


>gi|332293308|ref|YP_004431917.1| GTP cyclohydrolase I [Krokinobacter diaphorus 4H-3-7-5]
 gi|332171394|gb|AEE20649.1| GTP cyclohydrolase I [Krokinobacter diaphorus 4H-3-7-5]
          Length = 198

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/185 (44%), Positives = 123/185 (66%), Gaps = 3/185 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           +E K+    I++ +G+D DREG+  TP+R  K+ + L +GY+  P+        F E   
Sbjct: 15  DEIKDNFTSIIKKLGEDTDREGILKTPERAAKAMQFLTSGYEMDPSAILKGAM-FKE--D 71

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y DMV++K+I  +S CEHH+LP +GK H+AYIP  H++GLSKL RI++V+SRRLQ+QERL
Sbjct: 72  YDDMVIVKNIELYSLCEHHMLPFFGKAHIAYIPNGHIVGLSKLPRIVDVFSRRLQVQERL 131

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T  I   I S+ + KGVAV+IE  HMCM MRG+++   TT T+ F G+F + + + +F  
Sbjct: 132 THDILECINSTLNPKGVAVVIEASHMCMMMRGVQKQNSTTTTSGFRGQFEKQETRNEFLK 191

Query: 199 KMTHN 203
            ++ N
Sbjct: 192 LISSN 196


>gi|289662040|ref|ZP_06483621.1| GTP cyclohydrolase I [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 200

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 122/183 (66%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV ++Y + F+GY+  P  ++     F E 
Sbjct: 12  TQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRIEP--REYLERTFEEV 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y +M++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R++E Y+RR Q+QE
Sbjct: 70  AGYDEMIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVESYARRFQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI +  ++ VT+   G F  D      
Sbjct: 130 KMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRDVSMVTSKMLGSFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|167765291|ref|ZP_02437404.1| hypothetical protein BACSTE_03679 [Bacteroides stercoris ATCC
           43183]
 gi|167696919|gb|EDS13498.1| hypothetical protein BACSTE_03679 [Bacteroides stercoris ATCC
           43183]
          Length = 195

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 123/188 (65%), Gaps = 5/188 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P+++E KE    IL  +G+DP+REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PSLDELKEHYHHILTLLGEDPEREGLLKTPERVAKAMLALTKGYSMDPHEVLRSAKF--- 66

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
               Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 67  -KEDYNQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTH 202
           +F   + H
Sbjct: 186 EFMNLIRH 193


>gi|303237123|ref|ZP_07323693.1| GTP cyclohydrolase I [Prevotella disiens FB035-09AN]
 gi|302482510|gb|EFL45535.1| GTP cyclohydrolase I [Prevotella disiens FB035-09AN]
          Length = 197

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 119/179 (66%), Gaps = 4/179 (2%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLI 85
           R +L+ +G++PDREGL+ TP RV K+ + L  GY Q P    T       A +Y  MV++
Sbjct: 19  RYVLQLLGENPDREGLEKTPMRVAKAMQVLTRGYTQDPHKVLTDALF---AEEYNQMVIV 75

Query: 86  KDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHA 145
           KDI FFS CEHH+LP +GK H+AYIP  H+ GLSK+ R+++++S RLQ+QERLT QI   
Sbjct: 76  KDIDFFSMCEHHMLPFYGKAHVAYIPNGHITGLSKVARVVDIFSHRLQVQERLTQQIKDC 135

Query: 146 IESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQ 204
           I+ +    G  V++E +HMCM MRGI++    T T+AF+G F++ K + + F+ + H+ 
Sbjct: 136 IQDTLHPLGTMVVVEAKHMCMQMRGIEKQNSITTTSAFSGAFNQAKTREE-FMNLVHSN 193


>gi|171777624|ref|ZP_02919289.1| hypothetical protein STRINF_00124 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171283152|gb|EDT48576.1| hypothetical protein STRINF_00124 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 187

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T E+ + A+  +L  +G+DP REGL DTP RV K Y+E+F+G  + P  Q T+ F     
Sbjct: 3   TQEKLEAAVYQLLEALGEDPKREGLLDTPKRVAKMYQEMFSGLNEDPKDQFTAVF----T 58

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQ 135
             + ++VL+KDI F+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+Q
Sbjct: 59  ENHDEVVLVKDIPFYSICEHHLVPFYGKAHVAYLPSDGRVTGLSKLARAVEVASKRPQLQ 118

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           ERLT Q+A A+E +   KG+ V+IE +HMCM+MRGIK+ G  TVTT   G F  D+
Sbjct: 119 ERLTDQVATALEEALHPKGIFVMIEAEHMCMTMRGIKKPGSKTVTTVAKGIFKEDR 174


>gi|78778280|ref|YP_394595.1| GTP cyclohydrolase I [Sulfurimonas denitrificans DSM 1251]
 gi|78498820|gb|ABB45360.1| GTP cyclohydrolase [Sulfurimonas denitrificans DSM 1251]
          Length = 179

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 119/167 (71%), Gaps = 4/167 (2%)

Query: 32  IGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFF 91
           +G++PDREGL  TP RV K+Y+ +F GYK+ P     S       S   +MVL+KDI F+
Sbjct: 5   VGENPDREGLLKTPQRVKKAYEFIFGGYKEDPEEILNSALF---TSSNDEMVLLKDIEFY 61

Query: 92  SYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTD 151
           S CEHH+LPI G++H+AYIP   V+GLSK+ R++ V++RR+QIQE+LT QIA AI ++  
Sbjct: 62  STCEHHLLPIIGRVHVAYIPNGKVVGLSKIPRVVNVFARRMQIQEQLTEQIADAIMNTIK 121

Query: 152 SKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
            KGVAV+++ +HMCM MRG+++   TT ++A  G F +D K +++FF
Sbjct: 122 PKGVAVVVQARHMCMEMRGVEKINSTTTSSALRGLFKKDEKTRSEFF 168


>gi|282880101|ref|ZP_06288821.1| GTP cyclohydrolase I [Prevotella timonensis CRIS 5C-B1]
 gi|281305974|gb|EFA98014.1| GTP cyclohydrolase I [Prevotella timonensis CRIS 5C-B1]
          Length = 197

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 115/172 (66%), Gaps = 7/172 (4%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE--ASKYQDMVLI 85
           IL+ +G++PDREGL+ TP RV K+ + L  GY     TQD  R         KY  MV++
Sbjct: 21  ILQLLGENPDREGLEKTPMRVAKAMQVLTRGY-----TQDPKRVLLDALFEEKYDQMVIV 75

Query: 86  KDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHA 145
           KDI FFS CEHH+LP +GK H+AYIP  H+ GLSK+ R++++YS RLQ+QERLT Q+   
Sbjct: 76  KDIDFFSLCEHHMLPFYGKAHVAYIPHGHITGLSKVARVVDIYSHRLQVQERLTQQVKDC 135

Query: 146 IESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           I+ +    GV V+IE +HMCM MRG+++    T T+AF+G F++ K + +F 
Sbjct: 136 IQEALQPLGVMVVIEAKHMCMQMRGVEKQNSITTTSAFSGAFNQAKTREEFM 187


>gi|306836926|ref|ZP_07469879.1| GTP cyclohydrolase I [Corynebacterium accolens ATCC 49726]
 gi|304567197|gb|EFM42809.1| GTP cyclohydrolase I [Corynebacterium accolens ATCC 49726]
          Length = 202

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 122/176 (69%), Gaps = 6/176 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  +G+DPDREGL++TP RV ++Y+E+FAG  + PT       H   A  
Sbjct: 20  ERAEAAVRELLLAVGEDPDREGLRETPARVARAYREVFAGLHEDPT----EVLHKTFAED 75

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +Q++VL++DI  +S CEHH++P +G  H+ YIP K  HV GLSKL R+ ++Y++R Q+QE
Sbjct: 76  HQELVLVRDIPIYSTCEHHLVPFYGVAHIGYIPGKDGHVTGLSKLARLADMYAKRPQVQE 135

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           RLT QIA A+ +  +++ V V+IE +H+CM+MRGI++ G TT T+A  G F  +  
Sbjct: 136 RLTQQIADALVNVLEAQSVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFKNNAA 191


>gi|239942226|ref|ZP_04694163.1| GTP cyclohydrolase I [Streptomyces roseosporus NRRL 15998]
 gi|239988692|ref|ZP_04709356.1| GTP cyclohydrolase I [Streptomyces roseosporus NRRL 11379]
 gi|291445680|ref|ZP_06585070.1| GTP cyclohydrolase I [Streptomyces roseosporus NRRL 15998]
 gi|291348627|gb|EFE75531.1| GTP cyclohydrolase I [Streptomyces roseosporus NRRL 15998]
          Length = 201

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 118/169 (69%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL++TP RV ++YKE+FAG  Q P    T+ F  G    + 
Sbjct: 21  AEAAVRELLLAVGEDPDREGLRETPGRVARAYKEIFAGLYQQPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  FS CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPASTGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++ S  + +GV V++E +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TTQIAESLMSILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRGQL 185


>gi|149280548|ref|ZP_01886665.1| GTP cyclohydrolase I [Pedobacter sp. BAL39]
 gi|149228730|gb|EDM34132.1| GTP cyclohydrolase I [Pedobacter sp. BAL39]
          Length = 210

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 121/176 (68%), Gaps = 3/176 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G++P+REGL  TP+RV K+ + L  GY   P  +      F E   Y  MV++KD
Sbjct: 36  ILSKLGENPEREGLIKTPERVAKALQYLTHGYDLNPA-EILRGAMFKE--DYSQMVVVKD 92

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  FS CEHH+LP +GK H+AYIP  H++GLSK+ R+++ ++RRLQ+QERLT +I   I+
Sbjct: 93  IEVFSMCEHHMLPFFGKAHIAYIPNGHIVGLSKIPRVVDAFARRLQVQERLTNEIRDCIQ 152

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHN 203
            + +  GVAV+IE +H+CM+MRGI++    T T+AFTGEFS+DK + +F   +T N
Sbjct: 153 DTLNPVGVAVVIECKHLCMAMRGIQKQNSVTTTSAFTGEFSKDKTRAEFLRLITAN 208


>gi|15605786|ref|NP_213163.1| GTP cyclohydrolase I [Aquifex aeolicus VF5]
 gi|6016110|sp|O66603|GCH1_AQUAE RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|2982951|gb|AAC06566.1| GTP cyclohydrolase I [Aquifex aeolicus VF5]
          Length = 184

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 121/183 (66%), Gaps = 7/183 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+R+ L  IG+DPDREGLK+TP+RV + ++E           ++     F E   
Sbjct: 6   EKIKQAVRLFLEGIGEDPDREGLKETPERVARMWEEF-------ERMRNFDMKLFEEFGG 58

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y +MVL+KDI F+S CEHH+LP +GK+H+AYIP K + GLSKLVR +  ++ R Q+QERL
Sbjct: 59  YNEMVLVKDIKFYSLCEHHLLPFFGKVHIAYIPDKKISGLSKLVRTVRAFALRPQVQERL 118

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T +IA  +E   + KGV V+IE +H+CMSMRG+   G  TVT+A  G F +D    + FL
Sbjct: 119 TEEIADFLEKELEPKGVGVVIEAEHLCMSMRGVMSPGHLTVTSALRGVFLKDIKTREEFL 178

Query: 199 KMT 201
           K+ 
Sbjct: 179 KLV 181


>gi|190576442|ref|YP_001974287.1| GTP cyclohydrolase I [Stenotrophomonas maltophilia K279a]
 gi|190014364|emb|CAQ48011.1| putative GTP cyclohydrolase I [Stenotrophomonas maltophilia K279a]
          Length = 203

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 120/183 (65%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T ++A++A+R +LRW G+DP REGL DTP RV ++Y + F+GY+  P       F   E 
Sbjct: 15  TQDQAEDAVRTLLRWAGEDPSREGLLDTPRRVAEAYGDWFSGYRDDPRAYMERTFE--EV 72

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DI + S+CEHH+ PI G++H+ Y+P   V+G+SKL R++E Y+RR Q+QE
Sbjct: 73  AGYDELIVLRDIEYESHCEHHMAPIIGRVHVGYLPAGKVVGISKLARVVEAYARRFQVQE 132

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 133 KMTAQIAQCIQDVLQPIGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFRDDARTRAE 192

Query: 197 FLK 199
           FL+
Sbjct: 193 FLR 195


>gi|294625612|ref|ZP_06704236.1| GTP cyclohydrolase I [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292600087|gb|EFF44200.1| GTP cyclohydrolase I [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 200

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 122/183 (66%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV ++Y + F+GY+  P  ++     F E 
Sbjct: 12  TQTQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRDEP--REYLERTFEEV 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+ +  V+G+SKL R++E Y+RR Q+QE
Sbjct: 70  AGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLSRGKVVGISKLARVVESYARRFQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 130 KMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|115522821|ref|YP_779732.1| GTP cyclohydrolase I [Rhodopseudomonas palustris BisA53]
 gi|115516768|gb|ABJ04752.1| GTP cyclohydrolase [Rhodopseudomonas palustris BisA53]
          Length = 200

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 118/180 (65%), Gaps = 3/180 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           KP+ EE + A R ++RW GDDPDR GLK+TP R  ++++E FAGY+Q P       F   
Sbjct: 14  KPSPEEVEAAFRTLIRWAGDDPDRAGLKETPARAARAFREYFAGYEQDPLAILNKTFD-- 71

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y++MV+++ I F S+CEHH+ PI G+  +AY+P   V+GLSKL R+++ Y++RLQI
Sbjct: 72  ETGGYEEMVVLRGIPFESHCEHHLAPIIGQAWVAYVPSGRVVGLSKLARVVDAYAKRLQI 131

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T +IA A++     +GV V+I+  H CMS RG+ + G   VT+   G F RD   T
Sbjct: 132 QERMTSEIAFAVQDVLKPQGVGVVIKATHHCMSSRGVHKVGADMVTSCMLGCF-RDNALT 190


>gi|73748893|ref|YP_308132.1| GTP cyclohydrolase I [Dehalococcoides sp. CBDB1]
 gi|147669654|ref|YP_001214472.1| GTP cyclohydrolase [Dehalococcoides sp. BAV1]
 gi|289432889|ref|YP_003462762.1| GTP cyclohydrolase I [Dehalococcoides sp. GT]
 gi|123619872|sp|Q3ZYB5|GCH1_DEHSC RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|189045187|sp|A5FQD3|GCH1_DEHSB RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|73660609|emb|CAI83216.1| GTP cyclohydrolase I [Dehalococcoides sp. CBDB1]
 gi|146270602|gb|ABQ17594.1| GTP cyclohydrolase I [Dehalococcoides sp. BAV1]
 gi|288946609|gb|ADC74306.1| GTP cyclohydrolase I [Dehalococcoides sp. GT]
          Length = 189

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/185 (45%), Positives = 119/185 (64%), Gaps = 6/185 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           K++++ IL  IG+DPDREGLK+TP RV + Y ELF+G  Q P       +  G    +++
Sbjct: 8   KQSVQNILVAIGEDPDREGLKETPRRVAQMYTELFSGMNQDPAEVLRVGYELG----HRE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPK--KHVIGLSKLVRILEVYSRRLQIQERLT 139
           MV+IKDI F+S CEHH+LP  G +H+ YIP     V+G+SKL R++E+Y++R QIQER+ 
Sbjct: 64  MVIIKDIPFYSMCEHHLLPFSGVVHIGYIPNIDGRVVGISKLARVVEIYAKRPQIQERMA 123

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA AI       GVAV+IE +HMCM MRGIK+ G   +T+A  G F +       FL 
Sbjct: 124 TQIADAIMDGLKCDGVAVVIEAEHMCMVMRGIKKPGSRVITSALRGSFHKSPAARAEFLS 183

Query: 200 MTHNQ 204
           +  ++
Sbjct: 184 LIQHK 188


>gi|319790335|ref|YP_004151968.1| GTP cyclohydrolase I [Thermovibrio ammonificans HB-1]
 gi|317114837|gb|ADU97327.1| GTP cyclohydrolase I [Thermovibrio ammonificans HB-1]
          Length = 186

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 117/168 (69%), Gaps = 6/168 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  + A+R IL  IG+DPDREGL+DTP RV K Y+E+ +GY   P   +     F E  +
Sbjct: 6   ERIERAVREILLAIGEDPDREGLRDTPKRVAKMYEEVLSGYGDSP---ENHMVLFTE--R 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP-KKHVIGLSKLVRILEVYSRRLQIQER 137
           Y +M++++DI  +S CEHH+LP +GK H+AYIP    V GLSKL RI++VY++RLQ+QER
Sbjct: 61  YDEMIIVRDIPIYSMCEHHMLPFFGKAHVAYIPGNDKVTGLSKLARIVDVYAKRLQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           +T QIA AI     +KGV V++E QH+CM MRG+K+ G  TVT+A  G
Sbjct: 121 MTQQIADAIMEKLGAKGVMVVVEAQHLCMIMRGVKKPGSFTVTSAVKG 168


>gi|261417948|ref|YP_003251630.1| GTP cyclohydrolase I [Geobacillus sp. Y412MC61]
 gi|297529616|ref|YP_003670891.1| GTP cyclohydrolase I [Geobacillus sp. C56-T3]
 gi|319767240|ref|YP_004132741.1| GTP cyclohydrolase I [Geobacillus sp. Y412MC52]
 gi|261374405|gb|ACX77148.1| GTP cyclohydrolase I [Geobacillus sp. Y412MC61]
 gi|297252868|gb|ADI26314.1| GTP cyclohydrolase I [Geobacillus sp. C56-T3]
 gi|317112106|gb|ADU94598.1| GTP cyclohydrolase I [Geobacillus sp. Y412MC52]
          Length = 188

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 117/168 (69%), Gaps = 5/168 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R+IL  IG+DP+REGL DTP RV K Y E+FAG ++ P     + F    + +++++V
Sbjct: 12  AVRLILEAIGEDPNREGLVDTPKRVAKMYAEVFAGLQEDPKQHFQTVF----SEEHEELV 67

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           L+KDI F+S CEHH++P +G  H+AYIP++  V GLSKL R +E  +RR Q+QER+T  I
Sbjct: 68  LVKDIPFYSMCEHHLVPFFGAAHVAYIPREGKVTGLSKLARAVEAVARRPQLQERITATI 127

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           A +I  + +  GV V++E +HMCM+MRG+K+ G  TVTTA  G F  D
Sbjct: 128 ADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETD 175


>gi|169831394|ref|YP_001717376.1| GTP cyclohydrolase I [Candidatus Desulforudis audaxviator MP104C]
 gi|169638238|gb|ACA59744.1| GTP cyclohydrolase I [Candidatus Desulforudis audaxviator MP104C]
          Length = 186

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 124/174 (71%), Gaps = 5/174 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +E+ ++A+ +I+  IG+DP+REGL+DTP RV + Y E+F+G +  P  ++     F E  
Sbjct: 3   LEKIEQAVTMIIESIGEDPNREGLRDTPRRVARMYAEVFSGLETDP--EEVLEQFFTE-- 58

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVI-GLSKLVRILEVYSRRLQIQE 136
            +++++L+KDI  FS CEHH+LP+ GK H+AYIP++ +I GLSKL R+++ Y+RR Q+QE
Sbjct: 59  NHEELILVKDIPLFSVCEHHLLPVVGKAHVAYIPRRGLITGLSKLARVVDGYARRPQLQE 118

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLT QIA AI    +  GV V+IE +HMCM+MRG+ + G  TVT+A  G F R+
Sbjct: 119 RLTAQIADAIMKRLEPHGVLVMIEAEHMCMTMRGVNKPGAQTVTSAVRGIFERN 172


>gi|194367778|ref|YP_002030388.1| GTP cyclohydrolase I [Stenotrophomonas maltophilia R551-3]
 gi|194350582|gb|ACF53705.1| GTP cyclohydrolase I [Stenotrophomonas maltophilia R551-3]
          Length = 203

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 120/183 (65%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T ++A++A+R +LRW G+DP REGL DTP RV ++Y + F+GY+  P       F   E 
Sbjct: 15  TQDQAEDAVRTLLRWAGEDPSREGLLDTPRRVAEAYGDWFSGYRDDPRAYMERTFE--EV 72

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DI + S+CEHH+ PI G++H+ Y+P   V+G+SKL R++E Y+RR Q+QE
Sbjct: 73  AGYDELIVLRDIEYESHCEHHMAPIIGRVHVGYLPAGKVVGISKLARVVEAYARRFQVQE 132

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI + G++ VT+   G F  D      
Sbjct: 133 KMTAQIAQCIQDVLQPIGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGSFRDDARTRAE 192

Query: 197 FLK 199
           FL+
Sbjct: 193 FLR 195


>gi|251782272|ref|YP_002996574.1| GTP cyclohydrolase I [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
 gi|242390901|dbj|BAH81360.1| GTP cyclohydrolase [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
 gi|323127171|gb|ADX24468.1| GTP cyclohydrolase I [Streptococcus dysgalactiae subsp. equisimilis
           ATCC 12394]
          Length = 188

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+FAG  + P  + T+ F       
Sbjct: 6   EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFAGLNKDPKEEFTAVF----TEH 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H++Y+P    V GLSKL R +EV S+R Q+QER
Sbjct: 62  HEDVVIVKDISFYSMCEHHLVPFYGKAHISYLPSDGRVTGLSKLARAVEVASKRPQLQER 121

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  +    GV VL+E +HMCM+MRGIK+ G  T+TT   G +  D+ +
Sbjct: 122 LTAQIADALVEALHPTGVLVLVEAEHMCMTMRGIKKPGSKTITTTARGLYKEDRSE 177


>gi|255284092|ref|ZP_05348647.1| GTP cyclohydrolase I [Bryantella formatexigens DSM 14469]
 gi|255265349|gb|EET58554.1| GTP cyclohydrolase I [Bryantella formatexigens DSM 14469]
          Length = 186

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 116/182 (63%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ KE +R+IL  IG+D  REGL +TPDR+ + Y E+  G  +        RFH      
Sbjct: 6   EKIKEGVRLILEGIGEDTGREGLIETPDRIARMYTEIAGGMYEDAGKHLEKRFHVDN--- 62

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             DMV+ KDI+F+S CEHH+LP WGK H+AY+P   V+GLSK+ R + V++RRLQ+QE+L
Sbjct: 63  -NDMVMEKDITFYSMCEHHMLPFWGKAHVAYVPDGCVVGLSKIARTVNVFARRLQLQEQL 121

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T Q+A A       +GV V++E +HMCM+MRG+K+ G  TVT    G F  ++   + F 
Sbjct: 122 TAQVADAFMEHLAPQGVMVMVEAEHMCMTMRGVKKPGTKTVTVVTRGVFENNEALQNQFY 181

Query: 199 KM 200
           +M
Sbjct: 182 RM 183


>gi|292558462|gb|ADE31463.1| GTP cyclohydrolase I [Streptococcus suis GZ1]
          Length = 182

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/168 (50%), Positives = 118/168 (70%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++ I  +L  +G+DP+REGL DTP RV K Y E+F G ++ P  Q T+ F  G    
Sbjct: 5   EQIEQTIYQLLELLGEDPNREGLLDTPKRVAKMYLEMFNGLEEDPKDQFTAVFSEG---- 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F S CEHH++P +G  H+AYIP K  V GLSKL R +EV SRR Q+QER
Sbjct: 61  HEEVVLVKDIPFHSMCEHHLVPFYGIAHVAYIPSKGRVTGLSKLARAVEVASRRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT Q+AHA++ + + +GV V++E +HMCMSMRGI++ G  TVTT   G
Sbjct: 121 LTHQVAHALQDALEPEGVFVMVEAEHMCMSMRGIRKPGSKTVTTVALG 168


>gi|227502058|ref|ZP_03932107.1| GTP cyclohydrolase I [Corynebacterium accolens ATCC 49725]
 gi|227077213|gb|EEI15176.1| GTP cyclohydrolase I [Corynebacterium accolens ATCC 49725]
          Length = 202

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 122/176 (69%), Gaps = 6/176 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  +G+DPDREGL++TP RV ++Y+E+FAG  + PT       H   A  
Sbjct: 20  ERAEAAVRELLLAVGEDPDREGLRETPARVARAYREVFAGLHEDPT----EVLHKTFAED 75

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +Q++VL++DI  +S CEHH++P +G  H+ YIP K  HV GLSKL R+ ++Y++R Q+QE
Sbjct: 76  HQELVLVRDIPIYSTCEHHLVPFYGVAHIGYIPGKDGHVTGLSKLARLADMYAKRPQVQE 135

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           RLT QIA A+ +  +++ V V+IE +H+CM+MRGI++ G TT T+A  G F  +  
Sbjct: 136 RLTQQIADALVNVLEAQSVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFKNNAA 191


>gi|320010036|gb|ADW04886.1| GTP cyclohydrolase I [Streptomyces flavogriseus ATCC 33331]
          Length = 201

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 123/183 (67%), Gaps = 13/183 (7%)

Query: 7   GVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQ 66
           GVF+ K        A+ A+R +L  +G+DPDREGL++TP RV ++YKE+FAG  Q P   
Sbjct: 14  GVFDEK-------RAEAAVRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLHQEPEDV 66

Query: 67  DTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRI 124
            T+ F  G    + +MVL+KDI  FS CEHH++P  G  H+ YIP     + GLSKL R+
Sbjct: 67  LTTTFDLG----HDEMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPATTGKITGLSKLARL 122

Query: 125 LEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFT 184
           ++VY+RR Q+QERLT QIA ++ +  + +GV V++E +HMCMSMRGI++ G  T+T+A  
Sbjct: 123 VDVYARRPQVQERLTTQIAESLMAILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVR 182

Query: 185 GEF 187
           G+ 
Sbjct: 183 GQL 185


>gi|94497388|ref|ZP_01303959.1| GTP cyclohydrolase I [Sphingomonas sp. SKA58]
 gi|94423251|gb|EAT08281.1| GTP cyclohydrolase I [Sphingomonas sp. SKA58]
          Length = 201

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 120/187 (64%), Gaps = 2/187 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K+P   +  EAIR ++RW GD P+REGL +TP+RV ++++E   GY   P    +  FH 
Sbjct: 14  KEPVPADVSEAIRTLIRWTGDTPEREGLLETPERVARAWREYCRGYDDDPAYHLSRIFH- 72

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y D+VL+KDI F S+CEHH+ PI GK H+AY+P  +V+G+SKL R+L  Y+ RLQ
Sbjct: 73  -EVGGYDDIVLLKDIPFQSHCEHHMAPIVGKAHIAYLPGDYVVGISKLARVLHAYANRLQ 131

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           +QERLT ++A+ I+     +GVAV+IE  H CM+ RG++   +   T+   G F  D+  
Sbjct: 132 VQERLTSEVANCIQEHLKPQGVAVVIEATHGCMTGRGVRTPNVIMKTSRMLGVFRDDEKS 191

Query: 194 TDFFLKM 200
            +  LK+
Sbjct: 192 REEVLKL 198


>gi|157737875|ref|YP_001490559.1| GTP cyclohydrolase I [Arcobacter butzleri RM4018]
 gi|315637666|ref|ZP_07892872.1| GTP cyclohydrolase I [Arcobacter butzleri JV22]
 gi|157699729|gb|ABV67889.1| GTP cyclohydrolase I [Arcobacter butzleri RM4018]
 gi|315478120|gb|EFU68847.1| GTP cyclohydrolase I [Arcobacter butzleri JV22]
          Length = 190

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/180 (47%), Positives = 124/180 (68%), Gaps = 3/180 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           + AI+ IL +IG+D +REGL DTP RV K+++ + +GY Q P  +   +  F   S   +
Sbjct: 8   ENAIKNILTYIGEDINREGLLDTPKRVRKAFEFMCSGYNQDPK-EIIQKALF--TSTNDE 64

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV++KDI F+S+CEHH+LPI GK H+AYIP   V+GLSK+ R+++V++RRLQIQE++T Q
Sbjct: 65  MVVVKDIEFYSFCEHHMLPIIGKAHVAYIPNGKVVGLSKIPRVVDVFARRLQIQEQMTEQ 124

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           I  A+      KGVAV+I+ +HMCM MRG+++   TTVT++  G F  DK   D FL + 
Sbjct: 125 ICEALNEHLRPKGVAVMIDARHMCMEMRGVEKICSTTVTSSLRGLFKSDKKTKDEFLSIV 184


>gi|225574957|ref|ZP_03783567.1| hypothetical protein RUMHYD_03036 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037804|gb|EEG48050.1| hypothetical protein RUMHYD_03036 [Blautia hydrogenotrophica DSM
           10507]
          Length = 216

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 122/185 (65%), Gaps = 4/185 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           ++ ++A+R+ L  IG+D +REGL DTP R+ +  +E++ G  Q P      +F       
Sbjct: 36  QKVEQAVRLYLEGIGEDVNREGLLDTPSRIARMCEEIYGGLDQDPGVYLEKQFTVDS--- 92

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MV+ KDI+F+S CEHH+LP +GK H+AYIP + V GLSKL R +EVY+RR QIQE++
Sbjct: 93  -NEMVIEKDITFYSTCEHHLLPFFGKAHIAYIPNEKVTGLSKLARAVEVYARRPQIQEKM 151

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T+QIA A+E   + KGV V++E +H CM+MRGIK+ G  TVT+   GEF  +      FL
Sbjct: 152 TVQIADALEKYLNPKGVMVMLEAEHTCMTMRGIKKPGTKTVTSVTRGEFKGNYELQKMFL 211

Query: 199 KMTHN 203
           +M  +
Sbjct: 212 QMVKD 216


>gi|332296583|ref|YP_004438506.1| GTP cyclohydrolase 1 [Thermodesulfobium narugense DSM 14796]
 gi|332179686|gb|AEE15375.1| GTP cyclohydrolase 1 [Thermodesulfobium narugense DSM 14796]
          Length = 188

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 119/170 (70%), Gaps = 5/170 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K AI  IL  IG+DP+REGLKDTP+R+ + Y+E+F+G  + P +     +H      
Sbjct: 4   EKIKRAIYDILVAIGEDPNREGLKDTPERIARMYEEIFSGINEDPLSVLNVEYH----EN 59

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
             +MVLIKDI F+S CEHH++P  G+ H+AY+PK   V+GLSK+ R++++ S++ Q+QER
Sbjct: 60  TDEMVLIKDIPFYSICEHHLIPFIGRAHVAYLPKDGRVVGLSKIARVVDILSKKPQLQER 119

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           LT +IA  I    +  GVAV++E +H+CMSMRGIK+ G TTVT+A  G F
Sbjct: 120 LTSEIARTIMKGLNPLGVAVVVEAEHLCMSMRGIKKPGHTTVTSALRGAF 169


>gi|322411639|gb|EFY02547.1| GTP cyclohydrolase I [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 188

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+FAG  + P  + T+ F       
Sbjct: 6   EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFAGLNKDPKEEFTAVF----TEH 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 62  HEDVVIVKDISFYSMCEHHLVPFYGKAHIAYLPSDGCVTGLSKLARAVEVASKRPQLQER 121

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  +    GV VL+E +HMCM+MRGIK+ G  T+TT   G +  ++ +
Sbjct: 122 LTAQIADALVEALHPTGVLVLVEAEHMCMTMRGIKKPGSKTITTTARGLYKENRSE 177


>gi|154686526|ref|YP_001421687.1| GTP cyclohydrolase I [Bacillus amyloliquefaciens FZB42]
 gi|308174070|ref|YP_003920775.1| GTP cyclohydrolase I [Bacillus amyloliquefaciens DSM 7]
 gi|166218208|sp|A7Z630|GCH1_BACA2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|154352377|gb|ABS74456.1| MtrA [Bacillus amyloliquefaciens FZB42]
 gi|307606934|emb|CBI43305.1| GTP cyclohydrolase I [Bacillus amyloliquefaciens DSM 7]
 gi|328552804|gb|AEB23296.1| GTP cyclohydrolase I [Bacillus amyloliquefaciens TA208]
 gi|328912400|gb|AEB63996.1| GTP cyclohydrolase 1 [Bacillus amyloliquefaciens LL3]
          Length = 190

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 124/179 (69%), Gaps = 5/179 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +K+   E+ ++A+R IL  IG+DPDREGL DTP RV K Y E+F+G  + P  ++  +  
Sbjct: 1   MKEVNKEQIEQAVRQILEAIGEDPDREGLLDTPKRVAKMYAEVFSGLNEDP--KEHFKTV 58

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRR 131
           FGE   ++++VL+KDI+F S CEHH++P +GK H+AYIP+   V GLSKL R +E  S+R
Sbjct: 59  FGE--DHEELVLVKDIAFHSMCEHHLVPFYGKAHIAYIPRGGKVTGLSKLARAVEAVSKR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            Q+QER+T  IA +I  + D  GV V++E +HMCM+MRG+++ G  TVT+A  G F  D
Sbjct: 117 PQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGIFKDD 175


>gi|298480245|ref|ZP_06998443.1| GTP cyclohydrolase I [Bacteroides sp. D22]
 gi|295086536|emb|CBK68059.1| GTP cyclohydrolase I [Bacteroides xylanisolvens XB1A]
 gi|298273526|gb|EFI15089.1| GTP cyclohydrolase I [Bacteroides sp. D22]
          Length = 196

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/188 (42%), Positives = 122/188 (64%), Gaps = 5/188 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P +EE K   R I+  +G+D +REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PNLEELKSHYRSIITLLGEDAEREGLLKTPERVAKAMLSLTKGYHMDPHEVLRSAKFQ-- 67

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 68  --EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTH 202
           +F   + H
Sbjct: 186 EFMNLIQH 193


>gi|56420749|ref|YP_148067.1| GTP cyclohydrolase I [Geobacillus kaustophilus HTA426]
 gi|81557867|sp|Q5KXT7|GCH1_GEOKA RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|56380591|dbj|BAD76499.1| GTP cyclohydrolaseI [Geobacillus kaustophilus HTA426]
          Length = 188

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 117/168 (69%), Gaps = 5/168 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R+IL  IG+DP+REGL DTP RV K Y E+FAG ++ P     + F    + +++++V
Sbjct: 12  AVRLILEAIGEDPNREGLVDTPKRVAKMYAEVFAGLQEDPKQHFQTVF----SEEHEELV 67

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           L+KDI F+S CEHH++P +G  H+AYIP++  V GLSKL R +E  +RR Q+QER+T  I
Sbjct: 68  LVKDIPFYSMCEHHLVPFFGAAHVAYIPREGKVTGLSKLARAVEAVARRPQLQERITATI 127

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           A +I  + +  GV V++E +HMCM+MRG+K+ G  TVTTA  G F  D
Sbjct: 128 ADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGSKTVTTAVRGVFETD 175


>gi|212638932|ref|YP_002315452.1| GTP cyclohydrolase I [Anoxybacillus flavithermus WK1]
 gi|212560412|gb|ACJ33467.1| GTP cyclohydrolase I [Anoxybacillus flavithermus WK1]
          Length = 200

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 123/181 (67%), Gaps = 5/181 (2%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           ++ +  V++ ++A+R+IL  IG+DP+REGL DTP RV K Y E+F+G  + P     + F
Sbjct: 13  RMNQMNVQQIEQAVRLILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLTEDPKVHLQTVF 72

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSR 130
               +  ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R +E  +R
Sbjct: 73  ----SEDHEELVLVKDIPFYSMCEHHLVPFFGVAHVAYIPRGGKVTGLSKLARTVETVAR 128

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           R Q+QER+T  +A AI  + +  GV V++E +HMCM+MRG+K+ G  TVTTA  G  + D
Sbjct: 129 RPQLQERITATVADAIMETLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGTLATD 188

Query: 191 K 191
           +
Sbjct: 189 E 189


>gi|160883188|ref|ZP_02064191.1| hypothetical protein BACOVA_01157 [Bacteroides ovatus ATCC 8483]
 gi|237714394|ref|ZP_04544875.1| GTP cyclohydrolase I [Bacteroides sp. D1]
 gi|237719148|ref|ZP_04549629.1| GTP cyclohydrolase I [Bacteroides sp. 2_2_4]
 gi|260171924|ref|ZP_05758336.1| GTP cyclohydrolase I [Bacteroides sp. D2]
 gi|262408226|ref|ZP_06084773.1| GTP cyclohydrolase I [Bacteroides sp. 2_1_22]
 gi|294646295|ref|ZP_06723947.1| GTP cyclohydrolase I [Bacteroides ovatus SD CC 2a]
 gi|294806782|ref|ZP_06765609.1| GTP cyclohydrolase I [Bacteroides xylanisolvens SD CC 1b]
 gi|299148220|ref|ZP_07041282.1| GTP cyclohydrolase I [Bacteroides sp. 3_1_23]
 gi|315920236|ref|ZP_07916476.1| GTP cyclohydrolase I [Bacteroides sp. D2]
 gi|156111413|gb|EDO13158.1| hypothetical protein BACOVA_01157 [Bacteroides ovatus ATCC 8483]
 gi|229445558|gb|EEO51349.1| GTP cyclohydrolase I [Bacteroides sp. D1]
 gi|229451527|gb|EEO57318.1| GTP cyclohydrolase I [Bacteroides sp. 2_2_4]
 gi|262353778|gb|EEZ02871.1| GTP cyclohydrolase I [Bacteroides sp. 2_1_22]
 gi|292638376|gb|EFF56742.1| GTP cyclohydrolase I [Bacteroides ovatus SD CC 2a]
 gi|294446064|gb|EFG14704.1| GTP cyclohydrolase I [Bacteroides xylanisolvens SD CC 1b]
 gi|298512981|gb|EFI36868.1| GTP cyclohydrolase I [Bacteroides sp. 3_1_23]
 gi|313694111|gb|EFS30946.1| GTP cyclohydrolase I [Bacteroides sp. D2]
          Length = 196

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/188 (42%), Positives = 122/188 (64%), Gaps = 5/188 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P +EE K   R I+  +G+D +REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PNLEELKSHYRSIITLLGEDAEREGLLKTPERVAKAMLSLTKGYHMDPHEVLRSAKFQ-- 67

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 68  --EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTH 202
           +F   + H
Sbjct: 186 EFMNLIQH 193


>gi|182437882|ref|YP_001825601.1| GTP cyclohydrolase I [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|326778518|ref|ZP_08237783.1| GTP cyclohydrolase 1 [Streptomyces cf. griseus XylebKG-1]
 gi|229487998|sp|B1VSG4|GCH1_STRGG RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|178466398|dbj|BAG20918.1| putative GTP cyclohydrolase I [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326658851|gb|EGE43697.1| GTP cyclohydrolase 1 [Streptomyces cf. griseus XylebKG-1]
          Length = 201

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 118/169 (69%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL++TP RV ++YKE+FAG  Q P    T+ F  G    + 
Sbjct: 21  AEAAVRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLYQEPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  FS CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPATTGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++ S  + +GV V++E +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TTQIAESLMSILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRGQL 185


>gi|293368697|ref|ZP_06615303.1| GTP cyclohydrolase I [Bacteroides ovatus SD CMC 3f]
 gi|292636238|gb|EFF54724.1| GTP cyclohydrolase I [Bacteroides ovatus SD CMC 3f]
          Length = 196

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/188 (42%), Positives = 122/188 (64%), Gaps = 5/188 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P +EE K   R I+  +G+D +REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PNLEELKSHYRSIITLLGEDAEREGLLKTPERVAKAMLSLTKGYHMDPHEVLRSAKFQ-- 67

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 68  --EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTH 202
           +F   + H
Sbjct: 186 EFMNLIQH 193


>gi|311696420|gb|ADP99293.1| GTP cyclohydrolase 1 [marine bacterium HP15]
          Length = 189

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 118/181 (65%), Gaps = 5/181 (2%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVL 84
           R I+  +G+DPDREGL+DTP R  K+ + L  GY+Q +    + + F     S   +MV+
Sbjct: 13  RAIIDGLGEDPDREGLQDTPMRAAKAMQFLTCGYQQDLGDLVNNAVFE----SAMDEMVV 68

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           ++DI  +S CEHH+LP  GK H+AY+P   V+GLSK  RI+++Y+RRLQIQE LT QIA 
Sbjct: 69  VQDIELYSMCEHHMLPFIGKCHIAYLPAGKVLGLSKFARIVDMYARRLQIQENLTRQIAE 128

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQ 204
           A+ES T +KGVAV+IE QHMCM MRG+++      T+   G+F + +     FL +  N 
Sbjct: 129 AVESVTGAKGVAVVIEAQHMCMMMRGVEKQNSRMKTSMMLGQFRKSQATRTEFLTLISNN 188

Query: 205 R 205
           R
Sbjct: 189 R 189


>gi|138895792|ref|YP_001126245.1| GTP cyclohydrolase I [Geobacillus thermodenitrificans NG80-2]
 gi|134267305|gb|ABO67500.1| GTP cyclohydrolase I [Geobacillus thermodenitrificans NG80-2]
          Length = 196

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 122/183 (66%), Gaps = 5/183 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ + A+R+IL  IG+DP+REGL DTP RV K Y E+FAG ++ P     + F    + +
Sbjct: 15  EQIEYAVRLILEAIGEDPNREGLIDTPKRVAKMYAEVFAGLREDPKQHFQTVF----SEE 70

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F+S CEHH++P +G  H+AYIP++  V GLSKL R +E  +RR Q+QER
Sbjct: 71  HEELVLVKDIPFYSMCEHHLVPFFGVAHVAYIPREGKVTGLSKLARAVEAVARRPQLQER 130

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           +T  +A +I  + +  GV V++E +HMCM+MRG+K+ G  TVTTA  G F  D       
Sbjct: 131 ITATVADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETDANARSEV 190

Query: 198 LKM 200
           L +
Sbjct: 191 LSL 193


>gi|258591461|emb|CBE67762.1| GTP cyclohydrolase I [NC10 bacterium 'Dutch sediment']
          Length = 184

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 121/174 (69%), Gaps = 6/174 (3%)

Query: 25  IRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMV 83
           +R +L+ IG+DPDREGL  TP+RV + +  L +GY KQ+    + + F       Y ++V
Sbjct: 6   VRDLLKEIGEDPDREGLVKTPERVERMFAFLTSGYDKQVNNVLNEAVFQ----DNYDEIV 61

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           L+KDI FFS CEHH+LP +GK H+ Y+P   ++GLSKLVR++E+YSRRLQ+QERLT QIA
Sbjct: 62  LVKDIDFFSLCEHHLLPFFGKCHVGYLPDGRIVGLSKLVRLVEMYSRRLQVQERLTSQIA 121

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTDF 196
           +A+  +   KGVAV++E QH+CM MRG+++     VT++  G F  R + + +F
Sbjct: 122 NALLEALRPKGVAVVMEAQHLCMMMRGVEKQNSKAVTSSMHGVFRERIESRNEF 175


>gi|89894571|ref|YP_518058.1| hypothetical protein DSY1825 [Desulfitobacterium hafniense Y51]
 gi|89334019|dbj|BAE83614.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 187

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 126/175 (72%), Gaps = 5/175 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +E+ +EA+ +IL  IG+DP REGL DTP RV + Y+E+FAG  + P+     +F    + 
Sbjct: 5   LEKIEEAVTMILEAIGEDPRREGLLDTPKRVARMYQEVFAGLHEDPSQHLKVQF----SE 60

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQE 136
            +++M+++KDI  +S CEHH++P +GK H+AYIP+K  V GLSK+ R++E Y++R Q+QE
Sbjct: 61  DHEEMIIVKDIPVYSMCEHHLVPFYGKAHVAYIPRKGKVTGLSKIARVVEGYAKRPQLQE 120

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           RLT QIA ++ S  +++GV V+IE +HMCM+MRG+K+ G  T+T+A  G F  ++
Sbjct: 121 RLTGQIADSVMSMLNARGVLVVIEAEHMCMTMRGVKKPGSMTLTSAVRGIFKTNE 175


>gi|291548966|emb|CBL25228.1| GTP cyclohydrolase I [Ruminococcus torques L2-14]
          Length = 185

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 121/182 (66%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+R++L  IG+D +REGL DTPDR+ + Y+E++ G ++         F      +
Sbjct: 5   EKVEQAVRLLLEGIGEDVNREGLIDTPDRIARMYEEIYGGMEEDAGVHLMKTF----TVE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MV+ KDI+F+S CEHH+LP +GK H+AYIP   V+GLSKL R +EV++RRLQ+QE+L
Sbjct: 61  SSEMVIEKDITFYSTCEHHLLPFYGKAHIAYIPDGKVVGLSKLARTVEVFARRLQLQEQL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA A+      KG  V++E +HMCM+MRGIK+ G  TVT A  G F  D    + F 
Sbjct: 121 TGQIADALMEYMQPKGALVMVEAEHMCMTMRGIKKPGSQTVTLARRGVFETDPTLEERFF 180

Query: 199 KM 200
           +M
Sbjct: 181 RM 182


>gi|197302124|ref|ZP_03167184.1| hypothetical protein RUMLAC_00851 [Ruminococcus lactaris ATCC
           29176]
 gi|197298811|gb|EDY33351.1| hypothetical protein RUMLAC_00851 [Ruminococcus lactaris ATCC
           29176]
          Length = 185

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 123/182 (67%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+R++L  IG+D +REGL +TPDR+ + Y+E++ G ++      +  F      +
Sbjct: 5   EKIEQAVRLLLEGIGEDVNREGLLETPDRIARMYEEIYGGMEEDAGIHLSKTF----TVE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
            ++MV+ KDI+F+S CEHH+LP +GK H+AYIP   V+GLSKL R +EV++RRLQ+QE+L
Sbjct: 61  SREMVIEKDITFYSTCEHHLLPFYGKAHIAYIPDGKVVGLSKLARTVEVFARRLQLQEQL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA A+      KG  V+IE +HMCM+MRGIK+ G  TVT A  G F  D    + F 
Sbjct: 121 TGQIADALMEYMQPKGALVMIEAEHMCMTMRGIKKPGSQTVTLARRGVFETDPSLEERFF 180

Query: 199 KM 200
           +M
Sbjct: 181 RM 182


>gi|289670698|ref|ZP_06491773.1| GTP cyclohydrolase I [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 200

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 122/183 (66%), Gaps = 2/183 (1%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T  +A+EA+R +LRW G+DP REGL DTP RV ++Y + F+GY+  P  ++     F E 
Sbjct: 12  TQAQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRIEP--REYLERTFEEV 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           + Y ++++++DIS+ S+CEHH+ PI GK+H+ Y+P+  V+G+SKL R++E Y+RR Q+QE
Sbjct: 70  AGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVESYARRFQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           ++T QIA  I+      GV V++EG H CM+ RGI +  ++ VT+   G F  D      
Sbjct: 130 KMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRDVSMVTSKMLGSFREDARTRAE 189

Query: 197 FLK 199
           FL+
Sbjct: 190 FLQ 192


>gi|270308374|ref|YP_003330432.1| GTP cyclohydrolase I [Dehalococcoides sp. VS]
 gi|270154266|gb|ACZ62104.1| GTP cyclohydrolase I [Dehalococcoides sp. VS]
          Length = 189

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 119/185 (64%), Gaps = 6/185 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           K++++ +L  IG+DPDREGLK+TP RV + Y ELF+G  Q P       +  G    +++
Sbjct: 8   KQSVQNMLLAIGEDPDREGLKETPRRVAQMYAELFSGMNQDPAEVLRVGYELG----HRE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPK--KHVIGLSKLVRILEVYSRRLQIQERLT 139
           MV+IKDI F+S CEHH+LP  G +H+ YIP     V+G+SKL R++E+Y++R QIQER+ 
Sbjct: 64  MVIIKDIPFYSMCEHHLLPFSGVVHIGYIPNIDGRVVGISKLARVVEIYAKRPQIQERMA 123

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA AI       GVAV+IE +HMCM MRGIK+ G   +T+A  G F +       FL 
Sbjct: 124 TQIADAIIDGLKCDGVAVVIEAEHMCMVMRGIKKPGSRVITSALRGSFHKSPAARAEFLS 183

Query: 200 MTHNQ 204
           +  ++
Sbjct: 184 LIQHK 188


>gi|291545946|emb|CBL19054.1| GTP cyclohydrolase I [Ruminococcus sp. SR1/5]
          Length = 185

 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 119/182 (65%), Gaps = 4/182 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EAI+++L  IG+D +REGL+ TP+R+ +  +E++ G           +FH     +  +
Sbjct: 8   EEAIKLLLEGIGEDVNREGLQGTPERIARMCEEIYGGLDNEADEHLQKQFHV----ENNE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL KDI+F+S CEHH++P +GK H+AYIP   V GLSKL R ++VY+RR QIQERLT+Q
Sbjct: 64  MVLEKDITFYSMCEHHLMPFYGKAHIAYIPNGKVTGLSKLARTVDVYARRPQIQERLTVQ 123

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA A+E     KG+ V++E +H CM+MRGIK+ G  TVTT   GEF  +      FL M 
Sbjct: 124 IADALERVLAPKGIMVMLEAEHTCMTMRGIKKPGSKTVTTVTRGEFKENMELQKQFLAMV 183

Query: 202 HN 203
            +
Sbjct: 184 KD 185


>gi|85708401|ref|ZP_01039467.1| GTP cyclohydrolase I [Erythrobacter sp. NAP1]
 gi|85689935|gb|EAQ29938.1| GTP cyclohydrolase I [Erythrobacter sp. NAP1]
          Length = 207

 Score =  174 bits (442), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 87/179 (48%), Positives = 121/179 (67%), Gaps = 3/179 (1%)

Query: 13  LKKPTV-EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           L KP V E+ +EAIR ++RW GDDP REGL DTP RV +++ E  AG K+ P     SR 
Sbjct: 18  LNKPEVPEDVQEAIRTLIRWTGDDPTREGLLDTPKRVGRAWLEYCAGNKEDPAVH-LSRI 76

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   Y ++VL+KDI F S+CEHH+ PI GK H+AYIP + V+G+SKL R+L  ++ R
Sbjct: 77  -FEEVGGYDEIVLLKDIPFQSHCEHHMAPITGKAHIAYIPDQKVVGISKLARVLHGFANR 135

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           LQ+QERLT ++A  I ++ + +GVAV+IE +H CM+ RG+K   +  +T+   G F  D
Sbjct: 136 LQVQERLTAEVAECIWNNLEPRGVAVVIEAEHGCMTGRGVKVHEVEMLTSRMMGCFLED 194


>gi|32477192|ref|NP_870186.1| GTP cyclohydrolase I [Rhodopirellula baltica SH 1]
 gi|41017122|sp|Q7UJJ7|GCH1_RHOBA RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|32447743|emb|CAD77261.1| GTP cyclohydrolase I [Rhodopirellula baltica SH 1]
          Length = 229

 Score =  174 bits (442), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 113/169 (66%), Gaps = 4/169 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           + A+R IL  +G+DPDR+GL +TP+RV + Y E+FAG K  P       F    A  Y +
Sbjct: 49  ESAVREILEAVGEDPDRDGLLETPERVARMYAEMFAGLKSDPGRHLAKVF----AEDYDE 104

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL++DISF S CEHH+LP  GK H+AY+P   V+GLSKL R++E  +RR Q+QERLT  
Sbjct: 105 IVLVRDISFCSMCEHHLLPFTGKAHIAYLPSGKVVGLSKLARVVEEVARRPQVQERLTHT 164

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +A+ IE    ++GVAV++E  H CM+MRGI++ G   +T+A  G F  D
Sbjct: 165 VANLIEDRLSARGVAVVVESTHSCMTMRGIRKPGSLCLTSAMRGAFKTD 213


>gi|219669004|ref|YP_002459439.1| GTP cyclohydrolase I [Desulfitobacterium hafniense DCB-2]
 gi|219539264|gb|ACL21003.1| GTP cyclohydrolase I [Desulfitobacterium hafniense DCB-2]
          Length = 185

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 126/175 (72%), Gaps = 5/175 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +E+ +EA+ +IL  IG+DP REGL DTP RV + Y+E+FAG  + P+     +F    + 
Sbjct: 3   LEKIEEAVTMILEAIGEDPRREGLLDTPKRVARMYQEVFAGLHEDPSQHLKVQF----SE 58

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQE 136
            +++M+++KDI  +S CEHH++P +GK H+AYIP+K  V GLSK+ R++E Y++R Q+QE
Sbjct: 59  DHEEMIIVKDIPVYSMCEHHLVPFYGKAHVAYIPRKGKVTGLSKIARVVEGYAKRPQLQE 118

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           RLT QIA ++ S  +++GV V+IE +HMCM+MRG+K+ G  T+T+A  G F  ++
Sbjct: 119 RLTGQIADSVMSMLNARGVLVVIEAEHMCMTMRGVKKPGSMTLTSAVRGIFKTNE 173


>gi|120556687|ref|YP_961038.1| GTP cyclohydrolase I [Marinobacter aquaeolei VT8]
 gi|120326536|gb|ABM20851.1| GTP cyclohydrolase I [Marinobacter aquaeolei VT8]
          Length = 189

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 120/181 (66%), Gaps = 5/181 (2%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVL 84
           R I++ +G+DPDREGL++TP R  K+ + L  GY+Q +    + + F     S   +MV+
Sbjct: 13  RTIIQGLGEDPDREGLQNTPMRAAKAMQFLTRGYQQDLEELVNNAVFE----SAMDEMVV 68

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           I+DI  +S CEHH+LP  GK H+AY+P+  V+GLSK  RI+++Y+RRLQIQE LT QIA 
Sbjct: 69  IQDIELYSMCEHHMLPFIGKCHIAYLPQGKVLGLSKFARIVDMYARRLQIQENLTRQIAE 128

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQ 204
           AIES T +KGVAV+IE QHMCM MRG+++      T+   G+F + +     FL +  + 
Sbjct: 129 AIESVTQAKGVAVVIEAQHMCMMMRGVEKQNSRMKTSMMLGQFRKSQATRTEFLNLISSN 188

Query: 205 R 205
           R
Sbjct: 189 R 189


>gi|196248674|ref|ZP_03147374.1| GTP cyclohydrolase I [Geobacillus sp. G11MC16]
 gi|196211550|gb|EDY06309.1| GTP cyclohydrolase I [Geobacillus sp. G11MC16]
          Length = 219

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 122/183 (66%), Gaps = 5/183 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ + A+R+IL  IG+DP+REGL DTP RV K Y E+FAG ++ P     + F    + +
Sbjct: 38  EQIEYAVRLILEAIGEDPNREGLIDTPKRVAKMYAEVFAGLREDPKQHFQTVF----SEE 93

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F+S CEHH++P +G  H+AYIP++  V GLSKL R +E  +RR Q+QER
Sbjct: 94  HEELVLVKDIPFYSMCEHHLVPFFGVAHVAYIPREGKVTGLSKLARAVEAVARRPQLQER 153

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           +T  +A +I  + +  GV V++E +HMCM+MRG+K+ G  TVTTA  G F  D       
Sbjct: 154 ITATVADSIVEALEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETDANARSEV 213

Query: 198 LKM 200
           L +
Sbjct: 214 LSL 216


>gi|327539153|gb|EGF25782.1| GTP cyclohydrolase I [Rhodopirellula baltica WH47]
          Length = 229

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 113/169 (66%), Gaps = 4/169 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           + A+R IL  +G+DPDR+GL +TP+RV + Y E+FAG K  P       F    A  Y +
Sbjct: 49  ESAVREILEAVGEDPDRDGLLETPERVARMYAEMFAGLKSDPGRHLAKVF----AEDYDE 104

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL++DISF S CEHH+LP  GK H+AY+P   V+GLSKL R++E  +RR Q+QERLT  
Sbjct: 105 IVLVRDISFCSMCEHHLLPFTGKAHIAYLPSGKVVGLSKLARVVEEVARRPQVQERLTHT 164

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +A+ IE    ++GVAV++E  H CM+MRGI++ G   +T+A  G F  D
Sbjct: 165 VANLIEDRLSARGVAVVVESTHSCMTMRGIRKPGSLCLTSAMRGAFKTD 213


>gi|294790633|ref|ZP_06755791.1| GTP cyclohydrolase I [Scardovia inopinata F0304]
 gi|294458530|gb|EFG26883.1| GTP cyclohydrolase I [Scardovia inopinata F0304]
          Length = 211

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 117/168 (69%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  + A+R  L  IG+DPDREGLK TPDR+ ++ +ELFAG +Q P    ++RF      K
Sbjct: 26  EGVRRAVRDYLIAIGEDPDREGLKGTPDRIARASQELFAGLRQDPQDVLSARFDV----K 81

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP-KKHVIGLSKLVRILEVYSRRLQIQER 137
            +D+++++DI FFS CEHH+LP  G  H+ YIP K  V+GLSKL R+++VY+RR QIQER
Sbjct: 82  TEDLIVVRDIEFFSVCEHHLLPFHGLAHIGYIPTKDKVVGLSKLARLVQVYARRPQIQER 141

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           +T QIA A+    ++KG  V+ + +HMCMSMRG+K+    TVT+A  G
Sbjct: 142 MTQQIADALMDVLEAKGAIVITDCEHMCMSMRGVKQSQARTVTSAVRG 189


>gi|329116155|ref|ZP_08244872.1| GTP cyclohydrolase I [Streptococcus parauberis NCFD 2020]
 gi|326906560|gb|EGE53474.1| GTP cyclohydrolase I [Streptococcus parauberis NCFD 2020]
          Length = 186

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 121/176 (68%), Gaps = 5/176 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
            +E+A++AI  +L  IG++P+REGL DTP RV K Y+E+F+  +  P  Q T+ F     
Sbjct: 2   NIEKAEQAIYDLLEAIGENPNREGLLDTPKRVAKMYQEMFSELQADPKDQFTAVF----T 57

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQ 135
             ++D V++KDI F S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+Q
Sbjct: 58  ENHEDAVIVKDIYFHSMCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQ 117

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           ERLT Q+A+A+E +   KGV V++E +HMCM+MRGI++ G  T+TT   G +  D+
Sbjct: 118 ERLTAQVANALEEALHPKGVFVMLEAEHMCMTMRGIRKPGSKTITTTARGIYQTDR 173


>gi|258510971|ref|YP_003184405.1| GTP cyclohydrolase I [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257477697|gb|ACV58016.1| GTP cyclohydrolase I [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 207

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 124/170 (72%), Gaps = 5/170 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R+IL  IG+DPDREGL DTP RV + Y+E+F+G  + P  + ++RFH     ++ +
Sbjct: 27  EQAVRMILEAIGEDPDREGLVDTPARVARMYQEIFSGLHRDPQEELSARFHV----EHGE 82

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVI-GLSKLVRILEVYSRRLQIQERLTM 140
           +VL++DI F+S CEHH+LP +G  H+AY+P  +V+ GLSKL R+++V +++ Q+QER+T 
Sbjct: 83  IVLVRDIPFYSMCEHHLLPFFGTAHVAYLPHNNVVTGLSKLARLVDVVAKKPQVQERMTN 142

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +IA A+  +  ++GV V+I+ +H+CMSMRGI++ G  T T A  G++  D
Sbjct: 143 EIADALSEALQAEGVLVVIDAEHLCMSMRGIRKPGSRTTTIAARGKYDED 192


>gi|124494369|gb|ABN13260.1| GTP cyclohydrolase I [Bacillus subtilis]
          Length = 190

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 124/179 (69%), Gaps = 5/179 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +K+   E+ ++A+R IL  IG+DP+REGL DTP RV K Y E+F+G  + P  ++  +  
Sbjct: 1   MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDP--KEHFQTI 58

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRR 131
           FGE   ++++VL+KDI+F S CEHH++P +GK HLAYIP+   V GLSKL R +E  ++R
Sbjct: 59  FGE--NHEELVLVKDIAFHSMCEHHLVPFYGKAHLAYIPRGGKVTGLSKLARAVEAVAKR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            Q+QER+T  IA +I  + D  GV V++E +HMCM+MRG+++ G  TVT+A  G F  D
Sbjct: 117 PQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVFKDD 175


>gi|228477052|ref|ZP_04061690.1| GTP cyclohydrolase I [Streptococcus salivarius SK126]
 gi|312863770|ref|ZP_07724008.1| GTP cyclohydrolase I [Streptococcus vestibularis F0396]
 gi|322373446|ref|ZP_08047982.1| GTP cyclohydrolase I [Streptococcus sp. C150]
 gi|322516293|ref|ZP_08069222.1| GTP cyclohydrolase I [Streptococcus vestibularis ATCC 49124]
 gi|228251071|gb|EEK10242.1| GTP cyclohydrolase I [Streptococcus salivarius SK126]
 gi|311101306|gb|EFQ59511.1| GTP cyclohydrolase I [Streptococcus vestibularis F0396]
 gi|321278488|gb|EFX55557.1| GTP cyclohydrolase I [Streptococcus sp. C150]
 gi|322125225|gb|EFX96601.1| GTP cyclohydrolase I [Streptococcus vestibularis ATCC 49124]
          Length = 187

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 121/174 (69%), Gaps = 5/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+  +L  +G++P+REGL DTP RV K Y E+F+G  + P  Q T+ F    +  
Sbjct: 5   EKVEQAVYQLLEALGENPEREGLLDTPKRVAKMYAEMFSGLNEDPKDQFTAVF----SEV 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPK-KHVIGLSKLVRILEVYSRRLQIQER 137
           + ++VL+KDI F+S CEHH++P +GK H+AY+P    V GLSKL R +EV +RR Q+QER
Sbjct: 61  HDEVVLVKDIPFYSMCEHHLVPFYGKAHVAYLPSGDKVTGLSKLARAVEVAARRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LT Q+A A+E + + +GV V++E +HMCM+MRGIK+ G  T+TT   G +  D+
Sbjct: 121 LTDQVATALEEALNPRGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGLYKEDR 174


>gi|299144407|ref|ZP_07037487.1| GTP cyclohydrolase I [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298518892|gb|EFI42631.1| GTP cyclohydrolase I [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 187

 Score =  174 bits (442), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 81/178 (45%), Positives = 121/178 (67%), Gaps = 9/178 (5%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+ +IL  IG+DP REGL +TP RV + Y+E+F+G  Q      +  F   +     +
Sbjct: 10  EKAVTMILEAIGEDPSREGLVETPQRVARMYEEIFSGLGQTAENHLSKTFELVDG----N 65

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+ KDI+F+S CEHH+LP WGK+H+AY+P   V GLSKL R ++VY+++ Q+QERL ++
Sbjct: 66  MVIEKDITFYSMCEHHLLPFWGKVHIAYMPNGRVAGLSKLARTVDVYAKKPQLQERLNLE 125

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
           IA+AI    +++GV V++E +HMCM+MRG+KR G  TVT+      SR   +TD  L+
Sbjct: 126 IANAIMEYLNAQGVLVVVEAEHMCMNMRGVKRPGTKTVTS-----ISRGILETDLNLR 178


>gi|307266256|ref|ZP_07547797.1| GTP cyclohydrolase I [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326391796|ref|ZP_08213314.1| GTP cyclohydrolase I [Thermoanaerobacter ethanolicus JW 200]
 gi|306918706|gb|EFN48939.1| GTP cyclohydrolase I [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325992154|gb|EGD50628.1| GTP cyclohydrolase I [Thermoanaerobacter ethanolicus JW 200]
          Length = 188

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 84/188 (44%), Positives = 127/188 (67%), Gaps = 5/188 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+R IL  IG+DPDREGL +TPDRV + Y+E+FAG      T         +  +
Sbjct: 5   EKIKKAVRDILEAIGEDPDREGLLETPDRVARMYEEIFAGLH----TDVKDVIKIFQEDE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +Q+++L+KDI  +S CEHH+LP  G  H+AY+P+K  ++GLSKL RI+++ ++R Q+QER
Sbjct: 61  HQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGKILGLSKLARIVDILAKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT +IA  I  + +  GVAV+IE +H+CM+MRGIK+ G  TVT+A  G F  D+      
Sbjct: 121 LTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGIKKPGAKTVTSALRGIFRTDEKSRAEV 180

Query: 198 LKMTHNQR 205
           + + +++R
Sbjct: 181 MSLINSKR 188


>gi|228470151|ref|ZP_04055060.1| GTP cyclohydrolase I [Porphyromonas uenonis 60-3]
 gi|228308289|gb|EEK17144.1| GTP cyclohydrolase I [Porphyromonas uenonis 60-3]
          Length = 207

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 83/186 (44%), Positives = 119/186 (63%), Gaps = 5/186 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRF 71
           L +  +E  K  +  +L  +G+DP REGL  TP+RV K+   L  GY++ P      + F
Sbjct: 20  LSESQLERMKGHVNALLTELGEDPTREGLLKTPERVSKALHFLTKGYQEDPLAILRAATF 79

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
                  YQ MV+++DI F+S CEHH+LP +GK+H+ YIP K++ GLSK+ RI++V++RR
Sbjct: 80  R----EDYQQMVIVRDIDFYSLCEHHMLPFFGKVHVGYIPNKYITGLSKIPRIVDVFARR 135

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT QI   I+ +    GV V+IE QHMCM MRG+++    T T+ FTG F   K
Sbjct: 136 LQVQERLTTQIKDCIQQALSPLGVIVVIEAQHMCMQMRGVQKQNSFTTTSDFTGAFKESK 195

Query: 192 GKTDFF 197
            + +FF
Sbjct: 196 TREEFF 201


>gi|149184282|ref|ZP_01862600.1| GTP cyclohydrolase I [Erythrobacter sp. SD-21]
 gi|148831602|gb|EDL50035.1| GTP cyclohydrolase I [Erythrobacter sp. SD-21]
          Length = 203

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 115/178 (64%), Gaps = 2/178 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
           K P  E  ++AIR ++ W GDDP REGL DTP RV +++KE   GY + P      R  F
Sbjct: 15  KPPVPEHVQDAIRTLIEWTGDDPTREGLLDTPARVARAWKEYCLGYTEDPAVH-LGRV-F 72

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y ++VL+KDI F S+CEHH+ PI GK  +AY+P   V+G+SKL R+L  ++RRLQ
Sbjct: 73  EEVGGYNEIVLLKDIPFQSHCEHHMAPIHGKAAIAYLPNDRVVGISKLARVLHGFARRLQ 132

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           +QERLT ++A  I  +   +GVAV+I+ QH CM+ RG++  G+  VT+   G F  D+
Sbjct: 133 VQERLTAEVADCIWENLQPQGVAVVIDAQHACMTARGVRTPGVGMVTSRMMGTFLEDQ 190


>gi|332977212|gb|EGK14008.1| GTP cyclohydrolase 1 [Desmospora sp. 8437]
          Length = 249

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 121/173 (69%), Gaps = 5/173 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+R+IL  +G+DPDREGLK+TP RV + Y+E+F+G  + P    ++ F       
Sbjct: 66  EQIQQAVRMILEAVGEDPDREGLKETPARVARMYEEIFSGMGEDPDEYFSTVF----GED 121

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI FFS CEHH++P +GK H+ YIPK   V GLSKL R ++  +RR Q+QER
Sbjct: 122 HEELVLVKDIPFFSLCEHHLVPFFGKAHVGYIPKSGRVTGLSKLARAVDTVARRPQLQER 181

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +T  +A ++E +    GV V++E +HMCM+MRGIK+ G  TVT+A  G F ++
Sbjct: 182 ITYTVADSLERTLQPHGVIVVVEAEHMCMTMRGIKKPGSRTVTSAVRGVFEKN 234


>gi|255690501|ref|ZP_05414176.1| GTP cyclohydrolase I [Bacteroides finegoldii DSM 17565]
 gi|260623953|gb|EEX46824.1| GTP cyclohydrolase I [Bacteroides finegoldii DSM 17565]
          Length = 195

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 80/188 (42%), Positives = 122/188 (64%), Gaps = 5/188 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P +EE K   R I+  +G+D +REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PNLEELKNHYRSIITLLGEDAEREGLLKTPERVAKAMLSLTKGYHIDPHEVLRSAKF--- 66

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 67  -KEEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTH 202
           +F   + H
Sbjct: 186 EFMNLIQH 193


>gi|254457079|ref|ZP_05070507.1| GTP cyclohydrolase I [Campylobacterales bacterium GD 1]
 gi|207085871|gb|EDZ63155.1| GTP cyclohydrolase I [Campylobacterales bacterium GD 1]
          Length = 194

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 129/187 (68%), Gaps = 6/187 (3%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRF 71
           +KK    E + A++ ++  + +DP REGL +TP RV K+Y+ ++ GYK+ P    + + F
Sbjct: 1   MKKKEDIEFENAVKTMMLHVNEDPTREGLLETPGRVRKAYEFIYGGYKENPKEILEKALF 60

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
                S   +MVL+KDI F+S CEHH+LPI G++H+AYIP   V+GLSK+ R++ V++RR
Sbjct: 61  ----TSSNDEMVLLKDIEFYSTCEHHLLPIIGRVHVAYIPDGKVVGLSKIPRVVNVFARR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD- 190
           +QIQE+LT QIA AI  +   KGVAV+I+ +HMCM MRG+++   TT ++A  G F +D 
Sbjct: 117 MQIQEQLTEQIADAIMEAIAPKGVAVVIQARHMCMEMRGVEKINSTTTSSALRGLFKKDE 176

Query: 191 KGKTDFF 197
           K +++FF
Sbjct: 177 KTRSEFF 183


>gi|51892128|ref|YP_074819.1| GTP cyclohydrolase [Symbiobacterium thermophilum IAM 14863]
 gi|51855817|dbj|BAD39975.1| GTP cyclohydrolase [Symbiobacterium thermophilum IAM 14863]
          Length = 187

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 80/167 (47%), Positives = 121/167 (72%), Gaps = 5/167 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R+IL  +G+DPDREGL +TP RV   Y+E+FAG  + P  + T+ F+      +++
Sbjct: 7   EQAVRMILEAVGEDPDREGLLETPRRVADFYEEVFAGLHRDPAERLTAIFN----EDHEE 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           +V+++DISF S CEHH+LP +GK H+AYIP+   V+GLSKL R++E +SRR Q+QERLT 
Sbjct: 63  LVIVRDISFESMCEHHLLPFFGKAHVAYIPRSGRVVGLSKLARVVEDFSRRPQLQERLTA 122

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           QIA  +    +  GV V++E +HMCM+MRG+++ G +T+T+A  G F
Sbjct: 123 QIADLLMEKLNPLGVLVVVEAEHMCMTMRGVRKPGSSTITSAVRGVF 169


>gi|255011362|ref|ZP_05283488.1| GTP cyclohydrolase I [Bacteroides fragilis 3_1_12]
 gi|313149177|ref|ZP_07811370.1| GTP cyclohydrolase I [Bacteroides fragilis 3_1_12]
 gi|313137944|gb|EFR55304.1| GTP cyclohydrolase I [Bacteroides fragilis 3_1_12]
          Length = 194

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 125/192 (65%), Gaps = 5/192 (2%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSR 70
           ++  P +E+ K+  R I+  +G+D +REGL  TP+RV K+   L  GY   P     +++
Sbjct: 6   EINSPALEDLKKHYRSIITLLGEDAEREGLLKTPERVAKAMLTLTKGYHMDPHEVLRSAK 65

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
           F      +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S 
Sbjct: 66  FQ----EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSH 121

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ+QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ 
Sbjct: 122 RLQVQERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAFNQA 181

Query: 191 KGKTDFFLKMTH 202
           K + +F   + H
Sbjct: 182 KTREEFMNLIRH 193


>gi|57242494|ref|ZP_00370432.1| GTP cyclohydrolase I [Campylobacter upsaliensis RM3195]
 gi|57016779|gb|EAL53562.1| GTP cyclohydrolase I [Campylobacter upsaliensis RM3195]
          Length = 194

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 83/181 (45%), Positives = 125/181 (69%), Gaps = 6/181 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           E+ +  ++ +L  IG++P REGL  TP RV KSY+ L  GYK+ +    + + F     S
Sbjct: 7   EKFENCVKNMLELIGENPQREGLLKTPTRVFKSYEFLTNGYKKDVKEILNNALFD----S 62

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              +MVL++DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++EV++RRLQIQE+
Sbjct: 63  SNNEMVLVRDIEFYSLCEHHLLPFFGRAHIAYIPDKKVVGLSKIPRLVEVFARRLQIQEQ 122

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDF 196
           LT QIA A+  +  +KGV V++E +HMC+ MRG+++   TT T+A  G F ++ K + +F
Sbjct: 123 LTEQIAEALMQNVGAKGVGVVLEARHMCVEMRGVQKANSTTSTSALRGLFLKNEKTRREF 182

Query: 197 F 197
           F
Sbjct: 183 F 183


>gi|297588564|ref|ZP_06947207.1| GTP cyclohydrolase I [Finegoldia magna ATCC 53516]
 gi|297573937|gb|EFH92658.1| GTP cyclohydrolase I [Finegoldia magna ATCC 53516]
          Length = 189

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 79/172 (45%), Positives = 117/172 (68%), Gaps = 4/172 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+ +I+  IG+DP+REGL +TP RV + Y+E+F+G  Q      +  F   +   
Sbjct: 9   EKIEQAVSMIIEAIGEDPNREGLLETPQRVARMYEEIFSGLNQDAKVHLSKSFEIVD--- 65

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MV+ KDI F+S CEHH+LP WGK+++AYIP K V GLSKL R ++VYS++ Q+QERL
Sbjct: 66  -DNMVIEKDIPFYSMCEHHLLPFWGKVNIAYIPDKRVAGLSKLARTVDVYSKKPQLQERL 124

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            ++IA A+    + KG  V IE +HMCM+MRG+K+ G +T+T+   G F  D
Sbjct: 125 NIEIADALMEYLNCKGCLVTIEAEHMCMNMRGVKKPGTSTMTSVARGAFEED 176


>gi|254388631|ref|ZP_05003864.1| GTP cyclohydrolase I [Streptomyces clavuligerus ATCC 27064]
 gi|294813243|ref|ZP_06771886.1| GTP cyclohydrolase I [Streptomyces clavuligerus ATCC 27064]
 gi|326441647|ref|ZP_08216381.1| GTP cyclohydrolase I [Streptomyces clavuligerus ATCC 27064]
 gi|197702351|gb|EDY48163.1| GTP cyclohydrolase I [Streptomyces clavuligerus ATCC 27064]
 gi|294325842|gb|EFG07485.1| GTP cyclohydrolase I [Streptomyces clavuligerus ATCC 27064]
          Length = 201

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 82/169 (48%), Positives = 115/169 (68%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ AIR +L  +G+DPDREGL++TP RV ++Y+EL AG +Q P    T+ F  G    + 
Sbjct: 21  AENAIRELLAAVGEDPDREGLRETPARVARAYRELLAGLRQRPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI   S CEHH+LP  G  H+ YIP     + GLSKL R++EV++RR Q+QERL
Sbjct: 77  EMVLVKDIEIVSLCEHHLLPFHGVAHVGYIPADSGKITGLSKLARLVEVFARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    D++G  V+IE +HMCMS+RGI++ G  T T+A  G+ 
Sbjct: 137 TTQIADSLMRILDARGAIVVIEAEHMCMSVRGIRKPGAKTTTSAVRGQL 185


>gi|15864606|emb|CAC85372.1| GTP Cyclohydrolase [Streptococcus pyogenes]
          Length = 202

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 85/168 (50%), Positives = 115/168 (68%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+FAG  + P  + T+ F       
Sbjct: 20  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFAGLNKDPKEEFTAVF----TEH 75

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 76  HEDVVIVKDISFYSMCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 135

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+  +    GV VL+E +HMCM+MRGIK+ G  T+TT   G
Sbjct: 136 LTAQIADALVEALHPTGVLVLVEAEHMCMTMRGIKKPGSKTITTTARG 183


>gi|188996970|ref|YP_001931221.1| GTP cyclohydrolase I [Sulfurihydrogenibium sp. YO3AOP1]
 gi|229488264|sp|B2V9P4|GCH1_SULSY RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|188932037|gb|ACD66667.1| GTP cyclohydrolase I [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 187

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 122/184 (66%), Gaps = 7/184 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++AIR+ L  IG+DP+REGL+DTP RV K ++E F  Y+++  T       F E   Y +
Sbjct: 9   EQAIRLFLEGIGEDPNREGLRDTPKRVAKMWEE-FESYREMNMTI------FEEVGSYDE 61

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+++DI F+S CEHH+LP +GK H+AYIP K V GLSK+VR++  +S R Q+QERLT +
Sbjct: 62  MVVVRDIQFYSLCEHHLLPFFGKAHVAYIPDKKVCGLSKIVRVVNKFSYRPQVQERLTAE 121

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA  +E     KGVAV++E  H+CM+MRG++     TVT+  TG F   +   + FL + 
Sbjct: 122 IAEYLEKELQPKGVAVVMEAVHLCMAMRGVRNPESITVTSKLTGRFLECQKTREEFLNLI 181

Query: 202 HNQR 205
           ++ +
Sbjct: 182 NSHK 185


>gi|288905433|ref|YP_003430655.1| GTP cyclohydrolase I [Streptococcus gallolyticus UCN34]
 gi|306831514|ref|ZP_07464672.1| GTP cyclohydrolase I [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325978423|ref|YP_004288139.1| GTP cyclohydrolase II [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288732159|emb|CBI13724.1| putative GTP cyclohydrolase I [Streptococcus gallolyticus UCN34]
 gi|304426299|gb|EFM29413.1| GTP cyclohydrolase I [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325178351|emb|CBZ48395.1| folE [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
          Length = 187

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 123/183 (67%), Gaps = 5/183 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ + A+  +L  +G++P+REGL DTP RV K Y+E+F+G  + P  Q T+ F       
Sbjct: 5   EKLEAAVYQLLEALGENPEREGLLDTPKRVAKMYQEMFSGLNEDPKDQFTAVF----TEN 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           + ++VL+KDI F+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 61  HDEVVLVKDIPFYSMCEHHLVPFYGKAHVAYLPSDGRVTGLSKLARAVEVASKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT Q+A A+E +   KGV V++E +HMCM+MRGIK+ G  T+TT   G F  ++ + +  
Sbjct: 121 LTDQVATALEEALHPKGVFVMLEAEHMCMTMRGIKKPGSKTITTVAKGIFKENREERNEI 180

Query: 198 LKM 200
           L +
Sbjct: 181 LSL 183


>gi|237755856|ref|ZP_04584453.1| GTP cyclohydrolase I [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691992|gb|EEP61003.1| GTP cyclohydrolase I [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 187

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 82/184 (44%), Positives = 122/184 (66%), Gaps = 7/184 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++AI++ L  IG+DP+REGL+DTP RV K ++E F  Y+++  T       F E   Y +
Sbjct: 9   EQAIKLFLEGIGEDPNREGLRDTPKRVAKMWEE-FESYREMNMTV------FEEVGNYDE 61

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+++DI F+S CEHH+LP +GK H+AYIP K V GLSK+VR++  +S R Q+QERLT +
Sbjct: 62  MVVVRDIQFYSLCEHHLLPFFGKAHVAYIPDKKVCGLSKIVRVVNKFSYRPQVQERLTAE 121

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA  +E     KGVAV++E  H+CM+MRG++     TVT+  TG F   +   + FL + 
Sbjct: 122 IAEYLEKELQPKGVAVVMEAVHLCMAMRGVRNPEAITVTSKLTGRFLECQKTREEFLNLI 181

Query: 202 HNQR 205
           ++ +
Sbjct: 182 NSHK 185


>gi|20804346|emb|CAD31129.1| GTP cyclohydrolase [Streptococcus pyogenes]
          Length = 194

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 118/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+FAG  + P  + T+ F       
Sbjct: 12  EKAEAAIYHFLEAIGENPNREGLLDTPKRVAKMYAEMFAGLNKDPKEEFTAVF----TEH 67

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H++Y+P    V GLSKL R +EV S+R Q+QER
Sbjct: 68  HEDVVIVKDISFYSMCEHHLVPFYGKAHISYLPSDGRVTGLSKLARAVEVASKRPQLQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  +    GV  L+E +HMCM+MRGIK+ G  T+TT   G +  D+ +
Sbjct: 128 LTAQIADALVEALHPTGVLALVEAEHMCMTMRGIKKPGSKTITTTARGLYKEDRSE 183


>gi|302327206|gb|ADL26407.1| GTP cyclohydrolase I [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 188

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 115/186 (61%), Gaps = 6/186 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT--SRFHFGEASKY 79
           ++  R+IL  +G+DP+REGL DTP RV K Y EL  G       +D   +RFH     KY
Sbjct: 7   EDGFRMILEGMGEDPNREGLIDTPKRVAKMYAELMTGLSGEMKAEDILKTRFH----EKY 62

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            +M+++ DI F S CEHH LP  GK H+AYIP   V+GLSK+ R++E Y+R  QIQER+T
Sbjct: 63  DEMIIVPDIEFASMCEHHFLPFTGKAHVAYIPGDCVVGLSKIPRVVEFYARFPQIQERMT 122

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA  I+     KGVAV++E  HMCM+MRG+K+ G T VTT   G F  D+     F+ 
Sbjct: 123 RQIAELIQKVLQPKGVAVVLEASHMCMTMRGVKKPGATMVTTQLLGRFKTDEKTRAEFMS 182

Query: 200 MTHNQR 205
             +  R
Sbjct: 183 RIYAPR 188


>gi|261415908|ref|YP_003249591.1| GTP cyclohydrolase I [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|261372364|gb|ACX75109.1| GTP cyclohydrolase I [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 189

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 115/186 (61%), Gaps = 6/186 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT--SRFHFGEASKY 79
           ++  R+IL  +G+DP+REGL DTP RV K Y EL  G       +D   +RFH     KY
Sbjct: 8   EDGFRMILEGMGEDPNREGLIDTPKRVAKMYAELMTGLSGEMKAEDILKTRFH----EKY 63

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            +M+++ DI F S CEHH LP  GK H+AYIP   V+GLSK+ R++E Y+R  QIQER+T
Sbjct: 64  DEMIIVPDIEFASMCEHHFLPFTGKAHVAYIPGDCVVGLSKIPRVVEFYARFPQIQERMT 123

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA  I+     KGVAV++E  HMCM+MRG+K+ G T VTT   G F  D+     F+ 
Sbjct: 124 RQIAELIQKVLQPKGVAVVLEASHMCMTMRGVKKPGATMVTTQLLGRFKTDEKTRAEFMS 183

Query: 200 MTHNQR 205
             +  R
Sbjct: 184 RIYAPR 189


>gi|218289798|ref|ZP_03493998.1| GTP cyclohydrolase I [Alicyclobacillus acidocaldarius LAA1]
 gi|218240089|gb|EED07274.1| GTP cyclohydrolase I [Alicyclobacillus acidocaldarius LAA1]
          Length = 207

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 124/170 (72%), Gaps = 5/170 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R+IL  IG+DPDREGL DTP RV + Y+E+F+G  + P  + ++RFH     ++ +
Sbjct: 27  EQAVRMILEAIGEDPDREGLVDTPARVARMYEEIFSGLHRDPQEELSARFHV----EHGE 82

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVI-GLSKLVRILEVYSRRLQIQERLTM 140
           +VL++DI F+S CEHH+LP +G  H+AY+P  +V+ GLSKL R+++V +++ Q+QER+T 
Sbjct: 83  VVLVRDIPFYSMCEHHLLPFFGTAHVAYLPHDNVVTGLSKLARLVDVVAKKPQVQERMTN 142

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +IA A+  +  ++GV V+I+ +H+CMSMRGI++ G  T T A  G++  D
Sbjct: 143 EIADALSEALQAEGVLVVIDAEHLCMSMRGIRKPGSRTTTIAARGKYDED 192


>gi|163848192|ref|YP_001636236.1| GTP cyclohydrolase I [Chloroflexus aurantiacus J-10-fl]
 gi|222526097|ref|YP_002570568.1| GTP cyclohydrolase I [Chloroflexus sp. Y-400-fl]
 gi|163669481|gb|ABY35847.1| GTP cyclohydrolase I [Chloroflexus aurantiacus J-10-fl]
 gi|222449976|gb|ACM54242.1| GTP cyclohydrolase I [Chloroflexus sp. Y-400-fl]
          Length = 227

 Score =  174 bits (440), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 120/185 (64%), Gaps = 7/185 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+R IL  IG+ PDREGL+ TP RV K Y EL AGY   P            +  Y +
Sbjct: 43  EEAVRTILAAIGEVPDREGLQKTPSRVAKMYAELTAGYHIDPQALINGAVF---SVAYDE 99

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL+ +I ++S CEHH+LP +G++H+AYIP   V+GLSK+ RI+E+++RRLQ+QER+T+Q
Sbjct: 100 MVLVTNIDYYSLCEHHMLPFFGQVHVAYIPNGKVVGLSKIPRIVEMFARRLQVQERMTVQ 159

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFFLKM 200
           IA  I ++ +  GVAV+ EG HMC  MRG+K+     VT+A  G F  D K + +F   M
Sbjct: 160 IADFINATLEPAGVAVVAEGIHMCGVMRGVKKANARMVTSAMRGVFREDPKTRAEF---M 216

Query: 201 THNQR 205
            H  R
Sbjct: 217 AHINR 221


>gi|294501076|ref|YP_003564776.1| GTP cyclohydrolase I [Bacillus megaterium QM B1551]
 gi|295706424|ref|YP_003599499.1| GTP cyclohydrolase I [Bacillus megaterium DSM 319]
 gi|294351013|gb|ADE71342.1| GTP cyclohydrolase I [Bacillus megaterium QM B1551]
 gi|294804083|gb|ADF41149.1| GTP cyclohydrolase I [Bacillus megaterium DSM 319]
          Length = 188

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 124/179 (69%), Gaps = 8/179 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + KP +E+A   +R+IL  IG+DP+REGL DTP RV K Y+E+F+G  + P  ++  +  
Sbjct: 4   VNKPQIEQA---VRLILEAIGEDPNREGLLDTPKRVAKMYEEVFSGLNEDP--KEHFKTV 58

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRR 131
           FGE   ++++VL+KDI F+S CEHH++P +GK H+AYIPK   V GLSKL R +E  ++R
Sbjct: 59  FGE--DHEELVLVKDIPFYSMCEHHLVPFYGKAHVAYIPKGGRVTGLSKLARAVEAVAKR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            Q+QER+T  +A +I  + +  GV V++E +HMCM+MRGIK+ G  T+T+A  G    D
Sbjct: 117 PQLQERITSTVADSIVETLEPHGVMVVVEAEHMCMTMRGIKKPGAMTITSAVRGVLEHD 175


>gi|282858968|ref|ZP_06268106.1| GTP cyclohydrolase I [Prevotella bivia JCVIHMP010]
 gi|282588248|gb|EFB93415.1| GTP cyclohydrolase I [Prevotella bivia JCVIHMP010]
          Length = 197

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 118/180 (65%), Gaps = 3/180 (1%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +EE     + +L  +G+DP REGL+ TP RV K+ + L  GY Q P    T    F E  
Sbjct: 11  LEELAAHYKEVLTLLGEDPTREGLEKTPMRVAKAMQVLTRGYTQDPHKVLTDAL-FEE-- 67

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
           KY  MV++KDI FFS CEHH+LP +GK H+AYIP  H+ GLSK+ R+++++S RLQ+QER
Sbjct: 68  KYNQMVIVKDIDFFSMCEHHMLPFYGKAHVAYIPDGHITGLSKVARVIDIFSHRLQVQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QI   I+ +    GV V++E +HMCM MRG+++    T T+AF+G F++ K + +F 
Sbjct: 128 LTEQIKDCIQDTLQPLGVMVVLEAKHMCMQMRGVEKQNSITTTSAFSGAFNQAKTREEFM 187


>gi|300024226|ref|YP_003756837.1| GTP cyclohydrolase I [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526047|gb|ADJ24516.1| GTP cyclohydrolase I [Hyphomicrobium denitrificans ATCC 51888]
          Length = 197

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 87/196 (44%), Positives = 127/196 (64%), Gaps = 9/196 (4%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT--QDTSRF 71
           KKPT  E + A+R ILRW GDDP R+GL +TP RV+++Y+E F GY   P    Q T   
Sbjct: 5   KKPTRAEVEAAVRTILRWSGDDPSRDGLLETPARVVRAYEEYFRGYNDDPKAILQKT--- 61

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   Y +M++++ I F S+CEHH+ PI G+  +AYIP+  V+G+SKL R ++ +++R
Sbjct: 62  -FEEIEGYDEMIVLRGIRFESHCEHHMAPIIGRAWVAYIPRGRVVGISKLARAVDAFAKR 120

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T QIA+ I+   D +GVAV+++ +H CM+ RG  + G   VT+   G F RD 
Sbjct: 121 LQIQEKMTAQIANTIQEVLDPEGVAVVLKAEHHCMTTRGAHKPGTDMVTSRMLGVF-RDN 179

Query: 192 GKT--DFFLKMTHNQR 205
             T  +F   +T +QR
Sbjct: 180 PITRQEFLALVTEDQR 195


>gi|89099135|ref|ZP_01172014.1| GTP cyclohydrolase I [Bacillus sp. NRRL B-14911]
 gi|89086265|gb|EAR65387.1| GTP cyclohydrolase I [Bacillus sp. NRRL B-14911]
          Length = 188

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 119/170 (70%), Gaps = 5/170 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+R IL  IG+DP+REGL DTP RV K Y+E+F G  Q P  ++     FGE  ++++
Sbjct: 10  EEAVRSILEAIGEDPNREGLLDTPKRVAKMYEEVFMGIGQDP--EEYFETIFGE--EHEE 65

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           +VL+KDI F+S CEHH++P +GK H+AYIP+   V GLSKL R +E  ++R Q+QER+T 
Sbjct: 66  LVLVKDIPFYSMCEHHLVPFFGKAHVAYIPRNGRVTGLSKLARAVEAVAKRPQLQERITS 125

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            +A+AI    +  GV V++E +HMCM+MRG+K+ G  TVT+A  G  + D
Sbjct: 126 TVANAIMKKLEPHGVMVIVEAEHMCMTMRGVKKPGSKTVTSAVRGVLAED 175


>gi|86742990|ref|YP_483390.1| GTP cyclohydrolase [Frankia sp. CcI3]
 gi|86569852|gb|ABD13661.1| GTP cyclohydrolase I [Frankia sp. CcI3]
          Length = 217

 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 84/166 (50%), Positives = 117/166 (70%), Gaps = 6/166 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R +L  IG+DPDREGL+ TPDRV ++Y+E   G  + P+   T+ F  G    + +MV
Sbjct: 40  AVRELLIGIGEDPDREGLRKTPDRVARAYREAVEGLGRDPSEVLTTVFDEG----HDEMV 95

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           L++DI F S CEHH++   GK H+AYIP  K  + GLSKL R++++YSRR Q+QERLT Q
Sbjct: 96  LVRDIDFSSLCEHHLVVFSGKAHVAYIPNSKGQITGLSKLARLVDLYSRRPQVQERLTSQ 155

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           IA A+    D +GV V+IE +H+CMSMRG+++ G TTVT+A  G+F
Sbjct: 156 IADALVEVLDPRGVMVVIEAEHLCMSMRGVRKPGATTVTSAVRGQF 201


>gi|289642582|ref|ZP_06474724.1| GTP cyclohydrolase I [Frankia symbiont of Datisca glomerata]
 gi|289507577|gb|EFD28534.1| GTP cyclohydrolase I [Frankia symbiont of Datisca glomerata]
          Length = 224

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 124/180 (68%), Gaps = 10/180 (5%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E    A+R +L  IG+DPDREGL+ TP+RV ++Y+E   G  + P+   T+ F  G    
Sbjct: 41  ERVARAVRELLIGIGEDPDREGLRKTPERVARAYREAVEGLGRDPSEVLTTVFDEG---- 96

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +++MVL++DI F S CEHH++   GK H+AYIP +   + GLSKL R++++YSRR Q+QE
Sbjct: 97  HEEMVLVRDIDFTSLCEHHLVAFAGKAHVAYIPNESGQITGLSKLARLVDLYSRRPQVQE 156

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF----SRDKG 192
           RLT QIA A+E +   +GV V++E +H+CMSMRG+++ G  T+T+A  G+F    +R++G
Sbjct: 157 RLTTQIADALEQALSPRGVMVVVEAEHLCMSMRGVRKPGARTMTSAVRGQFLSTATRNEG 216


>gi|325262547|ref|ZP_08129284.1| GTP cyclohydrolase I [Clostridium sp. D5]
 gi|324032379|gb|EGB93657.1| GTP cyclohydrolase I [Clostridium sp. D5]
          Length = 184

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 120/182 (65%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+R++L  IG+D  REGLK+TPDR+ + Y E++ G  +         FH      
Sbjct: 5   EKIKQAVRLLLEGIGEDTGREGLKETPDRIARMYGEIYGGTDEDAAVHLKKTFHVDN--- 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             ++V+ KDI+F+S CEHH+LP +GK H+AYIP   V+GLSKL R +EV++RRLQ+QE+L
Sbjct: 62  -NEIVVEKDITFYSTCEHHLLPFYGKAHIAYIPDGKVVGLSKLARTVEVFARRLQLQEQL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA A+      +GV V+IE +HMCM+MRGIK+ G  T+T    G F  +   T+ F 
Sbjct: 121 TGQIADALMEHLKPRGVLVMIEAEHMCMTMRGIKKPGSQTMTIVKRGAFLDNPELTNLFF 180

Query: 199 KM 200
           ++
Sbjct: 181 QI 182


>gi|325269385|ref|ZP_08136002.1| GTP cyclohydrolase I [Prevotella multiformis DSM 16608]
 gi|325855021|ref|ZP_08171737.1| GTP cyclohydrolase I [Prevotella denticola CRIS 18C-A]
 gi|324988306|gb|EGC20272.1| GTP cyclohydrolase I [Prevotella multiformis DSM 16608]
 gi|325483999|gb|EGC86939.1| GTP cyclohydrolase I [Prevotella denticola CRIS 18C-A]
          Length = 197

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 117/180 (65%), Gaps = 3/180 (1%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           ++E     R +L  +G++P+REGL+ TP RV K+ + L  GY Q P    T    F E  
Sbjct: 11  LDELAAHYRKVLTLLGENPEREGLEKTPMRVAKAMQVLTRGYTQDPHKVLTDAL-FEE-- 67

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
           KY  MV++KDI FFS CEHH+LP +GK H+AYIP  H+ GLSK+ R++++Y+ RLQ+QER
Sbjct: 68  KYNQMVIVKDIDFFSMCEHHMLPFYGKAHVAYIPNGHITGLSKIARVVDIYAHRLQVQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT Q+   I  +   +GV V++E +HMCM MRG+++    T T+A++G F   K + +F 
Sbjct: 128 LTEQVMQCINDTLKPQGVMVVVEAKHMCMQMRGVEKQNSITTTSAYSGVFGSSKTRNEFM 187


>gi|239929768|ref|ZP_04686721.1| GTP cyclohydrolase I [Streptomyces ghanaensis ATCC 14672]
 gi|291438094|ref|ZP_06577484.1| GTP cyclohydrolase I [Streptomyces ghanaensis ATCC 14672]
 gi|291340989|gb|EFE67945.1| GTP cyclohydrolase I [Streptomyces ghanaensis ATCC 14672]
          Length = 202

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 117/169 (69%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  IG+DPDREGL +TP RV ++Y+EL AG +Q P    T+ F  G    + 
Sbjct: 22  AENAVRELLIAIGEDPDREGLLETPARVARAYRELLAGLRQEPEDVLTTTFDLG----HD 77

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI   S CEHH+LP  G  H+ YIP +   + GLSKL R++EV++RRLQ+QERL
Sbjct: 78  EMVLVKDIEIVSLCEHHMLPFHGVAHVGYIPAETGKITGLSKLARLVEVFARRLQVQERL 137

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T Q+A ++    +++GV V+IE +HMCMS+RG+++ G  T T+A  G+ 
Sbjct: 138 TTQVADSLMRILEARGVIVVIEAEHMCMSVRGVRKPGAKTTTSAVRGQL 186


>gi|304384070|ref|ZP_07366524.1| GTP cyclohydrolase I [Prevotella marshii DSM 16973]
 gi|304334786|gb|EFM01062.1| GTP cyclohydrolase I [Prevotella marshii DSM 16973]
          Length = 203

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 119/180 (66%), Gaps = 3/180 (1%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           ++E     R IL  +G+DP REGL+ TP RV K+ + L  GY+Q P+   T    F E+ 
Sbjct: 17  LDELSSHYRRILELLGEDPQREGLEKTPMRVAKAMQVLTRGYRQDPSKVLTDAL-FEES- 74

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
            Y  MV++KDI FFS CEHHILP +GK+H+AYIP   + GLSK+ R++++ S RLQ+QER
Sbjct: 75  -YNQMVIVKDIDFFSLCEHHILPFYGKVHVAYIPNGKITGLSKIARVVDIISHRLQVQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           +T QI   I+++    GV V++E +HMCM MRG+++    T T+ F+G F++ K + +F 
Sbjct: 134 MTQQIKDCIQNTLKPLGVMVIVEAKHMCMQMRGVEKQNSITTTSDFSGAFNQAKTREEFM 193


>gi|262375975|ref|ZP_06069206.1| GTP cyclohydrolase I [Acinetobacter lwoffii SH145]
 gi|262309069|gb|EEY90201.1| GTP cyclohydrolase I [Acinetobacter lwoffii SH145]
          Length = 184

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/171 (48%), Positives = 117/171 (68%), Gaps = 3/171 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+D +R GLKDTP R  K++  L +GY Q    + T++  F   S  ++MVL+K+
Sbjct: 10  ILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSQT-LEEVTNKAVF--PSDNREMVLVKN 66

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I F+S CEHH+LP +G++H+AY+P+ HV+GLSK  RI E+++RRLQIQE LT QIA A+ 
Sbjct: 67  IEFYSLCEHHLLPFYGRVHIAYLPEGHVLGLSKFARITEMFARRLQIQENLTQQIAEAVA 126

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
             T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 127 EVTKARGVAVMIDSAHMCMMMRGVGKQESTTRTVSFIGDFKTDKETRREFL 177


>gi|227834065|ref|YP_002835772.1| GTP cyclohydrolase I [Corynebacterium aurimucosum ATCC 700975]
 gi|262183449|ref|ZP_06042870.1| GTP cyclohydrolase I [Corynebacterium aurimucosum ATCC 700975]
 gi|254791040|sp|C3PJE8|GCH1_CORA7 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|227455081|gb|ACP33834.1| GTP cyclohydrolase I [Corynebacterium aurimucosum ATCC 700975]
          Length = 196

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/177 (45%), Positives = 120/177 (67%), Gaps = 6/177 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  +G+DPDREGL++TP RV ++Y E+FAG  Q PT       H   A +
Sbjct: 14  ERAEAAVRELLIAVGEDPDREGLRETPARVARAYAEVFAGLHQDPT----EVLHKTFAEE 69

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILEVYSRRLQIQE 136
           +Q++VL++DI  +S CEHH++P +G  H+ YIP    HV GLSKL R+ ++Y++R Q+QE
Sbjct: 70  HQELVLVRDIPIYSTCEHHLVPFYGTAHIGYIPGTDGHVTGLSKLARLADMYAKRPQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           RLT QIA A+     ++ V V+IE +H+CM+MRGI++ G TT T+A  G F ++   
Sbjct: 130 RLTSQIADALVEVLHAQSVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFKKNAAS 186


>gi|16079335|ref|NP_390159.1| GTP cyclohydrolase I [Bacillus subtilis subsp. subtilis str. 168]
 gi|221310194|ref|ZP_03592041.1| GTP cyclohydrolase I [Bacillus subtilis subsp. subtilis str. 168]
 gi|221314517|ref|ZP_03596322.1| GTP cyclohydrolase I [Bacillus subtilis subsp. subtilis str. NCIB
           3610]
 gi|221319439|ref|ZP_03600733.1| GTP cyclohydrolase I [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221323715|ref|ZP_03605009.1| GTP cyclohydrolase I [Bacillus subtilis subsp. subtilis str. SMY]
 gi|296332984|ref|ZP_06875441.1| GTP cyclohydrolase I [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305674912|ref|YP_003866584.1| GTP cyclohydrolase I [Bacillus subtilis subsp. spizizenii str. W23]
 gi|321311748|ref|YP_004204035.1| GTP cyclohydrolase I [Bacillus subtilis BSn5]
 gi|127481|sp|P19465|GCH1_BACSU RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|143231|gb|AAA22615.1| regulatory protein [Bacillus subtilis]
 gi|143799|gb|AAA20852.1| MtrA [Bacillus subtilis]
 gi|2634696|emb|CAB14194.1| GTP cyclohydrolase I [Bacillus subtilis subsp. subtilis str. 168]
 gi|124494289|gb|ABN13184.1| GTP cyclohydrolase I [Bacillus subtilis subsp. subtilis str. 168]
 gi|124494309|gb|ABN13203.1| GTP cyclohydrolase I [Bacillus subtilis]
 gi|124494329|gb|ABN13222.1| GTP cyclohydrolase I [Bacillus subtilis]
 gi|124494349|gb|ABN13241.1| GTP cyclohydrolase I [Bacillus subtilis subsp. spizizenii str. W23]
 gi|124494389|gb|ABN13279.1| GTP cyclohydrolase I [Bacillus subtilis]
 gi|124494409|gb|ABN13298.1| GTP cyclohydrolase I [Bacillus subtilis]
 gi|124494428|gb|ABN13316.1| GTP cyclohydrolase I [Bacillus subtilis]
 gi|124494449|gb|ABN13336.1| GTP cyclohydrolase I [Bacillus subtilis subsp. subtilis str. SMY]
 gi|124494469|gb|ABN13355.1| GTP cyclohydrolase I [Bacillus subtilis]
 gi|124494489|gb|ABN13374.1| GTP cyclohydrolase I [Bacillus subtilis]
 gi|124494509|gb|ABN13393.1| GTP cyclohydrolase I [Bacillus subtilis]
 gi|124494529|gb|ABN13412.1| GTP cyclohydrolase I [Bacillus subtilis]
 gi|291484702|dbj|BAI85777.1| GTP cyclohydrolase I [Bacillus subtilis subsp. natto BEST195]
 gi|296149835|gb|EFG90727.1| GTP cyclohydrolase I [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413156|gb|ADM38275.1| GTP cyclohydrolase I [Bacillus subtilis subsp. spizizenii str. W23]
 gi|320018022|gb|ADV93008.1| GTP cyclohydrolase I [Bacillus subtilis BSn5]
          Length = 190

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 124/179 (69%), Gaps = 5/179 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +K+   E+ ++A+R IL  IG+DP+REGL DTP RV K Y E+F+G  + P  ++  +  
Sbjct: 1   MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDP--KEHFQTI 58

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRR 131
           FGE   ++++VL+KDI+F S CEHH++P +GK H+AYIP+   V GLSKL R +E  ++R
Sbjct: 59  FGE--NHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLSKLARAVEAVAKR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            Q+QER+T  IA +I  + D  GV V++E +HMCM+MRG+++ G  TVT+A  G F  D
Sbjct: 117 PQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVFKDD 175


>gi|260592676|ref|ZP_05858134.1| GTP cyclohydrolase I [Prevotella veroralis F0319]
 gi|260535446|gb|EEX18063.1| GTP cyclohydrolase I [Prevotella veroralis F0319]
          Length = 197

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/170 (47%), Positives = 113/170 (66%), Gaps = 3/170 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL+ +G++P+REGL+ TP RV K+ + L  GY Q P    T    F E  KY  MV++KD
Sbjct: 21  ILKLLGENPEREGLEKTPMRVAKAMQVLTRGYTQDPHKVLTDAL-FEE--KYNQMVIVKD 77

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I FFS CEHHILP +GK H+AYIP   + GLSK+ R++++YS RLQ+QERLT Q+   I 
Sbjct: 78  IDFFSMCEHHILPFYGKAHVAYIPNGKITGLSKIARVVDIYSHRLQVQERLTEQVMQCIN 137

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
            +   +GV V+IE +HMCM MRG+++    T T+A++G F   K + +F 
Sbjct: 138 DTLKPQGVMVVIEAKHMCMQMRGVEKQNSITTTSAYSGVFESSKTRNEFM 187


>gi|53715238|ref|YP_101230.1| GTP cyclohydrolase I [Bacteroides fragilis YCH46]
 gi|60683172|ref|YP_213316.1| GTP cyclohydrolase I [Bacteroides fragilis NCTC 9343]
 gi|253566370|ref|ZP_04843824.1| GTP cyclohydrolase I [Bacteroides sp. 3_2_5]
 gi|265767068|ref|ZP_06094897.1| GTP cyclohydrolase I [Bacteroides sp. 2_1_16]
 gi|81313775|sp|Q5L925|GCH1_BACFN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|81608260|sp|Q64P85|GCH1_BACFR RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|52218103|dbj|BAD50696.1| GTP cyclohydrolase I [Bacteroides fragilis YCH46]
 gi|60494606|emb|CAH09407.1| putative GTP cyclohydrolase I [Bacteroides fragilis NCTC 9343]
 gi|251945474|gb|EES85912.1| GTP cyclohydrolase I [Bacteroides sp. 3_2_5]
 gi|263253445|gb|EEZ24921.1| GTP cyclohydrolase I [Bacteroides sp. 2_1_16]
 gi|301164692|emb|CBW24251.1| putative GTP cyclohydrolase I [Bacteroides fragilis 638R]
          Length = 194

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 120/183 (65%), Gaps = 5/183 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P +E+ K   R I+  +G+D +REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PALEDLKNHYRSIITLLGEDAEREGLLKTPERVAKAMLTLTKGYHMDPHEVLRSAKFQ-- 67

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 68  --EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAFNQAKTRE 185

Query: 195 DFF 197
           +F 
Sbjct: 186 EFM 188


>gi|237786213|ref|YP_002906918.1| GTP cyclohydrolase I [Corynebacterium kroppenstedtii DSM 44385]
 gi|237759125|gb|ACR18375.1| GTP cyclohydrolase I [Corynebacterium kroppenstedtii DSM 44385]
          Length = 188

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 124/184 (67%), Gaps = 6/184 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  +G+DPDREGL DTP+RV ++Y+E+FAG  Q P+   T  F+      
Sbjct: 6   ERARAAVRDLLIAVGEDPDREGLVDTPERVARAYEEIFAGLHQDPSEVLTKTFN----ED 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++VL++DI  +S CEHH++P +GK H+ YIP K   V GLSKL R++++Y++R Q+QE
Sbjct: 62  HRELVLVRDIPVYSTCEHHLVPFYGKAHIGYIPGKSGKVTGLSKLARLVDLYAKRPQVQE 121

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT Q+A A+ +    + V V+IE +H+CM+MRGI++ G TT T+A  G F  +      
Sbjct: 122 RLTKQVADAMVNRLQPQAVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFQTNPASRAE 181

Query: 197 FLKM 200
            L +
Sbjct: 182 VLSL 185


>gi|311068793|ref|YP_003973716.1| GTP cyclohydrolase I [Bacillus atrophaeus 1942]
 gi|310869310|gb|ADP32785.1| GTP cyclohydrolase I [Bacillus atrophaeus 1942]
          Length = 190

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 124/179 (69%), Gaps = 5/179 (2%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           +K+   E+ ++A+R IL  IG+DP+REGL DTP RV K Y E+F+G  + P  ++  +  
Sbjct: 1   MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDP--KEHFQTV 58

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRR 131
           FGE   ++++VL+KDI+F S CEHH++P +GK H+AYIP+   V GLSKL R +E  ++R
Sbjct: 59  FGE--DHEELVLVKDIAFHSMCEHHLVPFYGKAHIAYIPRGGKVTGLSKLARAVEAVAKR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            Q+QER+T  IA +I  + D  GV V++E +HMCM+MRG+++ G  TVT+A  G F  D
Sbjct: 117 PQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGIFKND 175


>gi|269216560|ref|ZP_06160414.1| GTP cyclohydrolase I [Slackia exigua ATCC 700122]
 gi|269130089|gb|EEZ61171.1| GTP cyclohydrolase I [Slackia exigua ATCC 700122]
          Length = 188

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 115/175 (65%), Gaps = 5/175 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A R++L  IG+DPDREGL +TP+RV + Y E+  G  Q      ++ F         ++V
Sbjct: 14  ATRLLLEGIGEDPDREGLLETPERVARMYAEVCGGLDQSAEKHLSTTF----TVDSDEVV 69

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           L +DI F S CEHH+LP +G+ H+AY+P   V+GLSKL R +EVY+RR Q+QERLT Q+A
Sbjct: 70  LERDIPFHSLCEHHLLPFFGRAHIAYLPNGKVVGLSKLARTVEVYARRPQLQERLTAQVA 129

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFF 197
            AI   T ++G  V+IE +HMCMSMRG+ + G  TVT A  GE++ D    T+FF
Sbjct: 130 DAIMEHTGARGAIVMIEAEHMCMSMRGVSKPGTKTVTVAKRGEYTTDSSLVTEFF 184


>gi|239827505|ref|YP_002950129.1| GTP cyclohydrolase I [Geobacillus sp. WCH70]
 gi|259647320|sp|C5D3E8|GCH1_GEOSW RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|239807798|gb|ACS24863.1| GTP cyclohydrolase I [Geobacillus sp. WCH70]
          Length = 188

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 118/174 (67%), Gaps = 5/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ + A+R+IL  IG+DP+REGL DTP RV K Y E+FAG  + P     + F    +  
Sbjct: 7   EQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAEVFAGLHEDPKQHFQTVF----SED 62

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R +E  +RR Q+QER
Sbjct: 63  HEELVLVKDIPFYSMCEHHLVPFFGVAHVAYIPRGGKVTGLSKLARAVETVARRPQLQER 122

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           +T  +A +I  + D  GV V++E +HMCM+MRG+K+ G  TVTTA  G F  D+
Sbjct: 123 ITATVADSIMETLDPYGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETDQ 176


>gi|320546893|ref|ZP_08041196.1| GTP cyclohydrolase I [Streptococcus equinus ATCC 9812]
 gi|320448488|gb|EFW89228.1| GTP cyclohydrolase I [Streptococcus equinus ATCC 9812]
          Length = 187

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 120/174 (68%), Gaps = 5/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ + A+  +L  +G++P+REGL +TP RV K Y+E+F+G  + P  Q T+ F    +  
Sbjct: 5   EKLEAAVYQLLEALGENPEREGLLNTPKRVAKMYQEMFSGLNEDPKDQFTAVF----SEN 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           + ++VL+KDI F+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 61  HDEVVLVKDIPFYSMCEHHLVPFYGKAHVAYLPSDGRVTGLSKLARAVEVASKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LT Q+A A+E +   KGV V++E +HMCM+MRGIK+ G  TVTT   G F  ++
Sbjct: 121 LTDQVATALEEALHPKGVFVMVEAEHMCMTMRGIKKPGSKTVTTVARGIFKENR 174


>gi|167036746|ref|YP_001664324.1| GTP cyclohydrolase I [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039465|ref|YP_001662450.1| GTP cyclohydrolase I [Thermoanaerobacter sp. X514]
 gi|256751869|ref|ZP_05492741.1| GTP cyclohydrolase I [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915465|ref|ZP_07132778.1| GTP cyclohydrolase I [Thermoanaerobacter sp. X561]
 gi|307725209|ref|YP_003904960.1| GTP cyclohydrolase I [Thermoanaerobacter sp. X513]
 gi|320115169|ref|YP_004185328.1| GTP cyclohydrolase I [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|229488266|sp|B0KCE5|GCH1_THEP3 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|229488267|sp|B0K5C1|GCH1_THEPX RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|166853705|gb|ABY92114.1| GTP cyclohydrolase I [Thermoanaerobacter sp. X514]
 gi|166855580|gb|ABY93988.1| GTP cyclohydrolase I [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256749276|gb|EEU62308.1| GTP cyclohydrolase I [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888525|gb|EFK83674.1| GTP cyclohydrolase I [Thermoanaerobacter sp. X561]
 gi|307582270|gb|ADN55669.1| GTP cyclohydrolase I [Thermoanaerobacter sp. X513]
 gi|319928260|gb|ADV78945.1| GTP cyclohydrolase I [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 188

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 121/174 (69%), Gaps = 5/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+R IL  IG+DPDREGL +TPDRV + Y+E+FAG      T         +  +
Sbjct: 5   EKIKKAVRDILEAIGEDPDREGLLETPDRVARMYEEIFAGLH----TDVKDVIKIFQEDE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +Q+++L+KDI  +S CEHH+LP  G  H+AY+P+K  ++GLSKL RI+++ ++R Q+QER
Sbjct: 61  HQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGRILGLSKLARIVDILAKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LT +IA  I  + +  GVAV+IE +H+CM+MRGIK+ G  TVT+A  G F  D+
Sbjct: 121 LTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGIKKPGAKTVTSALRGIFRTDE 174


>gi|296271396|ref|YP_003654028.1| GTP cyclohydrolase I [Thermobispora bispora DSM 43833]
 gi|296094183|gb|ADG90135.1| GTP cyclohydrolase I [Thermobispora bispora DSM 43833]
          Length = 194

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 119/181 (65%), Gaps = 8/181 (4%)

Query: 11  MKLKKPTVEEAK--EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT 68
           M +  P  + A+   A+R IL  IG+DPDREGL+DTP RV ++Y E F+G  Q P    T
Sbjct: 1   MTVPPPNFDRARIERAVREILIGIGEDPDREGLRDTPARVARAYAEQFSGLGQRPEDALT 60

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILE 126
           + F     + + +MVL+KDI   S CEHH+LP +G  H+ Y P  K  V GLSKL R+++
Sbjct: 61  TMFD----ADHDEMVLVKDIEVMSMCEHHLLPFYGVAHIGYTPNEKGKVTGLSKLARLVD 116

Query: 127 VYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGE 186
           VY+RR Q+QER+T QIA  +    + +GV V+IE +HMCM+MRG+++ G  T+T+A  G+
Sbjct: 117 VYARRPQLQERMTSQIADGLMQVLEPRGVIVVIEAEHMCMTMRGVRKPGAKTITSAVRGD 176

Query: 187 F 187
           F
Sbjct: 177 F 177


>gi|262283703|ref|ZP_06061467.1| GTP cyclohydrolase I [Streptococcus sp. 2_1_36FAA]
 gi|262260549|gb|EEY79251.1| GTP cyclohydrolase I [Streptococcus sp. 2_1_36FAA]
          Length = 187

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 85/186 (45%), Positives = 124/186 (66%), Gaps = 5/186 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ +E +  +L+ +G++PDREGL DTP RV K Y+E+F+G  + P  + T+ F  G    
Sbjct: 5   EKLQETVYQLLKLVGENPDREGLLDTPKRVAKMYQEVFSGLGRDPKDEFTAVFSEG---- 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F S CEHH+LP +G  H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 61  HEEVVLVKDIPFHSMCEHHLLPFYGVAHVAYLPSNGKVTGLSKLARAVEVASKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QIA A++ +   +GV V++E +HMCM+MRGIK+ G  TVTT   G +  +  +    
Sbjct: 121 LTAQIATALDEALSPEGVFVMVEAEHMCMTMRGIKKPGSKTVTTVAKGIYKENVHQRQEI 180

Query: 198 LKMTHN 203
           L M H+
Sbjct: 181 LSMIHH 186


>gi|295398951|ref|ZP_06808933.1| GTP cyclohydrolase I [Geobacillus thermoglucosidasius C56-YS93]
 gi|312110442|ref|YP_003988758.1| GTP cyclohydrolase I [Geobacillus sp. Y4.1MC1]
 gi|294978417|gb|EFG54013.1| GTP cyclohydrolase I [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215543|gb|ADP74147.1| GTP cyclohydrolase I [Geobacillus sp. Y4.1MC1]
          Length = 188

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 118/174 (67%), Gaps = 5/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ + A+R+IL  IG+DP+REGL DTP RV K Y ELF+G  + P     + F+      
Sbjct: 7   EQIEYAVRLILEAIGEDPNREGLVDTPKRVAKMYAELFSGLHEDPKQYFQTVFN----ED 62

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R +E  +RR Q+QER
Sbjct: 63  HEELVLVKDIPFYSMCEHHLVPFFGVAHVAYIPRDGKVTGLSKLARAVEAVARRPQLQER 122

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           +T  +A +I  + D  GV V++E +HMCM+MRG+K+ G  TVTTA  G F  D+
Sbjct: 123 ITATVADSIMETLDPYGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVFETDQ 176


>gi|52080787|ref|YP_079578.1| GTP cyclohydrolase I [Bacillus licheniformis ATCC 14580]
 gi|52786157|ref|YP_091986.1| GTP cyclohydrolase I [Bacillus licheniformis ATCC 14580]
 gi|319645256|ref|ZP_07999489.1| MtrA protein [Bacillus sp. BT1B_CT2]
 gi|52003998|gb|AAU23940.1| GTP cyclohydrolase I [Bacillus licheniformis ATCC 14580]
 gi|52348659|gb|AAU41293.1| MtrA [Bacillus licheniformis ATCC 14580]
 gi|317393065|gb|EFV73859.1| MtrA protein [Bacillus sp. BT1B_CT2]
          Length = 189

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/173 (48%), Positives = 121/173 (69%), Gaps = 5/173 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           ++ ++A+R IL  IG+DP+REGL DTP RV K Y E+FAG  + P  ++  +  FGE   
Sbjct: 7   DQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFAGLNEDP--KEHFKTIFGE--D 62

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F+S CEHH++P +GK H+AYIPK   V GLSKL R +E  ++R Q+QER
Sbjct: 63  HEELVLVKDIPFYSMCEHHLVPFYGKAHVAYIPKGGKVTGLSKLARAVEAVAKRPQLQER 122

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +T  IA +I  +    GV V++E +HMCM+MRG+K+ G  TVT+A  G F +D
Sbjct: 123 ITSTIADSIVETLTPHGVMVVVEAEHMCMTMRGVKKPGSKTVTSAVRGTFRQD 175


>gi|325290178|ref|YP_004266359.1| GTP cyclohydrolase I [Syntrophobotulus glycolicus DSM 8271]
 gi|324965579|gb|ADY56358.1| GTP cyclohydrolase I [Syntrophobotulus glycolicus DSM 8271]
          Length = 188

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/167 (49%), Positives = 117/167 (70%), Gaps = 5/167 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+ ++L  IG+DP+REGL DTP RV K Y E FAG    P+      F       +++
Sbjct: 9   EQAVSMLLEAIGEDPEREGLIDTPKRVAKFYAEAFAGLHDDPSKHLQVIFD----ENHEE 64

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           MV++KDI  +S CEHH+LP +GK H+AYIP+   V GLSKL R+++ Y+RR Q+QERLT 
Sbjct: 65  MVIVKDIPMYSMCEHHLLPFFGKAHVAYIPRNGKVTGLSKLARVIDGYARRPQLQERLTT 124

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           QIA  I++S +++GV V+IE +HMCM++RGIK+ G  TVT+A  G F
Sbjct: 125 QIADTIKNSLEARGVLVVIEAEHMCMTLRGIKKPGSKTVTSAVRGIF 171


>gi|310659065|ref|YP_003936786.1| GTP cyclohydrolase i [Clostridium sticklandii DSM 519]
 gi|308825843|emb|CBH21881.1| GTP cyclohydrolase I [Clostridium sticklandii]
          Length = 197

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/173 (48%), Positives = 117/173 (67%), Gaps = 10/173 (5%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH---FGEASK 78
           K A+R IL  IG+DPDREGL DTP R+   ++E+FAG  Q P      R H   F +   
Sbjct: 17  KRAVRDILEAIGEDPDREGLVDTPKRIANMFEEIFAGLHQDP------REHLQIFFQEEN 70

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +++MV++KDISF+S CEHH++P +GK H+AYIPK   + GLSKL R++E  +RR Q+QER
Sbjct: 71  HEEMVIVKDISFYSVCEHHLVPFFGKAHVAYIPKGGKLTGLSKLARVVETAARRPQLQER 130

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +   +A +I    D  GV V++E +HMCM+MRGIK+ G  T+T+A  G F +D
Sbjct: 131 IAKTVADSIVEVLDPYGVVVILEAEHMCMTMRGIKKPGSKTITSAVRGIFEKD 183


>gi|167753860|ref|ZP_02425987.1| hypothetical protein ALIPUT_02145 [Alistipes putredinis DSM 17216]
 gi|167658485|gb|EDS02615.1| hypothetical protein ALIPUT_02145 [Alistipes putredinis DSM 17216]
          Length = 202

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 118/183 (64%), Gaps = 3/183 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E  + IL  +G+DP REGL  TP+RV K+   L  GY+  P     S   F E  +Y+ 
Sbjct: 21  REHYKAILELLGEDPAREGLLKTPERVAKAMSFLTQGYEDDPLAIIRSA-TFKE--EYRQ 77

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL+KDI  +S CEHH+LP +GK H+AYIP  ++ GLSK+ R++E ++RRLQ+QERLT+Q
Sbjct: 78  MVLVKDIELYSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVESFARRLQVQERLTVQ 137

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           I   I+ + +  GVAV+IE  HMCM MRG+++ G  T T+AFTG F         F+ + 
Sbjct: 138 IRDCIQEALNPMGVAVVIEASHMCMQMRGVEKQGSATTTSAFTGVFLSHPPTRQEFMTLI 197

Query: 202 HNQ 204
            N+
Sbjct: 198 SNK 200


>gi|57234037|ref|YP_181917.1| GTP cyclohydrolase I [Dehalococcoides ethenogenes 195]
 gi|123618450|sp|Q3Z782|GCH1_DEHE1 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|57224485|gb|AAW39542.1| GTP cyclohydrolase I [Dehalococcoides ethenogenes 195]
          Length = 189

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/185 (44%), Positives = 118/185 (63%), Gaps = 6/185 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           K++++ +L  IG+DP+REGLK+TP RV + Y ELF+G  Q P       +  G    +++
Sbjct: 8   KQSVQNMLLAIGEDPEREGLKETPRRVAQMYAELFSGMNQDPAEVLRVGYELG----HRE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPK--KHVIGLSKLVRILEVYSRRLQIQERLT 139
           MV+IKDI F+S CEHH+LP  G +H+ YIP     V+G+SKL R++E+Y++R QIQER+ 
Sbjct: 64  MVIIKDIPFYSMCEHHLLPFSGVVHIGYIPNIDGRVVGISKLARVVEIYAKRPQIQERMA 123

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA AI       GVAV+IE +HMCM MRGIK+ G   +T+A  G F +       FL 
Sbjct: 124 TQIADAIIDGLKCDGVAVVIEAEHMCMVMRGIKKPGSRVITSALRGSFHKSPAARAEFLS 183

Query: 200 MTHNQ 204
           +   +
Sbjct: 184 LIQQK 188


>gi|153807323|ref|ZP_01959991.1| hypothetical protein BACCAC_01601 [Bacteroides caccae ATCC 43185]
 gi|149129685|gb|EDM20897.1| hypothetical protein BACCAC_01601 [Bacteroides caccae ATCC 43185]
          Length = 197

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 121/188 (64%), Gaps = 5/188 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P +EE K     I+  +G+D +REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PNLEELKSHYHSIITLLGEDAEREGLLKTPERVAKAMLSLTKGYHMDPHEVLRSAKFQ-- 67

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 68  --EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTH 202
           +F   + H
Sbjct: 186 EFMNLIQH 193


>gi|332186848|ref|ZP_08388590.1| GTP cyclohydrolase I [Sphingomonas sp. S17]
 gi|332013181|gb|EGI55244.1| GTP cyclohydrolase I [Sphingomonas sp. S17]
          Length = 208

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 113/172 (65%), Gaps = 2/172 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           +   +AIR ++ W GDDP REGL DTP RV ++++E  AGY   P     SR  F E   
Sbjct: 24  DHVAQAIRTLIAWAGDDPTREGLIDTPKRVARAWREYCAGYGDDPAVH-LSRV-FEEVGG 81

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y ++VL+KDI F S+CEHH+ PI G+ H+AY+P+ HV+G+SKL R+L  ++RRLQ+QERL
Sbjct: 82  YDEIVLLKDIPFQSHCEHHMAPIIGRAHIAYLPRNHVVGISKLARVLHGFARRLQVQERL 141

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           T ++A  I  +    GVAV+IE  H CM+ RG++  G+  VT+   G F  D
Sbjct: 142 TAEVADCIWENLKPLGVAVVIEATHACMTARGVRTPGVAMVTSRMMGVFRDD 193


>gi|327313321|ref|YP_004328758.1| GTP cyclohydrolase I [Prevotella denticola F0289]
 gi|326944156|gb|AEA20041.1| GTP cyclohydrolase I [Prevotella denticola F0289]
          Length = 197

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 113/170 (66%), Gaps = 3/170 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           +L  +G+DP+REGL+ TP RV K+ + L  GY Q P    T    F E  KY  MV++KD
Sbjct: 21  VLTLLGEDPEREGLEKTPMRVAKAMQVLTRGYTQDPHKVLTDAL-FEE--KYNQMVIVKD 77

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I FFS CEHH++P +GK H+AYIP  H+ GLSK+ R+++++S RLQ+QERLT Q+   I 
Sbjct: 78  IDFFSMCEHHMIPFYGKAHVAYIPNGHITGLSKIARVVDIFSHRLQVQERLTEQVMQCIN 137

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
            +   +GV V+IE +HMCM MRG+++    T T+A++G F   K + +F 
Sbjct: 138 DTLKPQGVMVVIEAKHMCMQMRGVEKQNAITTTSAYSGVFESSKTRNEFM 187


>gi|311112387|ref|YP_003983609.1| GTP cyclohydrolase I [Rothia dentocariosa ATCC 17931]
 gi|310943881|gb|ADP40175.1| GTP cyclohydrolase I [Rothia dentocariosa ATCC 17931]
          Length = 199

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 116/177 (65%), Gaps = 9/177 (5%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + KP +E A   +R IL  IG+DPDR+GL++TP RV ++Y+E F+G    P     + F 
Sbjct: 13  VDKPRIEAA---VREILLAIGEDPDRDGLQNTPARVARAYEEFFSGLHADPADVLGTTFD 69

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSR 130
                 + +MVL+KDI F+S CEHH++P  G  H+ YIP     V GLSKL R+LEVY+R
Sbjct: 70  IA----HSEMVLVKDIPFYSTCEHHLVPFHGVAHVGYIPGADGKVTGLSKLARVLEVYAR 125

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           R Q+QERLT Q+  A+E   + +G  V+IE +HMCMSMRG+++ G  TVT+A  G+ 
Sbjct: 126 RPQVQERLTTQVVEALEEHLNPRGAIVVIEAEHMCMSMRGVRKPGAKTVTSAVRGQL 182


>gi|293191263|ref|ZP_06609170.1| GTP cyclohydrolase I [Actinomyces odontolyticus F0309]
 gi|292820588|gb|EFF79558.1| GTP cyclohydrolase I [Actinomyces odontolyticus F0309]
          Length = 189

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/185 (44%), Positives = 123/185 (66%), Gaps = 5/185 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A R +L  IG+DP+REGL  TPDR+ ++++E+  G  + P     ++FH G      +
Sbjct: 9   EKASRDLLVAIGEDPEREGLVGTPDRMARAWREMCKGLTEDPREHLHTQFHAG----TDE 64

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVI-GLSKLVRILEVYSRRLQIQERLTM 140
           +VL++DI+FFS CEHH+LP +G+ H+ YIP+  V+ GLSKL R++E Y+RR Q+QERLT 
Sbjct: 65  LVLVRDITFFSVCEHHLLPFYGRAHVGYIPRGGVVTGLSKLARVVEGYARRPQVQERLTA 124

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           Q+A AI+   D +GV V+IE +HMCMSMRGI + G +TVT+A  G  S    + +    +
Sbjct: 125 QVADAIDEILDPQGVIVVIEAEHMCMSMRGISKPGSSTVTSALRGIMSDGATRAEMMALV 184

Query: 201 THNQR 205
               R
Sbjct: 185 LSGSR 189


>gi|297617390|ref|YP_003702549.1| GTP cyclohydrolase I [Syntrophothermus lipocalidus DSM 12680]
 gi|297145227|gb|ADI01984.1| GTP cyclohydrolase I [Syntrophothermus lipocalidus DSM 12680]
          Length = 188

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 121/176 (68%), Gaps = 5/176 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +E+ ++A+R+I+  IG+D DREGL+DTP RV + Y ELF+G ++ P+      F      
Sbjct: 3   IEKIEKAVRMIIEAIGEDKDREGLRDTPRRVARMYAELFSGIEEDPSKHLQVLF----TE 58

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQE 136
            + ++VLIKDI  +S CEHH+LP +GK H+AYIP+K  + GLSKLVR++E +++R Q+QE
Sbjct: 59  HHDELVLIKDIPLYSMCEHHLLPFYGKAHVAYIPRKGRITGLSKLVRVVEGFAKRPQLQE 118

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           RLT QIA +I       GVAV+IE +HMCM+MRG+ + G  TVT+A  G F  +  
Sbjct: 119 RLTSQIADSIMERLQPWGVAVVIEAEHMCMTMRGVNKPGSMTVTSAVRGIFETNPA 174


>gi|313204845|ref|YP_004043502.1| GTP cyclohydrolase i [Paludibacter propionicigenes WB4]
 gi|312444161|gb|ADQ80517.1| GTP cyclohydrolase I [Paludibacter propionicigenes WB4]
          Length = 198

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 125/193 (64%), Gaps = 9/193 (4%)

Query: 10  NMKLKKPTVEEAKEAIRV------ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP 63
           +  L +P   +A++  ++      I+  +G+D +REGL  TP+RV K+ + L  GY+Q P
Sbjct: 2   DFNLNQPVPFDAEKTAKIAEHYHQIIELLGEDVNREGLLKTPERVSKAMQFLMQGYEQDP 61

Query: 64  TTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVR 123
                S   F E   Y+ MV++KDI F+S CEHH+LP +GK H+AYIP K + GLSK+ R
Sbjct: 62  EEILRSAM-FTE--NYRQMVIVKDIDFYSMCEHHMLPFFGKAHIAYIPNKQITGLSKIAR 118

Query: 124 ILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAF 183
           I+EVY+RR+Q+QER+T QI   I+ + +  GV V+IE QH+CM MRG+++    T T+ F
Sbjct: 119 IVEVYARRMQVQERMTTQIKACIQKTLNPMGVMVIIEAQHLCMQMRGVQKQHSITTTSDF 178

Query: 184 TGEFSRDKGKTDF 196
           TG F + K + +F
Sbjct: 179 TGVFEQAKTREEF 191


>gi|189461509|ref|ZP_03010294.1| hypothetical protein BACCOP_02168 [Bacteroides coprocola DSM 17136]
 gi|189431778|gb|EDV00763.1| hypothetical protein BACCOP_02168 [Bacteroides coprocola DSM 17136]
          Length = 195

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 123/187 (65%), Gaps = 5/187 (2%)

Query: 11  MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTS 69
           MK  +  V++     + IL  +G+DP+REGL  TP+RV K+   L  GY+  P      +
Sbjct: 7   MKFPEEKVQKLMSHYKEILSLLGEDPEREGLLKTPERVAKAMLTLTRGYEVDPKEVLRAA 66

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
           +F      +Y  MV++KDI FFS CEHH+LP +GK+H+AYIP  ++ GLSK+ R+++++S
Sbjct: 67  KF----KEEYSQMVIVKDIDFFSMCEHHMLPFYGKVHVAYIPNGYITGLSKIARVVDIFS 122

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
            RLQ+QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++
Sbjct: 123 HRLQVQERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAFNQ 182

Query: 190 DKGKTDF 196
            K + +F
Sbjct: 183 AKTREEF 189


>gi|71910634|ref|YP_282184.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS5005]
 gi|71853416|gb|AAZ51439.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS5005]
          Length = 188

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F      +
Sbjct: 6   EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EQ 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 62  HEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 121

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 122 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 177


>gi|308067493|ref|YP_003869098.1| GTP cyclohydrolase I [Paenibacillus polymyxa E681]
 gi|305856772|gb|ADM68560.1| GTP cyclohydrolase I [Paenibacillus polymyxa E681]
          Length = 197

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 118/173 (68%), Gaps = 4/173 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL+ IG+DP REGL +TP RV + Y+E+FAGY+  P  +D     F E   ++++V++KD
Sbjct: 26  ILQLIGEDPKREGLLETPARVARMYEEIFAGYEVDP--RDALGVTFDE--NHEELVIVKD 81

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I ++S CEHH+ P +GK+H+ Y+P   ++GLSKL R++E  +RRLQ+QER+T QIA  + 
Sbjct: 82  IVYYSQCEHHMAPFFGKVHIGYVPSGKIVGLSKLARLVEAVTRRLQVQERITSQIADILN 141

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
            +  + GV V++EG+H+CM  RG+K+ G  TVT+A  G F  D  +   FL +
Sbjct: 142 EAVSAHGVMVVVEGEHLCMCARGVKKPGSKTVTSAVRGTFRDDAAQRAEFLSL 194


>gi|15675080|ref|NP_269254.1| GTP cyclohydrolase I [Streptococcus pyogenes M1 GAS]
 gi|94994368|ref|YP_602466.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS10750]
 gi|13622236|gb|AAK33975.1| GTP cyclohydrolase [Streptococcus pyogenes M1 GAS]
 gi|94547876|gb|ABF37922.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS10750]
          Length = 200

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F      +
Sbjct: 18  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EQ 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 74  HEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 134 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 189


>gi|256397525|ref|YP_003119089.1| GTP cyclohydrolase I [Catenulispora acidiphila DSM 44928]
 gi|256363751|gb|ACU77248.1| GTP cyclohydrolase I [Catenulispora acidiphila DSM 44928]
          Length = 234

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 118/172 (68%), Gaps = 6/172 (3%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
            E A+ A+R +L  +G+DPDREGLK+TP RV ++Y+E+FAG  Q P    T+ F  G   
Sbjct: 51  AERAERAVRELLLAVGEDPDREGLKETPARVSRAYREIFAGLHQGPEDVLTTTFDLG--- 107

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPK--KHVIGLSKLVRILEVYSRRLQIQ 135
            + +MVL++DI  +S CEHH++P  G  H+ YIP     + GLSKL R+++VY++R Q+Q
Sbjct: 108 -HDEMVLVRDIEVYSTCEHHLVPFHGVAHVGYIPSVDGRITGLSKLARLVDVYAKRPQVQ 166

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           ERLT QIA A+    + +GV V++E +H+CMSMRGI++ G  TVT+A  G+ 
Sbjct: 167 ERLTTQIADALVRILEPRGVIVVVECEHLCMSMRGIRKPGAKTVTSAVRGQL 218


>gi|210620865|ref|ZP_03292282.1| hypothetical protein CLOHIR_00225 [Clostridium hiranonis DSM 13275]
 gi|210155077|gb|EEA86083.1| hypothetical protein CLOHIR_00225 [Clostridium hiranonis DSM 13275]
          Length = 201

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/184 (47%), Positives = 127/184 (69%), Gaps = 6/184 (3%)

Query: 10  NMKLKKPTV--EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQD 67
           N++LK+  +  E+ K A+R IL  IG+DPDREGLKDTPDRV + Y+E+F G  Q P  ++
Sbjct: 7   NVELKEGKMDKEKIKRAVRDILEAIGEDPDREGLKDTPDRVARMYEEIFCGIFQDP--RE 64

Query: 68  TSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILE 126
             +  F E S +++MV++KDI F+S CEHH++P +GK H+ YIPK   + GLSKL R++E
Sbjct: 65  HLKVTFPEES-HEEMVIVKDIPFYSCCEHHLVPFFGKAHVVYIPKGGRLTGLSKLARVVE 123

Query: 127 VYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGE 186
             ++R Q+QER+  + A  I       GV V+IE +HMCM+MRG+K+ G  TVT+A  G 
Sbjct: 124 TIAKRPQLQERIAKETADIIMEELRPYGVMVVIEAEHMCMTMRGVKKPGSKTVTSAVRGV 183

Query: 187 FSRD 190
           F++D
Sbjct: 184 FAKD 187


>gi|78188350|ref|YP_378688.1| GTP cyclohydrolase I [Chlorobium chlorochromatii CaD3]
 gi|123580378|sp|Q3ATN0|GCH1_CHLCH RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|78170549|gb|ABB27645.1| GTP cyclohydrolase I [Chlorobium chlorochromatii CaD3]
          Length = 223

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 121/179 (67%), Gaps = 3/179 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           + A+  +L+ +G+DP REGL  TP+RV +S + L  GY + P  +   +  F E+  Y +
Sbjct: 45  ESAVYTMLQNVGEDPQREGLLKTPERVARSMRFLTKGYHENPE-ELLQKALFTES--YDE 101

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL++DI  FS CEHH+LP +GK H+AYIP   ++GLSKL R++EV+SRRLQ+QERLT Q
Sbjct: 102 MVLVRDIDLFSMCEHHMLPFFGKAHVAYIPDGKIVGLSKLARVVEVFSRRLQVQERLTQQ 161

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           I  AI++  + KGVAV+IE +H+CM MRG+++    T T+A +G F         FL++
Sbjct: 162 IRDAIQNVLNPKGVAVVIEAKHLCMVMRGVEKLNSITTTSAMSGVFMTSPSTRGEFLRL 220


>gi|89893349|ref|YP_516836.1| hypothetical protein DSY0603 [Desulfitobacterium hafniense Y51]
 gi|219666621|ref|YP_002457056.1| GTP cyclohydrolase I [Desulfitobacterium hafniense DCB-2]
 gi|89332797|dbj|BAE82392.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219536881|gb|ACL18620.1| GTP cyclohydrolase I [Desulfitobacterium hafniense DCB-2]
          Length = 188

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 123/186 (66%), Gaps = 7/186 (3%)

Query: 18  VEEAK--EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE 75
           +E+AK  EA+ +IL  IG+DP+REGLKDTPDRV + Y E+F+G  +         F    
Sbjct: 4   IEQAKIREAVLMILEAIGEDPEREGLKDTPDRVARMYAEIFSGLAEDAGVYLECVF---- 59

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQI 134
             ++++M+++KDI F+S CEHH++P  GK H+AYIP    V GLSKL R++E  +RR Q+
Sbjct: 60  TEEHEEMIVVKDIPFYSTCEHHLVPFIGKAHVAYIPAGGKVTGLSKLARVVESIARRPQL 119

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QERLT +IA  I    + +GVAV++E +H+CMSMRGIK+ G  TVT+A  G F +     
Sbjct: 120 QERLTREIADVIMKKLNPQGVAVVVEAEHLCMSMRGIKKPGSKTVTSAVRGLFRKSAKTR 179

Query: 195 DFFLKM 200
             FL +
Sbjct: 180 AEFLSL 185


>gi|20808735|ref|NP_623906.1| GTP cyclohydrolase I [Thermoanaerobacter tengcongensis MB4]
 gi|23821595|sp|Q8R7N2|GCH1_THETN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|20517377|gb|AAM25510.1| GTP cyclohydrolase I [Thermoanaerobacter tengcongensis MB4]
          Length = 188

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 127/188 (67%), Gaps = 5/188 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+R IL  IG+DPDREGL +TPDRV + Y+E+F+G      T         +  +
Sbjct: 5   EKIKKAVREILEAIGEDPDREGLLETPDRVARMYEEIFSGLH----TDVKDVIKIFQEDE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +Q+++L+KDI  +S CEHH+LP  G  H+AY+P+K  ++GLSK+ RI++V S+R Q+QER
Sbjct: 61  HQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGRILGLSKVARIVDVLSKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT +IA  I  + +  GVAV+IE +H+CM+MRG+K+ G  TVT+A  G F  D+      
Sbjct: 121 LTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGVKKPGSKTVTSALRGIFRTDQKARAEV 180

Query: 198 LKMTHNQR 205
           + + +++R
Sbjct: 181 MALINSKR 188


>gi|94969235|ref|YP_591283.1| GTP cyclohydrolase [Candidatus Koribacter versatilis Ellin345]
 gi|94551285|gb|ABF41209.1| GTP cyclohydrolase I [Candidatus Koribacter versatilis Ellin345]
          Length = 199

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/195 (44%), Positives = 123/195 (63%), Gaps = 7/195 (3%)

Query: 14  KKPTV---EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR 70
           K+PT       +E +  +L+ IG+DP REGL  TP+R  K+ K L  GY + P T     
Sbjct: 5   KEPTTLTSASNEELVAELLQRIGEDPKREGLLRTPERYAKALKFLTKGYDEDPETVLNGA 64

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
                   Y +MV++KDI  FS CEHH+LP +GK+H+AYIP   VIGLSKL R++EV++R
Sbjct: 65  LF---TVTYDEMVIVKDIEMFSLCEHHLLPFFGKVHIAYIPNGKVIGLSKLPRLVEVFAR 121

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ+QERLT +IA  IE   +  GV V+IE +H+CM MRG+++   +TVT+A  G F   
Sbjct: 122 RLQVQERLTTEIAQTIERVIEPLGVGVIIEARHLCMMMRGVEKQHSSTVTSAMLGAFRAP 181

Query: 191 KGKTDFFLKMTHNQR 205
           + + + FL +  N +
Sbjct: 182 QTREE-FLSLVRNSK 195


>gi|50914165|ref|YP_060137.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS10394]
 gi|71903463|ref|YP_280266.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS6180]
 gi|94988570|ref|YP_596671.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS9429]
 gi|94992392|ref|YP_600491.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS2096]
 gi|306827396|ref|ZP_07460683.1| GTP cyclohydrolase I [Streptococcus pyogenes ATCC 10782]
 gi|50903239|gb|AAT86954.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS10394]
 gi|71802558|gb|AAX71911.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS6180]
 gi|94542078|gb|ABF32127.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS9429]
 gi|94545900|gb|ABF35947.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS2096]
 gi|304430543|gb|EFM33565.1| GTP cyclohydrolase I [Streptococcus pyogenes ATCC 10782]
          Length = 202

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F      +
Sbjct: 20  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EQ 75

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 76  HEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 135

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 136 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 191


>gi|332826678|gb|EGJ99500.1| GTP cyclohydrolase 1 [Dysgonomonas gadei ATCC BAA-286]
          Length = 187

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 116/169 (68%), Gaps = 3/169 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           I+  +G++ DREGL  TP RV K+ + L  GY + P       F F E   Y+ MV++KD
Sbjct: 17  IISLLGENADREGLLSTPVRVAKAMQFLTKGYHEDPEEILRKAF-FKE--DYRQMVIVKD 73

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I F+S CEHH+LP WGK H+AYIP  ++ GLSK+ R+++V++RRLQ+QER+T+QI   I+
Sbjct: 74  IDFYSMCEHHMLPFWGKAHVAYIPNGYITGLSKIARVVDVFARRLQVQERMTLQIKECIQ 133

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
            + +  GV V+IE QHMCM MRG+++   TT T+ FTG F++ K + +F
Sbjct: 134 KTLNPLGVMVVIEAQHMCMQMRGVEKQNSTTTTSDFTGVFNQAKTREEF 182


>gi|288921154|ref|ZP_06415442.1| GTP cyclohydrolase I [Frankia sp. EUN1f]
 gi|288347463|gb|EFC81752.1| GTP cyclohydrolase I [Frankia sp. EUN1f]
          Length = 252

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/166 (48%), Positives = 116/166 (69%), Gaps = 6/166 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R +L  IG+DPDREGL+ TPDRV ++Y+E   G  + P    T+ F  G    + +MV
Sbjct: 74  AVRELLIGIGEDPDREGLRKTPDRVARAYQEAVEGLGRDPAEVLTTVFDEG----HDEMV 129

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           L++DI F S CEHH++   GK H+AYIP  K  + GLSKL R++++Y+RR Q+QERLT Q
Sbjct: 130 LVRDIDFSSLCEHHLVVFAGKAHVAYIPNEKGQITGLSKLARLVDLYARRPQVQERLTSQ 189

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           +A A+    D +GV V++E +H+CMSMRG+++ G TTVT+A  G+F
Sbjct: 190 VADALVDVLDPRGVMVVVEAEHLCMSMRGVRKPGATTVTSAVRGQF 235


>gi|295107232|emb|CBL04775.1| GTP cyclohydrolase I [Gordonibacter pamelaeae 7-10-1-b]
          Length = 189

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 121/183 (66%), Gaps = 6/183 (3%)

Query: 25  IRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVL 84
           +R+IL  +G+DP+REGL++TP RV + Y+E+FAG +Q P     + F       +++MVL
Sbjct: 10  VRLILEGVGEDPEREGLRETPARVARMYEEVFAGLEQDPAEHFATTFD----EHHEEMVL 65

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           ++DI F+S CEHH++P +GK H+AYIP     + GLSKL R+++V+++R Q+QERLT QI
Sbjct: 66  VRDIPFYSMCEHHLVPFFGKAHVAYIPAADGRICGLSKLARLVDVFAKRPQVQERLTSQI 125

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTH 202
           A  +      +GV V++E +H+CMSMRG+K+ G  T T+A  G F R +      L +  
Sbjct: 126 ADTLIEQLHPQGVIVVLEAEHLCMSMRGVKKAGAKTTTSAVRGAFERSQATRAEALSLIF 185

Query: 203 NQR 205
            +R
Sbjct: 186 ARR 188


>gi|333029278|ref|ZP_08457339.1| GTP cyclohydrolase 1 [Bacteroides coprosuis DSM 18011]
 gi|332739875|gb|EGJ70357.1| GTP cyclohydrolase 1 [Bacteroides coprosuis DSM 18011]
          Length = 196

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 122/188 (64%), Gaps = 5/188 (2%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDT 68
           N    +  ++  KE    +L  +G+DP+REGL  TP+RV K+   L  GY+  P     +
Sbjct: 6   NFDALQSEIKSLKEHYTEVLSLLGEDPEREGLIKTPERVAKAMLTLTRGYRMDPHEVLMS 65

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
           +RF       Y+ MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++V+
Sbjct: 66  ARF----KEDYKQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPSGYITGLSKIARVVDVF 121

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           S RLQ+QER+T+QI   I+ + +  GV V+IE +HMCM MRG+++    T T+ FTG F+
Sbjct: 122 SHRLQVQERMTLQIKECIQEALNPLGVMVVIEAKHMCMQMRGVEKQNSITTTSDFTGAFN 181

Query: 189 RDKGKTDF 196
           + K + +F
Sbjct: 182 QAKTREEF 189


>gi|322706301|gb|EFY97882.1| GTP cyclohydrolase I, putative [Metarhizium anisopliae ARSEF 23]
          Length = 288

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 117/183 (63%), Gaps = 3/183 (1%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +E+ + A+R +L  +G+DPDREGL  TP R   +   L  GY QI      +   F E  
Sbjct: 101 LEKMRSAVRTLLECLGEDPDREGLLATPSRYANALLFLTKGY-QINVDDVVNNALFDE-- 157

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
           ++ +MV++K I F S CEHH+LP  GKIH+ YIP   VIGLSKL RI E++SRRLQIQER
Sbjct: 158 EHHEMVIVKGIEFSSLCEHHVLPFTGKIHIGYIPSGKVIGLSKLPRIAEMFSRRLQIQER 217

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT Q+A AI  +   +GVAV+IE  HMCM MRG+++ G  T+T+   G F  ++   D F
Sbjct: 218 LTKQVADAIMETIGPRGVAVVIESSHMCMEMRGVEKTGTATITSCVLGCFKEEEKTRDEF 277

Query: 198 LKM 200
           + +
Sbjct: 278 MSL 280


>gi|19746048|ref|NP_607184.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS8232]
 gi|61224302|sp|P0A3E9|GCH1_STRP8 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|73919627|sp|Q5XCA9|GCH1_STRP6 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|81175324|sp|P0C0C2|GCH1_STRP1 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|19748217|gb|AAL97683.1| GTP cyclohydrolase [Streptococcus pyogenes MGAS8232]
          Length = 194

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 119/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F      +
Sbjct: 12  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EQ 67

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 68  HEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 128 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 183


>gi|88861220|ref|ZP_01135853.1| GTP cyclohydrolase I [Pseudoalteromonas tunicata D2]
 gi|88816813|gb|EAR26635.1| GTP cyclohydrolase I [Pseudoalteromonas tunicata D2]
          Length = 196

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 120/185 (64%), Gaps = 3/185 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           +E K++ + I+  IG+DP REGL DTP R  K+ + L  GYK+    Q T+   F   S 
Sbjct: 15  DELKKSYQQIIESIGEDPTREGLLDTPKRAAKAMEYLTKGYKET-LEQITNNAVF--TSD 71

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             DMVL++DI  +S CEHH+LP  G+ H+AYIP   V+GLSK  RI+++Y+RR QIQE+L
Sbjct: 72  ADDMVLVQDIELYSMCEHHLLPFVGRCHIAYIPNGKVLGLSKFARIVDMYARRFQIQEQL 131

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA A+E  T +KGV V++E +HMCM MRG+++   +  T+   G F +D    + FL
Sbjct: 132 THQIAKAVEEVTGAKGVGVIVEAKHMCMMMRGVEKQNSSMRTSVMLGNFRQDPKTRNEFL 191

Query: 199 KMTHN 203
           ++  N
Sbjct: 192 QLVKN 196


>gi|172041380|ref|YP_001801094.1| GTP cyclohydrolase I [Corynebacterium urealyticum DSM 7109]
 gi|171852684|emb|CAQ05660.1| unnamed protein product [Corynebacterium urealyticum DSM 7109]
          Length = 204

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 118/174 (67%), Gaps = 6/174 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  +G+DPDREGL DTP RV ++Y+E+F+G    PT    + F+      
Sbjct: 21  ERAEAAVRELLIAVGEDPDREGLADTPARVARAYEEVFSGLGTDPTEVLNTTFN----ED 76

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++VL+KDI F+S CEHH++P +G  H+ YIP +   V GLSKL R++E ++RR Q+QE
Sbjct: 77  HRELVLVKDIPFYSTCEHHLVPFFGHAHIGYIPGRSGKVTGLSKLARLVEGFARRPQVQE 136

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLT  IA A+    D+  V V+IE +H+CM+MRG+++ G  TVT+A  G F  +
Sbjct: 137 RLTTSIADALMERLDASAVIVVIEAEHLCMAMRGVRKPGANTVTSAVRGGFQNN 190


>gi|92114415|ref|YP_574343.1| GTP cyclohydrolase [Chromohalobacter salexigens DSM 3043]
 gi|122419618|sp|Q1QV64|GCH1_CHRSD RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|91797505|gb|ABE59644.1| GTP cyclohydrolase I [Chromohalobacter salexigens DSM 3043]
          Length = 184

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 83/185 (44%), Positives = 119/185 (64%), Gaps = 5/185 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           EE  +  R I+  +G+DPDREGL+DTP R  K+ + L  GY Q + +  + + F     S
Sbjct: 3   EELADNYRHIIAGLGEDPDREGLRDTPKRAAKAMQFLTQGYGQTLESLVNGAVFE----S 58

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
           +  +MVLIKDI  +S CEHH+LP  GK H+AY+P+  V+GLSK  RI+++Y+RR+QIQE 
Sbjct: 59  QTDEMVLIKDIELYSMCEHHLLPFIGKCHIAYLPEGRVLGLSKFARIVDMYARRMQIQEN 118

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QIA A++  T ++GV V+IE QHMCM MRG+++   +  T+   G F  +      F
Sbjct: 119 LTRQIAEAVQQVTQARGVGVIIEAQHMCMMMRGVEKQNSSMKTSVMLGAFRNNLTTRQEF 178

Query: 198 LKMTH 202
           L + H
Sbjct: 179 LTLVH 183


>gi|254882335|ref|ZP_05255045.1| GTP cyclohydrolase I [Bacteroides sp. 4_3_47FAA]
 gi|294775921|ref|ZP_06741420.1| GTP cyclohydrolase I [Bacteroides vulgatus PC510]
 gi|319640613|ref|ZP_07995332.1| GTP cyclohydrolase I [Bacteroides sp. 3_1_40A]
 gi|254835128|gb|EET15437.1| GTP cyclohydrolase I [Bacteroides sp. 4_3_47FAA]
 gi|294450290|gb|EFG18791.1| GTP cyclohydrolase I [Bacteroides vulgatus PC510]
 gi|317387783|gb|EFV68643.1| GTP cyclohydrolase I [Bacteroides sp. 3_1_40A]
          Length = 197

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 124/188 (65%), Gaps = 5/188 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEA 76
           +E+ K   + IL  +G+D +REGL  TP+RV K+   L  GY+Q P      ++F     
Sbjct: 14  IEQLKGHYQSILSLLGEDVEREGLLKTPERVAKAMLTLTRGYEQDPHAILLGAKF----K 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
            +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++V+S RLQ+QE
Sbjct: 70  EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDVFSHRLQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + +F
Sbjct: 130 RMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNAITTTSDFTGAFNQAKTREEF 189

Query: 197 FLKMTHNQ 204
              + HN+
Sbjct: 190 MNLIRHNR 197


>gi|50085551|ref|YP_047061.1| GTP cyclohydrolase I [Acinetobacter sp. ADP1]
 gi|49531527|emb|CAG69239.1| GTP cyclohydrolase I [Acinetobacter sp. ADP1]
          Length = 197

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 125/192 (65%), Gaps = 6/192 (3%)

Query: 8   VFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQ 66
           +FN ++K   +   +++   IL  +G+D +R GLKDTP R  K++  L +GY K +    
Sbjct: 4   LFN-RVKSKRLMSMQQSYANILTAVGEDLNRPGLKDTPIRAAKAFSFLTSGYGKSLEEVT 62

Query: 67  DTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILE 126
           + + F     S   +MVL+K+I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E
Sbjct: 63  NNAVF----PSDNHEMVLVKNIEFYSLCEHHLLPFYGRVHIAYLPEGQVLGLSKFARITE 118

Query: 127 VYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGE 186
           +++RRLQIQE LT QIA A+E  T ++GVAV+I+  HMCM MRG+ +   TT T +F G+
Sbjct: 119 MFARRLQIQENLTQQIAQAVEEVTKARGVAVMIDSAHMCMMMRGVGKQESTTRTVSFIGD 178

Query: 187 FSRDKGKTDFFL 198
           F  DK     FL
Sbjct: 179 FKTDKEARREFL 190


>gi|291514805|emb|CBK64015.1| GTP cyclohydrolase I [Alistipes shahii WAL 8301]
          Length = 202

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/190 (46%), Positives = 122/190 (64%), Gaps = 4/190 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           TVE  K     ILR +G+DP REGL  TP+RV K+   L  GY + P     S   F E 
Sbjct: 16  TVEALKGHYTEILRLLGEDPAREGLLKTPERVAKAMSFLTKGYDENPLEIIRSA-TFRE- 73

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
            +Y+ MVL+K+I  +S CEHH+LP +GK H+AYIP   + GLSK+ R++E ++RRLQ+QE
Sbjct: 74  -EYKQMVLVKNIELYSMCEHHMLPFYGKAHVAYIPNGRITGLSKIARVVECFARRLQVQE 132

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTD 195
           RLT+QI   I+ + +  GVAV+IE  HMCM MRGI++    T T+AFTG F  D + + +
Sbjct: 133 RLTVQIRDCIQEALNPMGVAVVIEASHMCMQMRGIEKQQSATTTSAFTGIFLSDHRTREE 192

Query: 196 FFLKMTHNQR 205
           F   ++H  R
Sbjct: 193 FMTLISHRYR 202


>gi|294630628|ref|ZP_06709188.1| GTP cyclohydrolase I [Streptomyces sp. e14]
 gi|292833961|gb|EFF92310.1| GTP cyclohydrolase I [Streptomyces sp. e14]
          Length = 201

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/169 (48%), Positives = 116/169 (68%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL DTP RV ++Y+E+FAG  Q P    T+ F  G    + 
Sbjct: 21  AENAVRELLIAVGEDPDREGLLDTPARVARAYREIFAGLWQKPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  FS CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPSASGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    + +GV V++E +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TTQIADSLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTITSAVRGQL 185


>gi|294012061|ref|YP_003545521.1| GTP cyclohydrolase I [Sphingobium japonicum UT26S]
 gi|292675391|dbj|BAI96909.1| GTP cyclohydrolase I [Sphingobium japonicum UT26S]
          Length = 202

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/189 (42%), Positives = 120/189 (63%), Gaps = 2/189 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
            +K P   +  EAIR ++RW GDDP+REGL +TP+RV +++KE   GY   P    +  F
Sbjct: 13  SIKIPVPADVAEAIRTLIRWSGDDPEREGLVETPERVARAWKEYCRGYDDDPAYHLSRIF 72

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
           H  E   Y D+VL+KDI F S+CEHH+ PI G  H+AY+P ++V+G+SKL R+L  ++ R
Sbjct: 73  H--EVGGYDDIVLLKDIPFQSHCEHHMAPIVGVAHIAYLPGQYVVGISKLARVLHAFAHR 130

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT ++A+ I      +GVAV++E  H CM+ RG++   +   T+   G F  D+
Sbjct: 131 LQVQERLTSEVANCIWEHLRPQGVAVVVEATHGCMTGRGVRTPNVVMKTSRMLGVFRDDE 190

Query: 192 GKTDFFLKM 200
              +  LK+
Sbjct: 191 KSREEVLKL 199


>gi|19114393|ref|NP_593481.1| GTP cyclohydrolase (predicted) [Schizosaccharomyces pombe 972h-]
 gi|3183014|sp|O13774|GCH1_SCHPO RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|2370485|emb|CAB11513.1| GTP cyclohydrolase (predicted) [Schizosaccharomyces pombe]
          Length = 235

 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 124/181 (68%), Gaps = 4/181 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           V++   AI  IL  +G+DP+R+GL  TP+R  K+      GY+Q   T+  +   F E  
Sbjct: 52  VKKISNAISTILECLGEDPERQGLLGTPERYAKAMLYFTKGYEQ-NLTEVINEAVFQE-- 108

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
            +++MV+++DI  FS CEHH++P  GKIH+ YIP+K V+GLSKL RI  ++SRRLQ+QER
Sbjct: 109 DHEEMVIVRDIDVFSLCEHHLVPFIGKIHIGYIPRKRVLGLSKLARIANMFSRRLQVQER 168

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDF 196
           LT Q+A AI++    +GVAV++E  HMCM MRG+++ G +TVT++ TG F R  K + +F
Sbjct: 169 LTKQVAQAIQAVLKPQGVAVVMEATHMCMVMRGVEKPGSSTVTSSLTGIFQRSHKTREEF 228

Query: 197 F 197
           F
Sbjct: 229 F 229


>gi|288803029|ref|ZP_06408465.1| GTP cyclohydrolase I [Prevotella melaninogenica D18]
 gi|302345225|ref|YP_003813578.1| GTP cyclohydrolase I [Prevotella melaninogenica ATCC 25845]
 gi|288334546|gb|EFC72985.1| GTP cyclohydrolase I [Prevotella melaninogenica D18]
 gi|302150019|gb|ADK96281.1| GTP cyclohydrolase I [Prevotella melaninogenica ATCC 25845]
          Length = 197

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 117/180 (65%), Gaps = 3/180 (1%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           ++E     + +L  +G+DP+REGL+ TP RV K+ + L  GY Q P    T    F E  
Sbjct: 11  LDELASHYKQVLTLLGEDPEREGLQKTPMRVAKAMQVLTRGYTQDPHKVLTDAL-FEE-- 67

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
           KY  MV++KDI FFS CEHHILP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+QER
Sbjct: 68  KYNQMVIVKDIDFFSMCEHHILPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQVQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT Q+   I  +   +GV V+IE +HMCM MRG+++    T T+A++G F   K + +F 
Sbjct: 128 LTEQVMQCINDTLKPQGVMVVIEAKHMCMQMRGVEKQNSITTTSAYSGVFESSKTRNEFM 187


>gi|255325837|ref|ZP_05366929.1| GTP cyclohydrolase I [Corynebacterium tuberculostearicum SK141]
 gi|311740144|ref|ZP_07713976.1| GTP cyclohydrolase I [Corynebacterium pseudogenitalium ATCC 33035]
 gi|255297049|gb|EET76374.1| GTP cyclohydrolase I [Corynebacterium tuberculostearicum SK141]
 gi|311304699|gb|EFQ80770.1| GTP cyclohydrolase I [Corynebacterium pseudogenitalium ATCC 33035]
          Length = 197

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 122/184 (66%), Gaps = 6/184 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           + A+ A+R +L  +G+DPDREGL++TP RV ++Y+E+FAG  + PT       H   A  
Sbjct: 15  DRAEAAVRELLLAVGEDPDREGLRETPARVARAYREVFAGLHEDPT----EVLHKTFAED 70

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +Q++VL++DI  +S CEHH++P +G  H+ YIP K  HV GLSKL R+ ++Y++R Q+QE
Sbjct: 71  HQELVLVRDIPIYSTCEHHLVPFYGVAHIGYIPGKDGHVTGLSKLARLADMYAKRPQVQE 130

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT Q+A A+     ++ V V+IE +H+CM+MRGI++ G TT T+A  G F  +      
Sbjct: 131 RLTQQVADALVEVLGAQSVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFKNNAASRAE 190

Query: 197 FLKM 200
            L +
Sbjct: 191 VLSL 194


>gi|237751972|ref|ZP_04582452.1| GTP cyclohydrolase I [Helicobacter winghamensis ATCC BAA-430]
 gi|229376539|gb|EEO26630.1| GTP cyclohydrolase I [Helicobacter winghamensis ATCC BAA-430]
          Length = 192

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/189 (44%), Positives = 120/189 (63%), Gaps = 3/189 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
            +K+ T E  +E IR I   IG+D +REGL DTP RV+KS++ L++GYK  P       F
Sbjct: 4   NIKENTGESTQELIRTIFDCIGEDRNREGLLDTPKRVVKSWEHLYSGYKSDPKEILGRVF 63

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
             G      +MV++KDI F+S CEHH+LP +GK+ + YIP   V+G+SKL R++EVYSRR
Sbjct: 64  TEGACD---EMVVLKDIEFYSVCEHHMLPFFGKVSIGYIPDSKVVGISKLARLVEVYSRR 120

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQIQE++T QIA  +      KGV V+ E +HMCM MRG+++     +T+A  G F  D 
Sbjct: 121 LQIQEKMTAQIADTLMEVLQPKGVMVVAEAKHMCMVMRGVEKQNSQMLTSAIRGLFKSDH 180

Query: 192 GKTDFFLKM 200
              + F+ +
Sbjct: 181 RTREEFMGL 189


>gi|315639064|ref|ZP_07894232.1| GTP cyclohydrolase I [Campylobacter upsaliensis JV21]
 gi|315480840|gb|EFU71476.1| GTP cyclohydrolase I [Campylobacter upsaliensis JV21]
          Length = 194

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 125/181 (69%), Gaps = 6/181 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           E+ +  ++ +L  IG++P REGL  TP RV KSY+ L  GYK+ +    + + F     S
Sbjct: 7   EKFENCVKNMLELIGENPQREGLLKTPTRVFKSYEFLTNGYKKDVKEILNDALFD----S 62

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              +MVL++DI F+S CEHH+LP +G+ H+AYIP K V+GLSK+ R++E+++RRLQIQE+
Sbjct: 63  SNNEMVLVRDIEFYSLCEHHLLPFFGRAHIAYIPDKKVVGLSKIPRLVEIFARRLQIQEQ 122

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDF 196
           LT QIA A+  +  +KGV V++E +HMC+ MRG+++   TT T+A  G F ++ K + +F
Sbjct: 123 LTEQIAEALMQNVGAKGVGVVLEARHMCVEMRGVQKANSTTSTSALRGLFLKNEKTRREF 182

Query: 197 F 197
           F
Sbjct: 183 F 183


>gi|157692777|ref|YP_001487239.1| GTP cyclohydrolase I [Bacillus pumilus SAFR-032]
 gi|194016860|ref|ZP_03055473.1| GTP cyclohydrolase I [Bacillus pumilus ATCC 7061]
 gi|166989685|sp|A8FEL2|GCH1_BACP2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|157681535|gb|ABV62679.1| GTP cyclohydrolase I [Bacillus pumilus SAFR-032]
 gi|194011466|gb|EDW21035.1| GTP cyclohydrolase I [Bacillus pumilus ATCC 7061]
          Length = 189

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/181 (45%), Positives = 122/181 (67%), Gaps = 5/181 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R IL+ IG+DPDREGL DTP RV K Y+E+F+G  + P  ++  +  FGE   ++++V
Sbjct: 12  AVRDILKAIGEDPDREGLLDTPKRVAKMYEEVFSGLNEDP--KEHFKTIFGE--DHEELV 67

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           L+KDI+F S CEHH++P +GK H+AYIP+   V GLSKL R +E  ++R Q+QER+T  I
Sbjct: 68  LVKDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLSKLARAVEAVAKRPQLQERITSTI 127

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTH 202
           A ++  + +  GV +++E +HMCM+MRG+K+ G  TVT+A  G F+ D       L    
Sbjct: 128 ADSMVETLNPHGVMIVVEAEHMCMTMRGVKKPGAKTVTSAVRGTFANDAAARAEVLSFIK 187

Query: 203 N 203
           N
Sbjct: 188 N 188


>gi|300742492|ref|ZP_07072513.1| GTP cyclohydrolase I [Rothia dentocariosa M567]
 gi|300381677|gb|EFJ78239.1| GTP cyclohydrolase I [Rothia dentocariosa M567]
          Length = 216

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 115/177 (64%), Gaps = 9/177 (5%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + KP +E A   +R IL  IG+DPDR+GL++TP RV ++Y+E F+G    P     + F 
Sbjct: 30  VDKPRIEAA---VREILLAIGEDPDRDGLQNTPARVARAYEEFFSGLHADPADVLGTTFD 86

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSR 130
                 + +MVL+KDI F+S CEHH++P  G  H+ YIP     V GLSKL R+LEVY+R
Sbjct: 87  IA----HSEMVLVKDIPFYSMCEHHLVPFHGVAHVGYIPGADGKVTGLSKLARVLEVYAR 142

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           R Q+QERLT Q+  A+E     +G  V+IE +HMCMSMRG+++ G  TVT+A  G+ 
Sbjct: 143 RPQVQERLTTQVVEALEEHLSPRGAIVVIEAEHMCMSMRGVRKPGAKTVTSAVRGQL 199


>gi|154508554|ref|ZP_02044196.1| hypothetical protein ACTODO_01055 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798188|gb|EDN80608.1| hypothetical protein ACTODO_01055 [Actinomyces odontolyticus ATCC
           17982]
          Length = 189

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 118/165 (71%), Gaps = 5/165 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A R +L  IG+DP+REGL  TPDR+ ++++E+  G  + P     ++FH G      +
Sbjct: 9   EKASRDLLVAIGEDPEREGLVGTPDRMARAWREMCKGLTEDPREHLHTQFHAG----TDE 64

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVI-GLSKLVRILEVYSRRLQIQERLTM 140
           +VL++DI+FFS CEHH+LP +G+ H+ YIP+  V+ GLSKL R++E Y+RR Q+QERLT 
Sbjct: 65  LVLVRDITFFSVCEHHLLPFYGRAHVGYIPRGGVVTGLSKLARVVEGYARRPQVQERLTA 124

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           Q+A AI+   D +GV V+IE +HMCMSMRGI + G +TVT+A  G
Sbjct: 125 QVADAIDEILDPQGVIVVIEAEHMCMSMRGISKPGSSTVTSALRG 169


>gi|310828932|ref|YP_003961289.1| GTP cyclohydrolase I [Eubacterium limosum KIST612]
 gi|308740666|gb|ADO38326.1| GTP cyclohydrolase I [Eubacterium limosum KIST612]
          Length = 215

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 120/190 (63%), Gaps = 5/190 (2%)

Query: 9   FNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT 68
           FN+   +   E+  EA+ +++  IG+DP REGL DTPDR+ + Y+E+FAG  Q      +
Sbjct: 23  FNIGGIQMNKEKIMEAVTMLIEAIGEDPQREGLVDTPDRIARMYEEIFAGIGQTAEEHLS 82

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
             F      +  D+V+ +DI F+S CEHH LP +GK H+AY+P   V GLSKLVR ++VY
Sbjct: 83  KSFTI----ESNDLVIERDIPFYSMCEHHFLPFYGKAHIAYVPNGKVAGLSKLVRTVDVY 138

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           +R+ Q+QE+LT +I  AI    D++GV V+IE +H+CM+MRG+KR G  TVT    G   
Sbjct: 139 ARKPQLQEKLTSEIGSAIMEYLDAQGVMVIIEAEHLCMNMRGVKRPGTKTVTAMSDGILK 198

Query: 189 RDKG-KTDFF 197
            D   K D +
Sbjct: 199 TDASLKNDVY 208


>gi|239916686|ref|YP_002956244.1| GTP cyclohydrolase I [Micrococcus luteus NCTC 2665]
 gi|281414856|ref|ZP_06246598.1| GTP cyclohydrolase I [Micrococcus luteus NCTC 2665]
 gi|239837893|gb|ACS29690.1| GTP cyclohydrolase I [Micrococcus luteus NCTC 2665]
          Length = 206

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 120/196 (61%), Gaps = 9/196 (4%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           +  + +P +E A   +R IL  IG+DPDREGL DTP RV K+Y E FAG  Q P     +
Sbjct: 18  STAVDRPRIEAA---VREILLAIGEDPDREGLADTPARVAKAYAEFFAGLHQSPDQVLGT 74

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEV 127
            F       ++++VL+KDI F+S CEHH++P  G  H+ YIP     V GLSKL R++E+
Sbjct: 75  TFDIA----HEELVLVKDIPFYSTCEHHLVPFHGAAHIGYIPSAEGRVTGLSKLARLVEL 130

Query: 128 YSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           Y+RR Q+QERLT Q+  A+      +G  V++E +HMCMSMRG+++ G  TVT+A  G+ 
Sbjct: 131 YARRPQVQERLTTQVVEALMEHLAPRGAIVVVEAEHMCMSMRGVRKPGAKTVTSAVRGQL 190

Query: 188 SRDKGKTDFFLKMTHN 203
                +++    + H 
Sbjct: 191 RDPSTRSEAMSLIMHG 206


>gi|150003052|ref|YP_001297796.1| GTP cyclohydrolase I [Bacteroides vulgatus ATCC 8482]
 gi|149931476|gb|ABR38174.1| GTP cyclohydrolase I [Bacteroides vulgatus ATCC 8482]
          Length = 208

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 124/188 (65%), Gaps = 5/188 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEA 76
           +E+ K   + IL  +G+D +REGL  TP+RV K+   L  GY+Q P      ++F     
Sbjct: 25  IEQLKGHYQSILSLLGEDVEREGLLKTPERVAKAMLTLTRGYEQDPHAILLGAKF----K 80

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
            +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++V+S RLQ+QE
Sbjct: 81  EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDVFSHRLQVQE 140

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + +F
Sbjct: 141 RMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNAITTTSDFTGAFNQAKTREEF 200

Query: 197 FLKMTHNQ 204
              + HN+
Sbjct: 201 MNLIRHNR 208


>gi|55821520|ref|YP_139962.1| GTP cyclohydrolase I [Streptococcus thermophilus LMG 18311]
 gi|55823448|ref|YP_141889.1| GTP cyclohydrolase I [Streptococcus thermophilus CNRZ1066]
 gi|81559092|sp|Q5LYM8|GCH1_STRT1 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|81560286|sp|Q5M391|GCH1_STRT2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|55737505|gb|AAV61147.1| GTP cyclohydrolase I [Streptococcus thermophilus LMG 18311]
 gi|55739433|gb|AAV63074.1| GTP cyclohydrolase I [Streptococcus thermophilus CNRZ1066]
 gi|312278858|gb|ADQ63515.1| GTP cyclohydrolase 1 [Streptococcus thermophilus ND03]
          Length = 187

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 120/174 (68%), Gaps = 5/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+  +L  +G++P+REGL DTP RV K Y E+F+G  + P  Q T+ F    +  
Sbjct: 5   EKVEQAVYQLLEALGENPEREGLLDTPKRVAKMYAEMFSGLNEDPKDQFTAVF----SEV 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPK-KHVIGLSKLVRILEVYSRRLQIQER 137
           + ++VL+KDI F+S CEHH++P +G  H+AY+P    V GLSKL R +EV +RR Q+QER
Sbjct: 61  HDEVVLVKDIPFYSMCEHHLVPFYGMAHVAYLPSGDKVTGLSKLARAVEVAARRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LT Q+A A+E + + +GV V++E +HMCM+MRGIK+ G  T+TT   G +  D+
Sbjct: 121 LTDQVATALEEALNPRGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGIYKEDR 174


>gi|321248548|ref|XP_003191164.1| GTP cyclohydrolase I [Cryptococcus gattii WM276]
 gi|317457631|gb|ADV19377.1| GTP cyclohydrolase I, putative [Cryptococcus gattii WM276]
          Length = 436

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 122/189 (64%), Gaps = 7/189 (3%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ--IPTTQDTSRF 71
           K   +E    A+R +L  IG+DPDREGL+ TP+R  K+   +  GY++  +    D    
Sbjct: 244 KSANMELLTSALRTVLECIGEDPDREGLQRTPERYAKALLWMTKGYEERLVDVINDAV-- 301

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   + +MV+++DI  FS CEHH++P  GKI + YIP K V+GLSKL RI E +SRR
Sbjct: 302 -FAE--DHDEMVIVRDIEVFSLCEHHLVPFTGKISIGYIPSKLVLGLSKLARIAETFSRR 358

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT Q+A A+E +   +GVAV++E  HMCMSMRG+++ G TTVT+   G F + +
Sbjct: 359 LQVQERLTKQVALAVEEAIRPRGVAVVMEASHMCMSMRGVQKPGATTVTSTMLGCFRQQQ 418

Query: 192 GKTDFFLKM 200
              + FL +
Sbjct: 419 KTREEFLTL 427


>gi|310640262|ref|YP_003945020.1| gtp cyclohydrolase 1 [Paenibacillus polymyxa SC2]
 gi|309245212|gb|ADO54779.1| GTP cyclohydrolase 1 [Paenibacillus polymyxa SC2]
          Length = 197

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 118/173 (68%), Gaps = 4/173 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL+ IG+DP REGL +TP RV + Y+E+FAGY+  P  +D     F E   ++++V++KD
Sbjct: 26  ILKLIGEDPKREGLLETPARVARMYEEIFAGYEVDP--RDALGVTFDE--NHEELVIVKD 81

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I ++S CEHH+ P +GK+H+ Y+P   ++GLSKL R++E  +RRLQ+QER+T QIA  + 
Sbjct: 82  IVYYSQCEHHMAPFFGKVHIGYVPSGKIVGLSKLARLVEAVTRRLQVQERITSQIADILN 141

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
            +  + GV V++EG+H+CM  RG+K+ G  TVT+A  G F  +  +   FL +
Sbjct: 142 EAVSAHGVMVVVEGEHLCMCARGVKKPGSKTVTSAVRGTFRDNAAQRAEFLSL 194


>gi|257065173|ref|YP_003144845.1| GTP cyclohydrolase I [Slackia heliotrinireducens DSM 20476]
 gi|256792826|gb|ACV23496.1| GTP cyclohydrolase I [Slackia heliotrinireducens DSM 20476]
          Length = 194

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 120/181 (66%), Gaps = 7/181 (3%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           KL +P    A+ AIR  L  IG+DPDREGL +TP RV ++  E+FAG ++ P      +F
Sbjct: 8   KLDQP---RAEAAIREFLYAIGEDPDREGLLETPSRVARACAEIFAGLQENPADHLKKQF 64

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSR 130
           H    + +++MV++KDI F S CEHH+LP  G+ H+AYIP+K  + GLSK+ R +E ++R
Sbjct: 65  H---EADHEEMVIVKDIPFNSMCEHHLLPFSGRAHVAYIPRKGRITGLSKIARCVEGFAR 121

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           R Q+QERL  Q+A A+  + D  G  V+IE +HMCM+ RGI++ G  TVT+A  G F  D
Sbjct: 122 RPQVQERLASQVADALMEALDPLGAIVVIEAEHMCMTARGIRKPGSLTVTSAVRGVFKED 181

Query: 191 K 191
           +
Sbjct: 182 Q 182


>gi|312890752|ref|ZP_07750284.1| GTP cyclohydrolase I [Mucilaginibacter paludis DSM 18603]
 gi|311296766|gb|EFQ73903.1| GTP cyclohydrolase I [Mucilaginibacter paludis DSM 18603]
          Length = 212

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 116/171 (67%), Gaps = 5/171 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPT-TQDTSRFHFGEASKYQDMVLIK 86
           IL+ +G+DP+REGL  TP+RV K+   L  GY   P    ++++F       Y  MV++K
Sbjct: 38  ILKQLGEDPEREGLVKTPERVAKALLYLTHGYDLNPQEILESAKF----KEDYSQMVVVK 93

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP +GK H+AYIP  HV+GLSK+ R+++ ++RRLQ+QERLT QI   I
Sbjct: 94  DIEVYSMCEHHMLPFFGKAHIAYIPNGHVVGLSKIPRVVDAFARRLQVQERLTNQIRDCI 153

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
             +    GVAV+IE +H+CM MRG+++    T T+AFTGEF ++K + +F 
Sbjct: 154 HETLQPIGVAVVIECRHLCMCMRGVQKQNSVTTTSAFTGEFIKEKTRAEFL 204


>gi|268680772|ref|YP_003305203.1| GTP cyclohydrolase I [Sulfurospirillum deleyianum DSM 6946]
 gi|268618803|gb|ACZ13168.1| GTP cyclohydrolase I [Sulfurospirillum deleyianum DSM 6946]
          Length = 193

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 119/180 (66%), Gaps = 5/180 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPT-TQDTSRFHFGEAS 77
           EE + A++ +L  IG++  REGL  TP RV K+Y+ +  GY Q PT   + + F     S
Sbjct: 7   EEFENAVKTMLEIIGENTQREGLLKTPSRVFKAYEYMTQGYHQSPTEVLNEALFE----S 62

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
               MVLIKDI F+S CEHH+LPI G+ H+AYIP   V+GLSK+ R++++++RRLQIQE+
Sbjct: 63  DNNQMVLIKDIEFYSMCEHHLLPIIGRAHVAYIPNGKVVGLSKIPRMVDIFARRLQIQEQ 122

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QIA AI+     KGV V+I+ +HMCM MRG+++    T T+A  G F +   + +FF
Sbjct: 123 LTEQIAKAIDDVIAPKGVGVVIQARHMCMEMRGVEKTHSNTTTSALRGLFLKADTRKEFF 182


>gi|225870486|ref|YP_002746433.1| GTP cyclohydrolase I [Streptococcus equi subsp. equi 4047]
 gi|225699890|emb|CAW93792.1| GTP cyclohydrolase I [Streptococcus equi subsp. equi 4047]
          Length = 207

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 121/175 (69%), Gaps = 7/175 (4%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           ++A+ AI  +L  IG+DP+REGL+DTP RV K Y E+ +G +Q    + T+ F       
Sbjct: 25  KKAEAAIYQLLEAIGEDPNREGLRDTPKRVAKMYLEMLSGLEQDAKDEFTAVF----TEH 80

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           + D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 81  HDDLVIVKDISFYSMCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVTSKRPQLQER 140

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF--SRD 190
           LT QIA+A+  +   KGV V++E +HMCM+MRG+K+ G  T+TT   G +  SRD
Sbjct: 141 LTAQIANALVDALQPKGVFVMVEAEHMCMTMRGVKKPGSKTITTTARGIYKDSRD 195


>gi|323701736|ref|ZP_08113407.1| GTP cyclohydrolase I [Desulfotomaculum nigrificans DSM 574]
 gi|323533272|gb|EGB23140.1| GTP cyclohydrolase I [Desulfotomaculum nigrificans DSM 574]
          Length = 187

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 119/170 (70%), Gaps = 5/170 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+++IL  IG+DP REGL +TP RV K Y+E+F G ++ P+   +  F    + ++++
Sbjct: 8   EQAVKMILEAIGEDPQREGLLETPARVAKMYQEIFMGLEEDPSEHLSKTF----SEEHEE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           MVL+KDI  FS CEHH++P  GK H+ YIP+  +V GLSKL R++  Y+RR Q+QERLT 
Sbjct: 64  MVLVKDIPLFSMCEHHLIPFIGKAHVCYIPRNGNVTGLSKLARLVNGYARRPQLQERLTK 123

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           QIA AI +  +  GV V++E +H+CMSMRG++  G  TVT+A  G F ++
Sbjct: 124 QIADAIMTKLNPYGVVVVVEAEHLCMSMRGVRVPGAHTVTSAVRGLFKKN 173


>gi|25090391|sp|Q8K7K9|GCH1_STRP3 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
          Length = 194

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 118/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F       
Sbjct: 12  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EH 67

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 68  HEDVVIVKDISFYSVCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 128 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 183


>gi|332669079|ref|YP_004452087.1| GTP cyclohydrolase I [Cellulomonas fimi ATCC 484]
 gi|332338117|gb|AEE44700.1| GTP cyclohydrolase I [Cellulomonas fimi ATCC 484]
          Length = 211

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 119/171 (69%), Gaps = 6/171 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           + A+ A+R +L  +G+DPDREGL +TP RV ++Y+E+FAG  Q PT   T+ F  G    
Sbjct: 29  QRAEAAVRELLLAVGEDPDREGLLETPARVARAYREIFAGLYQDPTDVLTTTFDLG---- 84

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +++MVL+KDI  +S CEHH++P  G  H+ YIP +   + GLSKL R+++VY+RR Q+QE
Sbjct: 85  HEEMVLVKDIEVYSTCEHHLVPFHGVAHVGYIPGEDGRITGLSKLARLVDVYARRPQVQE 144

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           RLT Q+A A+      +GV V++E +H+CMSMRG+++ G  TVT+A  G+ 
Sbjct: 145 RLTSQVADALVEVLQPRGVLVVVECEHLCMSMRGVRKPGSRTVTSAVRGQM 195


>gi|289707002|ref|ZP_06503337.1| GTP cyclohydrolase I [Micrococcus luteus SK58]
 gi|289556327|gb|EFD49683.1| GTP cyclohydrolase I [Micrococcus luteus SK58]
          Length = 206

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 120/196 (61%), Gaps = 9/196 (4%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           +  + +P +E A   +R IL  IG+DPDREGL DTP RV K+Y E FAG  Q P     +
Sbjct: 18  STAVDRPRIEAA---VREILLAIGEDPDREGLTDTPARVAKAYAEFFAGLHQSPDQVLGT 74

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEV 127
            F       ++++VL+KDI F+S CEHH++P  G  H+ YIP     V GLSKL R++E+
Sbjct: 75  TFDIA----HEELVLVKDIPFYSTCEHHLVPFHGAAHIGYIPSAEGRVTGLSKLARLVEL 130

Query: 128 YSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           Y+RR Q+QERLT Q+  A+      +G  V++E +HMCMSMRG+++ G  TVT+A  G+ 
Sbjct: 131 YARRPQVQERLTTQVVEALMEHLAPRGAIVVVEAEHMCMSMRGVRKPGAKTVTSAVRGQL 190

Query: 188 SRDKGKTDFFLKMTHN 203
                +++    + H 
Sbjct: 191 RDPSTRSEAMSLIMHG 206


>gi|21910295|ref|NP_664563.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS315]
 gi|21904490|gb|AAM79366.1| GTP cyclohydrolase [Streptococcus pyogenes MGAS315]
          Length = 200

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 118/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F       
Sbjct: 18  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EH 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 74  HEDVVIVKDISFYSVCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 134 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 189


>gi|258512776|ref|YP_003186210.1| GTP cyclohydrolase I [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257479502|gb|ACV59821.1| GTP cyclohydrolase I [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 206

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 126/180 (70%), Gaps = 5/180 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R+IL  IG+ PDREGL DTP RV + Y+E+F+G  Q P  + T+RFH     ++ +
Sbjct: 26  EQAVRMILEAIGEAPDREGLVDTPARVARMYQEIFSGLHQDPRDELTARFHV----EHGE 81

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVI-GLSKLVRILEVYSRRLQIQERLTM 140
           +VL++DI F S CEHH+LP +G  H+AY+P  HV+ GLSKL R+++V +++ Q+QER+T 
Sbjct: 82  VVLVRDIPFHSMCEHHLLPFFGIAHIAYLPHNHVVTGLSKLARLVDVVAKKPQVQERMTN 141

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +IA A+  + +++GV V+++ +H+CMSMRGI++ G  T T A  G +     + +  L++
Sbjct: 142 EIADALVEALEAEGVLVVVDAEHLCMSMRGIRKPGSRTTTVATRGRYLHHPHEREEVLRL 201


>gi|260556718|ref|ZP_05828936.1| GTP cyclohydrolase I [Acinetobacter baumannii ATCC 19606]
 gi|260409977|gb|EEX03277.1| GTP cyclohydrolase I [Acinetobacter baumannii ATCC 19606]
          Length = 184

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 115/172 (66%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +R GLKDTP R  K++  L +GY K +    + + F     S   +MVL+K
Sbjct: 10  ILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVF----PSDNHEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 66  NIEFYSLCEHHLLPFYGRVHIAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              TD++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 126 AEVTDARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFL 177


>gi|28895871|ref|NP_802221.1| GTP cyclohydrolase I [Streptococcus pyogenes SSI-1]
 gi|28811121|dbj|BAC64054.1| putative GTP cyclohydrolase [Streptococcus pyogenes SSI-1]
          Length = 202

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 118/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F       
Sbjct: 20  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EH 75

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 76  HEDVVIVKDISFYSVCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 135

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 136 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 191


>gi|271970340|ref|YP_003344536.1| GTP cyclohydrolase I [Streptosporangium roseum DSM 43021]
 gi|270513515|gb|ACZ91793.1| GTP cyclohydrolase I [Streptosporangium roseum DSM 43021]
          Length = 193

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 127/188 (67%), Gaps = 9/188 (4%)

Query: 11  MKLKKPTVEEAK--EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT 68
           M +K   V+ A+  +A+R IL  +G+DPDR+GL+DTP RV ++Y E FAG  Q P    T
Sbjct: 1   MSVKPLQVDSARIEKAVREILIALGEDPDRDGLQDTPARVARAYAEQFAGLGQSPEDVLT 60

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILE 126
           + F       + +MVL++DI  +S CEHH++P  G  H+ YIP  K  V GLSKL R+++
Sbjct: 61  TVFDV----DHDEMVLVRDIEVYSTCEHHLVPFHGVAHVGYIPNEKGQVTGLSKLARLVD 116

Query: 127 VYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGE 186
           VY+RR Q+QER+T QIA A+ S  + +GV V+IE +H+CM+MRG+++ G  T+T+A  G+
Sbjct: 117 VYARRPQVQERMTSQIADALMSVLEPRGVIVVIECEHLCMTMRGVRKPGAKTITSAVRGD 176

Query: 187 FSRDKGKT 194
           F R+  KT
Sbjct: 177 F-RNSDKT 183


>gi|311106077|ref|YP_003978930.1| GTP cyclohydrolase 2 [Achromobacter xylosoxidans A8]
 gi|310760766|gb|ADP16215.1| GTP cyclohydrolase 2 [Achromobacter xylosoxidans A8]
          Length = 181

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 115/174 (66%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+DP REGL DTP R  K+ + L  GY Q +    + + F     S  +++VL+K
Sbjct: 10  ILEQLGEDPSREGLADTPARAAKAMRHLCRGYDQNLDEIVNGALF----TSDTREIVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I  +S CEHH+LP  GK H+AY+P   V+GLSK+ RI+E+Y+RRLQIQE L+ Q+A A+
Sbjct: 66  NIELYSLCEHHMLPFIGKAHVAYLPNGKVLGLSKVARIVEMYARRLQIQENLSRQVAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +S TD+ GVAV+IE QHMCM MRG+++   + VT+   GEF  +      FL +
Sbjct: 126 QSVTDAAGVAVVIEAQHMCMMMRGVEKQNSSMVTSVMLGEFHDNPSTRAEFLSL 179


>gi|258514640|ref|YP_003190862.1| GTP cyclohydrolase I [Desulfotomaculum acetoxidans DSM 771]
 gi|257778345|gb|ACV62239.1| GTP cyclohydrolase I [Desulfotomaculum acetoxidans DSM 771]
          Length = 188

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 85/181 (46%), Positives = 123/181 (67%), Gaps = 6/181 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+ +IL  IG+DP+REGL +TP RV + YKE+F G  + P       F+     +
Sbjct: 5   EKIEKAVYMILEAIGEDPEREGLLETPARVARMYKEVFCGLSEDPNIHLRKIFN----EE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI+F S CEHH+LP +GK H+AYIP K  V GLSKL R+++ Y++R Q+QER
Sbjct: 61  HEELVLVKDIAFSSMCEHHLLPFFGKAHVAYIPHKGRVTGLSKLARVVDSYAKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTDF 196
           LT QIA  I    +  GV V++E +HMCM++RGIK+ G  TVT+A  G F S D  + + 
Sbjct: 121 LTSQIADCIMKHLNPYGVIVVVEAEHMCMTLRGIKKPGSKTVTSAVRGAFKSNDATRAEA 180

Query: 197 F 197
           F
Sbjct: 181 F 181


>gi|86130316|ref|ZP_01048916.1| GTP cyclohydrolase I [Dokdonia donghaensis MED134]
 gi|85818991|gb|EAQ40150.1| GTP cyclohydrolase I [Dokdonia donghaensis MED134]
          Length = 198

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 120/187 (64%), Gaps = 7/187 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K     I++ +G+D  REG+  TP+R  K+ + L +GY+      D +    G   K
Sbjct: 15  EDVKSNFTSIIKSLGEDTSREGIVKTPERAAKAMQYLTSGYEM-----DAAAILKGAMFK 69

Query: 79  --YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             Y DMV++K+I  +S CEHH+LP +GK H+AYIP  H++GLSKL RI++V++RRLQ+QE
Sbjct: 70  EDYDDMVIVKNIELYSLCEHHMLPFFGKAHIAYIPNGHIVGLSKLPRIVDVFARRLQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT  I   I ++   KGVAV+IE  HMCM MRG+++   TT T+ F G+F R + + +F
Sbjct: 130 RLTHDILECINTTLQPKGVAVVIEASHMCMMMRGVQKQNSTTTTSGFRGQFERQETRNEF 189

Query: 197 FLKMTHN 203
              ++ N
Sbjct: 190 LKLISSN 196


>gi|296454755|ref|YP_003661898.1| GTP cyclohydrolase I [Bifidobacterium longum subsp. longum JDM301]
 gi|296184186|gb|ADH01068.1| GTP cyclohydrolase I [Bifidobacterium longum subsp. longum JDM301]
          Length = 199

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 116/168 (69%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  +EA+R+ L+ IG+DP+REGL +TPDR+ ++ +ELFAG +  P   D    HF     
Sbjct: 18  EGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQASPA--DVLEKHFD--VD 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
            +++VL+KDI  +S CEHH+LP  G  H+ YIP K  V+GLSKL R++EVY+RR Q+QER
Sbjct: 74  TEELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYARRPQVQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+     ++GV V+ E +H+CMSMRGIK+    TVT+A  G
Sbjct: 134 LTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG 181


>gi|332850880|ref|ZP_08433056.1| GTP cyclohydrolase I [Acinetobacter baumannii 6013150]
 gi|332871786|ref|ZP_08440221.1| GTP cyclohydrolase I [Acinetobacter baumannii 6013113]
 gi|332730402|gb|EGJ61723.1| GTP cyclohydrolase I [Acinetobacter baumannii 6013150]
 gi|332731194|gb|EGJ62493.1| GTP cyclohydrolase I [Acinetobacter baumannii 6013113]
          Length = 182

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 115/172 (66%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +R GLKDTP R  K++  L +GY K +    + + F     S   +MVL+K
Sbjct: 8   ILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVF----PSDNHEMVLVK 63

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 64  NIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIAEAV 123

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              TD++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 124 AEVTDARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFL 175


>gi|169795251|ref|YP_001713044.1| GTP cyclohydrolase I [Acinetobacter baumannii AYE]
 gi|184158882|ref|YP_001847221.1| GTP cyclohydrolase I [Acinetobacter baumannii ACICU]
 gi|213158083|ref|YP_002320134.1| GTP cyclohydrolase I [Acinetobacter baumannii AB0057]
 gi|215482787|ref|YP_002324988.1| GTP cyclohydrolase I [Acinetobacter baumannii AB307-0294]
 gi|301346746|ref|ZP_07227487.1| GTP cyclohydrolase I [Acinetobacter baumannii AB056]
 gi|301594600|ref|ZP_07239608.1| GTP cyclohydrolase I [Acinetobacter baumannii AB059]
 gi|169148178|emb|CAM86041.1| GTP cyclohydrolase I [Acinetobacter baumannii AYE]
 gi|183210476|gb|ACC57874.1| GTP cyclohydrolase I [Acinetobacter baumannii ACICU]
 gi|213057243|gb|ACJ42145.1| GTP cyclohydrolase I [Acinetobacter baumannii AB0057]
 gi|213987790|gb|ACJ58089.1| GTP cyclohydrolase I [Acinetobacter baumannii AB307-0294]
          Length = 184

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 115/172 (66%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +R GLKDTP R  K++  L +GY K +    + + F     S   +MVL+K
Sbjct: 10  ILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVF----PSDNHEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 66  NIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              TD++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 126 AEVTDARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFL 177


>gi|139473808|ref|YP_001128524.1| GTP cyclohydrolase I [Streptococcus pyogenes str. Manfredo]
 gi|166220292|sp|A2REL9|GCH1_STRPG RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|134272055|emb|CAM30294.1| GTP cyclohydrolase I [Streptococcus pyogenes str. Manfredo]
          Length = 194

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 118/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F       
Sbjct: 12  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EH 67

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 68  HEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 128 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 183


>gi|328883302|emb|CCA56541.1| GTP cyclohydrolase I type 1 [Streptomyces venezuelae ATCC 10712]
          Length = 201

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 117/169 (69%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL++TP RV ++YKE+FAG  Q+P    T+ F  G    + 
Sbjct: 21  AEAAVRELLIAVGEDPDREGLRETPARVARAYKEIFAGLWQVPEGVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  +S CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVYSTCEHHLVPFRGVAHVGYIPSTSGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T Q+A ++    + +GV V+ E +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TTQVADSLMDILEPRGVIVVFECEHMCMSMRGIRKPGAKTITSAVRGQL 185


>gi|299137837|ref|ZP_07031018.1| GTP cyclohydrolase I [Acidobacterium sp. MP5ACTX8]
 gi|298600478|gb|EFI56635.1| GTP cyclohydrolase I [Acidobacterium sp. MP5ACTX8]
          Length = 203

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 118/179 (65%), Gaps = 5/179 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           +L  IG+DP R+GL +TP R+ KS   L  GY Q I      + F       Y +MV++K
Sbjct: 29  LLTRIGEDPSRDGLLNTPKRMEKSMAFLTQGYTQSIDAVLHGALFDV----HYDEMVIVK 84

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G+ H+AY+P   VIGLSK+ RI++V++RRLQ+QERLT QIA AI
Sbjct: 85  EIEFYSQCEHHLLPFFGRAHVAYVPNGKVIGLSKIPRIIDVFARRLQVQERLTQQIAQAI 144

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQR 205
           E +   +GV V++E QH+CM MRG+++ G +TVT+A  G F   +   + FL +   +R
Sbjct: 145 EDAIQPQGVGVIVEAQHLCMMMRGVEKQGSSTVTSAMLGVFKSQQQTRNEFLSLVERRR 203


>gi|58263148|ref|XP_568984.1| GTP cyclohydrolase I [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134107790|ref|XP_777506.1| hypothetical protein CNBB0800 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50260198|gb|EAL22859.1| hypothetical protein CNBB0800 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57223634|gb|AAW41677.1| GTP cyclohydrolase I, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 435

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/189 (45%), Positives = 122/189 (64%), Gaps = 7/189 (3%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ--IPTTQDTSRF 71
           K   +E    A+R +L  IG+DPDREGL+ TP+R  K+   +  GY++  +    D    
Sbjct: 243 KSANMELLTSALRTVLECIGEDPDREGLQRTPERYAKALLWMTKGYEERLVDVINDAV-- 300

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E   + +MV+++DI  FS CEHH++P  GKI + YIP K V+GLSKL RI E +SRR
Sbjct: 301 -FAE--DHDEMVIVRDIEVFSLCEHHLVPFTGKISIGYIPSKLVLGLSKLARIAETFSRR 357

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QERLT Q+A A+E +   +GVAV++E  HMCMSMRG+++ G TTVT+   G F + +
Sbjct: 358 LQVQERLTKQVALAVEEAIRPRGVAVVMEASHMCMSMRGVQKPGATTVTSTMLGCFRQQQ 417

Query: 192 GKTDFFLKM 200
              + FL +
Sbjct: 418 KTREEFLTL 426


>gi|225849027|ref|YP_002729191.1| GTP cyclohydrolase I [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644045|gb|ACN99095.1| GTP cyclohydrolase I [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 187

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/184 (44%), Positives = 121/184 (65%), Gaps = 7/184 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++AIR+ L  IG+DP+REGL+DTP RV K ++E F  + +   T       F +   Y +
Sbjct: 9   EQAIRLFLEGIGEDPNREGLRDTPKRVAKMWEE-FESHGEFNMTV------FEDVGSYDE 61

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+++DI FFS+CEHH+LP +GK H+AYIP K V GLSK+VR++  +S R Q+QERLT +
Sbjct: 62  MVVVRDIQFFSFCEHHLLPFFGKAHVAYIPDKKVCGLSKIVRVVNKFSYRPQVQERLTAE 121

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA  +E     KGVAV++E  H+CM+MRG++     TVT+  TG F   +   + FL + 
Sbjct: 122 IAEFLEKELQPKGVAVVMEAIHLCMAMRGVRNPDSVTVTSKLTGRFLECQKTREEFLNLI 181

Query: 202 HNQR 205
           ++ +
Sbjct: 182 NSHK 185


>gi|222152971|ref|YP_002562148.1| GTP cyclohydrolase I [Streptococcus uberis 0140J]
 gi|222113784|emb|CAR41830.1| GTP cyclohydrolase I [Streptococcus uberis 0140J]
          Length = 186

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/187 (44%), Positives = 123/187 (65%), Gaps = 5/187 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +++A++AI  +L  IG+DP REGL +TP RV K Y+E+F+  K       T+ F      
Sbjct: 4   IKKAEDAIYQLLEAIGEDPQREGLLETPKRVAKMYEEMFSSLKSDAKEAFTAVF----TE 59

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQE 136
            Y D+VL+KDI F+S CEHH++P +G  H+AY P+   V GLSKL R +E+ S++ Q+QE
Sbjct: 60  AYDDLVLVKDIPFYSMCEHHLVPFYGVAHIAYYPQNGKVTGLSKLARAVEIASKKPQLQE 119

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT QIA A++ S   +GV V++E +HMCM+MRGIK+ G  T+TT   G F+ DK +  +
Sbjct: 120 RLTSQIADALDQSLHPRGVFVMVEAEHMCMTMRGIKKPGSKTMTTTARGIFTEDKKEQAY 179

Query: 197 FLKMTHN 203
            L +  +
Sbjct: 180 VLSLIKD 186


>gi|212691811|ref|ZP_03299939.1| hypothetical protein BACDOR_01306 [Bacteroides dorei DSM 17855]
 gi|237708597|ref|ZP_04539078.1| GTP cyclohydrolase I [Bacteroides sp. 9_1_42FAA]
 gi|237724135|ref|ZP_04554616.1| GTP cyclohydrolase I [Bacteroides sp. D4]
 gi|265755195|ref|ZP_06089965.1| GTP cyclohydrolase I [Bacteroides sp. 3_1_33FAA]
 gi|212665712|gb|EEB26284.1| hypothetical protein BACDOR_01306 [Bacteroides dorei DSM 17855]
 gi|229437595|gb|EEO47672.1| GTP cyclohydrolase I [Bacteroides dorei 5_1_36/D4]
 gi|229457297|gb|EEO63018.1| GTP cyclohydrolase I [Bacteroides sp. 9_1_42FAA]
 gi|263234337|gb|EEZ19927.1| GTP cyclohydrolase I [Bacteroides sp. 3_1_33FAA]
          Length = 197

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 124/188 (65%), Gaps = 5/188 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEA 76
           +E+ K   + IL  +G+D +REGL  TP+RV K+   L  GY+Q P      ++F     
Sbjct: 14  IEQLKGHYQSILSLLGEDVEREGLLKTPERVAKAMLTLTRGYEQDPHAILLGAKF----K 69

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
            +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++V+S RLQ+QE
Sbjct: 70  EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDVFSHRLQVQE 129

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           R+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + +F
Sbjct: 130 RMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNAITTTSDFTGAFNQAKTREEF 189

Query: 197 FLKMTHNQ 204
              + HN+
Sbjct: 190 MDLIRHNR 197


>gi|157151501|ref|YP_001451148.1| GTP cyclohydrolase I [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|189045198|sp|A8AZD8|GCH1_STRGC RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|157076295|gb|ABV10978.1| GTP cyclohydrolase I [Streptococcus gordonii str. Challis substr.
           CH1]
          Length = 187

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 123/186 (66%), Gaps = 5/186 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ +E +  +L  +G++PDREGL DTP RV K Y+E+F+G  + P  + T+ F  G    
Sbjct: 5   EKLQETVYQLLELVGENPDREGLLDTPKRVAKMYQEVFSGLGRDPKDEFTAVFSEG---- 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F S CEHH+LP +G  H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 61  HEEVVLVKDIPFHSMCEHHLLPFYGVAHVAYLPSNGKVTGLSKLARAVEVASKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QIA A++ +   +GV V++E +HMCM+MRGIK+ G  T+TT   G +  +  +    
Sbjct: 121 LTAQIATALDEALSPEGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGIYKENVHQRQEI 180

Query: 198 LKMTHN 203
           L M H+
Sbjct: 181 LSMIHH 186


>gi|297159330|gb|ADI09042.1| GTP cyclohydrolase I [Streptomyces bingchenggensis BCW-1]
          Length = 201

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 123/183 (67%), Gaps = 13/183 (7%)

Query: 7   GVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQ 66
           GVF+ K        A++AIR +L  +G+DPDREGL++TP RV ++Y+E+FAG +Q P   
Sbjct: 14  GVFDEK-------RAEQAIRELLIAVGEDPDREGLRETPGRVARAYREIFAGLRQKPEEV 66

Query: 67  DTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRI 124
            T+ F  G    + +MVL+KDI   S CEHH++P  G  H+ YIP     + GLSKL R+
Sbjct: 67  LTTTFDLG----HDEMVLVKDIEVMSSCEHHLVPFVGVAHVGYIPSNDGKITGLSKLARL 122

Query: 125 LEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFT 184
           ++V++RR Q+QERLT QIA ++    + +GV V++E +HMCM+MRG+++ G  T+T+A  
Sbjct: 123 VDVFARRPQVQERLTTQIADSLMRILEPRGVIVVVECEHMCMTMRGVRKPGAKTLTSAVR 182

Query: 185 GEF 187
           G+ 
Sbjct: 183 GQL 185


>gi|149373090|ref|ZP_01891995.1| GTP cyclohydrolase I [unidentified eubacterium SCB49]
 gi|149354317|gb|EDM42885.1| GTP cyclohydrolase I [unidentified eubacterium SCB49]
          Length = 199

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 116/179 (64%), Gaps = 3/179 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           ++ K+    IL+ IG+D DREG+  TP+R  K+ + L +G+ Q P     S      A  
Sbjct: 16  DDLKDNFTNILKGIGEDVDREGIVKTPERAAKAMQFLTSGHNQDPAEILKSAMF---AED 72

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y DMV+IKDI  +S CEHHILP +GK H+AYIP  H++GLSK+ R++++++RRLQ+QERL
Sbjct: 73  YNDMVIIKDIELYSLCEHHILPFFGKAHIAYIPNGHIVGLSKIPRVVDIFARRLQVQERL 132

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           T  I   I  +   +GVAV+IE  HMCM MRG+++    T T+ F G+F + + + +F 
Sbjct: 133 THDILECINETLKPQGVAVVIEASHMCMMMRGVQKQNSVTTTSGFRGQFEKIETRNEFL 191


>gi|119025428|ref|YP_909273.1| GTP cyclohydrolase I [Bifidobacterium adolescentis ATCC 15703]
 gi|118765012|dbj|BAF39191.1| GTP cyclohydrolase I [Bifidobacterium adolescentis ATCC 15703]
          Length = 211

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 113/168 (67%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  ++A+R+ L+ IG+DPDREGL DTPDR+ ++ KELFAG    P     +RF       
Sbjct: 28  EGVRQAVRLFLKSIGEDPDREGLLDTPDRIGRACKELFAGLGHGPEEVLKTRFKV----D 83

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
             +MVL++DI  FS CEHH+LP  G  H+ YIP+   V GLSKL R++E+Y+RR Q+QER
Sbjct: 84  TDEMVLVRDIELFSVCEHHLLPFHGVAHVGYIPQNGQVAGLSKLARLVELYARRPQVQER 143

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT Q+A A+    D++GV V+ E  HMCM+MRG+K+    TVT+A  G
Sbjct: 144 LTQQVADALMEGIDARGVIVVTECDHMCMAMRGVKKAQSRTVTSAVRG 191


>gi|302548444|ref|ZP_07300786.1| GTP cyclohydrolase I [Streptomyces hygroscopicus ATCC 53653]
 gi|302466062|gb|EFL29155.1| GTP cyclohydrolase I [Streptomyces himastatinicus ATCC 53653]
          Length = 214

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 116/171 (67%), Gaps = 6/171 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+R IL  +G+DPDR GLK+TP RV  +Y ELFAG +  PT    + F  G    +Q+
Sbjct: 32  EEAVRDILVAVGEDPDRRGLKETPRRVAHAYAELFAGLRVDPTDVLDTTFEEG----HQE 87

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERLT 139
           ++++ DI   S+CEHH+LP  G+ H+ Y+P +   V GLSKL R++EVY+RR Q+QERLT
Sbjct: 88  LIMVCDIEVQSFCEHHLLPFLGRAHIGYVPGESGCVAGLSKLARLVEVYARRPQVQERLT 147

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            QIA  + ++ D+ GV V++E +H CM+MRGI++ G  TVT+A  G    D
Sbjct: 148 SQIADCLHTTLDAAGVLVVVECEHTCMTMRGIRKAGARTVTSAVRGTLQSD 198


>gi|306833623|ref|ZP_07466750.1| GTP cyclohydrolase I [Streptococcus bovis ATCC 700338]
 gi|304424393|gb|EFM27532.1| GTP cyclohydrolase I [Streptococcus bovis ATCC 700338]
          Length = 187

 Score =  171 bits (434), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 119/178 (66%), Gaps = 5/178 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+  +L  +G++P+REGL DTP RV K Y+E+F+G  + P  Q T+ F       + ++V
Sbjct: 10  AVYQLLEALGENPEREGLLDTPKRVAKMYQEMFSGLNEDPKDQFTAVF----TENHDEVV 65

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           L+KDI F+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QERLT Q+
Sbjct: 66  LVKDIPFYSMCEHHLVPFYGKAHVAYLPSDGRVTGLSKLARAVEVASKRPQLQERLTDQV 125

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           A A+E +   KGV V++E +HMCM+MRGIK+    TVTT   G F  ++ + +  L +
Sbjct: 126 ATALEEALHPKGVFVMLEAEHMCMTMRGIKKPSSKTVTTVAKGIFKENREERNEILSL 183


>gi|225868481|ref|YP_002744429.1| GTP cyclohydrolase I [Streptococcus equi subsp. zooepidemicus]
 gi|225701757|emb|CAW99140.1| GTP cyclohydrolase I [Streptococcus equi subsp. zooepidemicus]
          Length = 207

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 121/175 (69%), Gaps = 7/175 (4%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           ++A+ AI  +L  IG+DP+REGL+DTP RV K Y E+ +G ++    + T+ F       
Sbjct: 25  KKAEAAIYQLLEAIGEDPNREGLRDTPKRVAKMYLEMLSGLEKDAKDEFTAVF----TEH 80

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           + D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV SRR Q+QER
Sbjct: 81  HDDLVIVKDISFYSMCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVTSRRPQLQER 140

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF--SRD 190
           LT QIA+A+  +   KGV V++E +HMCM+MRG+K+ G  T+TT   G +  SRD
Sbjct: 141 LTAQIANALVDALQPKGVFVMVEAEHMCMTMRGVKKPGSKTITTTARGIYKDSRD 195


>gi|189463795|ref|ZP_03012580.1| hypothetical protein BACINT_00128 [Bacteroides intestinalis DSM
           17393]
 gi|224535829|ref|ZP_03676368.1| hypothetical protein BACCELL_00693 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189438745|gb|EDV07730.1| hypothetical protein BACINT_00128 [Bacteroides intestinalis DSM
           17393]
 gi|224522552|gb|EEF91657.1| hypothetical protein BACCELL_00693 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 197

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 123/189 (65%), Gaps = 5/189 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P ++E KE  + I+  +G+D +REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PALDELKEHYQRIITLLGEDAEREGLLKTPERVAKAMLSLTKGYFMDPHEVLRSAKF--- 66

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 67  -KEEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKECIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTHN 203
           +F   +  N
Sbjct: 186 EFMNLIRQN 194


>gi|296133434|ref|YP_003640681.1| GTP cyclohydrolase I [Thermincola sp. JR]
 gi|296032012|gb|ADG82780.1| GTP cyclohydrolase I [Thermincola potens JR]
          Length = 188

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 120/167 (71%), Gaps = 5/167 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+++IL  IG+DP REGL DTP RV + Y+E+F+G ++ P  +D  +  F E   +++
Sbjct: 8   EQAVKMILEAIGEDPTREGLVDTPKRVARMYQEIFSGLEEDP--KDHLKVLFTE--DHEE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           MVL+KDI F+S CEHH+LP +G+ H+AYIP++  + GLSKL R +E  ++R Q+QERLT 
Sbjct: 64  MVLVKDIPFYSMCEHHLLPFFGRAHVAYIPRRGKITGLSKLARAVETIAKRPQLQERLTC 123

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            IA AI  S +  GV V++E +HMCM+MRG+K+ G  TVT+A  G F
Sbjct: 124 GIAEAIMESLNPLGVLVVVEAEHMCMTMRGVKKPGSMTVTSAVRGLF 170


>gi|228990625|ref|ZP_04150590.1| GTP cyclohydrolase 1 [Bacillus pseudomycoides DSM 12442]
 gi|228996723|ref|ZP_04156360.1| GTP cyclohydrolase 1 [Bacillus mycoides Rock3-17]
 gi|228763042|gb|EEM11952.1| GTP cyclohydrolase 1 [Bacillus mycoides Rock3-17]
 gi|228769151|gb|EEM17749.1| GTP cyclohydrolase 1 [Bacillus pseudomycoides DSM 12442]
          Length = 189

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 122/183 (66%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ ++A+R+IL  IGDDP+REG+ DTP RV K Y E+F+G  + P        H
Sbjct: 1   MAKVNLEQIEQAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE  +++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--EHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPRGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  TVTTA  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|157164234|ref|YP_001465994.1| GTP cyclohydrolase I [Campylobacter concisus 13826]
 gi|171855044|sp|A7ZB36|GCH1_CAMC1 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|112801818|gb|EAT99162.1| GTP cyclohydrolase I [Campylobacter concisus 13826]
          Length = 190

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 126/190 (66%), Gaps = 9/190 (4%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA-- 76
           E  + +++ +L  IG+DP+REGL  TP+RV K++K L +GY+Q P          G+A  
Sbjct: 3   ESFENSVKNMLTIIGEDPNREGLIKTPERVYKAFKFLTSGYEQDPKEV------LGDALF 56

Query: 77  -SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
            S   +MVL+++I F+S CEHH+LPI G++H+AYIP   V+GLSK+ R++ +Y+RRLQIQ
Sbjct: 57  TSSNNEMVLMRNIEFYSLCEHHLLPIIGRVHVAYIPNGKVVGLSKIPRMVNIYARRLQIQ 116

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           E++T QIA A+E     KGV V++E +HMC+ MRG+++   TT T+A  G F ++     
Sbjct: 117 EQMTEQIAKALEDVIAPKGVGVVVEARHMCVEMRGVEKINSTTTTSALRGCFIKNADTRR 176

Query: 196 FFLKMTHNQR 205
            F  + ++ R
Sbjct: 177 EFFSLINSPR 186


>gi|210635431|ref|ZP_03298535.1| hypothetical protein COLSTE_02466 [Collinsella stercoris DSM 13279]
 gi|210158378|gb|EEA89349.1| hypothetical protein COLSTE_02466 [Collinsella stercoris DSM 13279]
          Length = 194

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 117/182 (64%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ A+R++L  IG+DPDREGL +TPDRV + Y EL  G  +  +   +  F    A  
Sbjct: 14  EKARVAVRMLLEAIGEDPDREGLVETPDRVARMYSELCDGMDRRASEHLSKTF----AVS 69

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             D+V+ +DI+F+S CEHH+LP +GK  + YIP   V GLSKL R +EV++RRLQ+QE+L
Sbjct: 70  GDDLVIERDITFYSLCEHHMLPFYGKAAIGYIPNGRVAGLSKLARAVEVFARRLQLQEQL 129

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T Q+A A+ +  D KG  V +E +HMCM+MRG+++ G  T T A  G F  +      F 
Sbjct: 130 TAQVADALMAELDCKGAIVYMEAEHMCMTMRGVQKSGTKTATLARRGAFVENPELEARFF 189

Query: 199 KM 200
           +M
Sbjct: 190 RM 191


>gi|21221830|ref|NP_627609.1| GTP cyclohydrolase I [Streptomyces coelicolor A3(2)]
 gi|256786990|ref|ZP_05525421.1| GTP cyclohydrolase I [Streptomyces lividans TK24]
 gi|289770883|ref|ZP_06530261.1| GTP cyclohydrolase I [Streptomyces lividans TK24]
 gi|9296992|sp|Q9X8I3|GCH1_STRCO RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|4808342|emb|CAB42756.1| putative GTP cyclohydrolase I [Streptomyces coelicolor A3(2)]
 gi|289701082|gb|EFD68511.1| GTP cyclohydrolase I [Streptomyces lividans TK24]
          Length = 201

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 117/169 (69%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL++TP RV ++Y+E+FAG  Q P    T+ F  G    + 
Sbjct: 21  AENAVRELLIAVGEDPDREGLRETPARVARAYREIFAGLWQEPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  FS CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPSTSGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    + +GV V++E +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TTQIADSLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRGQL 185


>gi|289579207|ref|YP_003477834.1| GTP cyclohydrolase I [Thermoanaerobacter italicus Ab9]
 gi|297545387|ref|YP_003677689.1| GTP cyclohydrolase I [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|289528920|gb|ADD03272.1| GTP cyclohydrolase I [Thermoanaerobacter italicus Ab9]
 gi|296843162|gb|ADH61678.1| GTP cyclohydrolase I [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
          Length = 188

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 124/174 (71%), Gaps = 5/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+R IL  IG++PDREGL +TPDRV + Y+E+FAG       +D  +  F E  +
Sbjct: 5   EKIKKAVRDILEAIGENPDREGLLETPDRVARMYEEIFAGLHT--NVKDVIKI-FQE-DE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +Q+++L+KDI  +S CEHH+LP  G  H+AY+P+K  ++GLSKL RI+++ ++R Q+QER
Sbjct: 61  HQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGRILGLSKLARIVDILAKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LT +IA  I  + +  GVAV+IE +H+CM+MRG+K+ G  TVT+A  G F  D+
Sbjct: 121 LTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGVKKPGSKTVTSALRGIFRTDQ 174


>gi|94984314|ref|YP_603678.1| GTP cyclohydrolase I [Deinococcus geothermalis DSM 11300]
 gi|94554595|gb|ABF44509.1| GTP cyclohydrolase I [Deinococcus geothermalis DSM 11300]
          Length = 202

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 116/175 (66%), Gaps = 3/175 (1%)

Query: 29  LRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDI 88
           L  IG++P+REGL  TP RV K+++ L AGY Q  T  D +     EA    +MV++KDI
Sbjct: 26  LTAIGENPEREGLLKTPHRVAKAWRFLTAGYHQ--TLADAAGDAVFEAEG-SEMVIVKDI 82

Query: 89  SFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIES 148
            F+S CEHH+LP +G+ H+AYIP   ++GLSK  RI+++Y+RRLQ+QER+T QIA A+E 
Sbjct: 83  EFYSMCEHHMLPFYGRAHIAYIPDGKILGLSKFARIVDLYARRLQVQERITTQIADAVEE 142

Query: 149 STDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHN 203
               +GVAVL+EG H+CM+MRG+++   +T T+A  G F  D      F+    N
Sbjct: 143 LLSPRGVAVLMEGVHLCMAMRGVQKQNSSTTTSAMRGVFKEDARTRAEFMSAVQN 197


>gi|227539276|ref|ZP_03969325.1| GTP cyclohydrolase I [Sphingobacterium spiritivorum ATCC 33300]
 gi|227240958|gb|EEI90973.1| GTP cyclohydrolase I [Sphingobacterium spiritivorum ATCC 33300]
          Length = 210

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 118/174 (67%), Gaps = 3/174 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL+ +G+DP REGL  TP+RV K+ K L  GY   P         F E   Y  MV++KD
Sbjct: 36  ILQALGEDPAREGLLKTPERVAKALKYLTHGYDLDPAAVLKGAM-FEE--DYSQMVVVKD 92

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP +GK H+AYIP  H++GLSK+ R++++++RRLQ+QERLT +I   I+
Sbjct: 93  IEVYSLCEHHMLPFFGKAHVAYIPNGHIVGLSKIPRVVDIFARRLQVQERLTNEIRDCIQ 152

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
            +  ++GVAV++E +HMCM+MRG+++    T T+AFTG F  D  +++F   +T
Sbjct: 153 ETLGAQGVAVVMECKHMCMAMRGVQKQNSVTTTSAFTGAFQNDVTRSEFLRLIT 206


>gi|284989214|ref|YP_003407768.1| GTP cyclohydrolase I [Geodermatophilus obscurus DSM 43160]
 gi|284062459|gb|ADB73397.1| GTP cyclohydrolase I [Geodermatophilus obscurus DSM 43160]
          Length = 206

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 88/192 (45%), Positives = 123/192 (64%), Gaps = 15/192 (7%)

Query: 5   RTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPT 64
           RTGV +++        A  A+R +L  +G+DPDR GL+ TPDRV ++Y E FAG  Q P 
Sbjct: 17  RTGVDHVR--------AAAAVRELLLAVGEDPDRPGLQGTPDRVARAYAETFAGLWQDPA 68

Query: 65  TQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLV 122
               + F       + +MVL+KDI  +S CEHH++P  G  H+ YIP ++  V GLSKL 
Sbjct: 69  DVLATTFD----EDHDEMVLVKDIPMYSTCEHHLVPFHGVAHIGYIPGENGRVTGLSKLA 124

Query: 123 RILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTA 182
           R++EVY+RR Q+QER+T QIA A+      +GV V+IE +H+CM+MRGI++ G TT+T+A
Sbjct: 125 RLVEVYARRPQVQERMTSQIADALADVLKPRGVLVVIEAEHLCMAMRGIRKPGATTLTSA 184

Query: 183 FTGEFSRDKGKT 194
             G F RD   T
Sbjct: 185 VRGIF-RDNAAT 195


>gi|294786619|ref|ZP_06751873.1| GTP cyclohydrolase I [Parascardovia denticolens F0305]
 gi|294485452|gb|EFG33086.1| GTP cyclohydrolase I [Parascardovia denticolens F0305]
          Length = 214

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 115/165 (69%), Gaps = 5/165 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           K A+R+ L+ IG+DPDREGLKDTPDR+ ++ +E+F+G  Q P     +RF+       +D
Sbjct: 32  KRAVRLYLQSIGEDPDREGLKDTPDRIARASQEIFSGMSQNPRDVLGARFNVA----TED 87

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQERLTM 140
           +V+++DI F+S CEHH+LP  G  H+ YIP K+ V+GLSKL R+++V++ R QIQER+T 
Sbjct: 88  LVVVRDIEFYSVCEHHLLPFHGLAHIGYIPDKNRVVGLSKLARLVQVFAHRPQIQERMTQ 147

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           QIA A+     +KG  V+ + +HMCMSMRG+K     TVT+A  G
Sbjct: 148 QIADALMDELGAKGAIVITDCEHMCMSMRGVKESQARTVTSAVRG 192


>gi|319955768|ref|YP_004167031.1| GTP cyclohydrolase i [Nitratifractor salsuginis DSM 16511]
 gi|319418172|gb|ADV45282.1| GTP cyclohydrolase I [Nitratifractor salsuginis DSM 16511]
          Length = 193

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 85/175 (48%), Positives = 120/175 (68%), Gaps = 4/175 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R IL  +G+DPDREGL  TP RV K+ + L  GY + P  +   +  F   S   +MV
Sbjct: 11  AVRTILENLGEDPDREGLLKTPHRVAKALEFLTEGYHKDPE-EILKKALF--TSSNDEMV 67

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           L++DI F+S CEHH+LPI G+ H+AYIP   V+GLSK+ R++ +++RRLQIQE+LT QIA
Sbjct: 68  LVRDIEFYSLCEHHMLPIIGRAHVAYIPDGKVVGLSKIPRVVNLFARRLQIQEQLTEQIA 127

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
            AI  +   KGVAV+I  +HMCM MRG+++   TTVT+A  G F +D + + +F+
Sbjct: 128 DAISDTIHPKGVAVVIHARHMCMEMRGVEKINSTTVTSALRGLFKKDIRTRNEFY 182


>gi|291516357|emb|CBK69973.1| GTP cyclohydrolase I [Bifidobacterium longum subsp. longum F8]
          Length = 199

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 115/168 (68%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  +EA+R+ L+ IG+DP+REGL +TPDR+ ++ +ELFAG +  P   D    HF     
Sbjct: 18  EGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQASPA--DVLEKHFD--VD 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
             ++VL+KDI  +S CEHH+LP  G  H+ YIP K  V+GLSKL R++EVY+RR Q+QER
Sbjct: 74  TDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYARRPQVQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+     ++GV V+ E +H+CMSMRGIK+    TVT+A  G
Sbjct: 134 LTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG 181


>gi|255318418|ref|ZP_05359651.1| GTP cyclohydrolase I [Acinetobacter radioresistens SK82]
 gi|262378648|ref|ZP_06071805.1| GTP cyclohydrolase I [Acinetobacter radioresistens SH164]
 gi|255304410|gb|EET83594.1| GTP cyclohydrolase I [Acinetobacter radioresistens SK82]
 gi|262299933|gb|EEY87845.1| GTP cyclohydrolase I [Acinetobacter radioresistens SH164]
          Length = 184

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 116/172 (67%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +R GLKDTP R  K++  L +GY K +    + + F     S  ++MVL+K
Sbjct: 10  ILTAVGEDLNRPGLKDTPMRAAKAFSYLTSGYSKTLEEVTNNAVF----PSDNREMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+ +V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 66  NIEFYSLCEHHLLPFYGRVHIAYLPEGNVLGLSKFARITEMFARRLQIQENLTQQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 126 AEVTQARGVAVMIDSAHMCMMMRGVGKQESTTRTVSFIGDFKTDKEARREFL 177


>gi|153855133|ref|ZP_01996317.1| hypothetical protein DORLON_02330 [Dorea longicatena DSM 13814]
 gi|149752302|gb|EDM62233.1| hypothetical protein DORLON_02330 [Dorea longicatena DSM 13814]
          Length = 185

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 120/182 (65%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+R++L  +G+D +REGL DTPDR+ + Y+E++ G  +      +  F       
Sbjct: 5   EKIEQAVRLLLEGMGEDVNREGLIDTPDRIARMYEEIYGGMDEDAGKHLSKTF----TVD 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MV+ KDI+F+S CEHH+LP +GK H+AYIP   V+GLSKL R +EV++RRLQ+QE+L
Sbjct: 61  SHEMVIEKDITFYSTCEHHLLPFYGKAHIAYIPDGKVVGLSKLARTVEVFARRLQLQEQL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA A+      +G  V+IE +HMCM+MRGIK+ G  TVT A  G F  D    + F 
Sbjct: 121 TGQIADALMEHMQPEGAIVMIEAEHMCMTMRGIKKPGSQTVTIARRGVFETDPVLEERFF 180

Query: 199 KM 200
           +M
Sbjct: 181 RM 182


>gi|229084614|ref|ZP_04216883.1| GTP cyclohydrolase 1 [Bacillus cereus Rock3-44]
 gi|228698690|gb|EEL51406.1| GTP cyclohydrolase 1 [Bacillus cereus Rock3-44]
          Length = 189

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 121/183 (66%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ ++A+R+IL  IGDDP+REG+ DTP RV K Y E+F+G  + P        H
Sbjct: 1   MAKVNLEQIEQAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R +E  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPRGGKVTGLSKLARTVETIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  TVTT+  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTSVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|312133976|ref|YP_004001315.1| fole [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773275|gb|ADQ02763.1| FolE [Bifidobacterium longum subsp. longum BBMN68]
          Length = 199

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 115/168 (68%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  +EA+R+ L+ IG+DP+REGL +TPDR+ ++ +ELFAG +  P   D    HF     
Sbjct: 18  EGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQASPA--DVLEKHFD--VD 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
             ++VL+KDI  +S CEHH+LP  G  H+ YIP K  V+GLSKL R++EVY+RR Q+QER
Sbjct: 74  TDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYARRPQVQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+     ++GV V+ E +H+CMSMRGIK+    TVT+A  G
Sbjct: 134 LTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG 181


>gi|134299612|ref|YP_001113108.1| GTP cyclohydrolase I [Desulfotomaculum reducens MI-1]
 gi|172044294|sp|A4J5D0|GCH1_DESRM RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|134052312|gb|ABO50283.1| GTP cyclohydrolase I [Desulfotomaculum reducens MI-1]
          Length = 187

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 121/174 (69%), Gaps = 9/174 (5%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE--ASKY 79
           ++A+++IL  IG+DP+REGL++TP RV + Y+E+FAG  + P        H G+  + ++
Sbjct: 8   EKAVKMILEAIGEDPNREGLEETPARVARMYQEIFAGLGEDPEE------HLGKTFSEEH 61

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERL 138
           ++MV++KDI  FS CEHH++P  GK H+ YIP+  +V GLSKL R++  Y+RR Q+QERL
Sbjct: 62  EEMVIVKDIRLFSMCEHHLIPFIGKAHVCYIPRNGNVTGLSKLARLVNGYARRPQLQERL 121

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           T QIA AI    +  GV V++E +H+CMSMRG++  G  TVT+A  G F +++ 
Sbjct: 122 TKQIADAIMKRLNPYGVVVVVEAEHLCMSMRGVRSPGARTVTSAVRGIFKKNEA 175


>gi|308175889|ref|YP_003915295.1| GTP cyclohydrolase I [Arthrobacter arilaitensis Re117]
 gi|307743352|emb|CBT74324.1| GTP cyclohydrolase I [Arthrobacter arilaitensis Re117]
          Length = 192

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 109/166 (65%), Gaps = 6/166 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R IL  IG+DPDR+GL DTP RV K+Y E FAG  Q       + F      ++ +MV
Sbjct: 15  AVREILEAIGEDPDRDGLVDTPKRVAKAYAEFFAGLHQDAADHLATTFDI----EHDEMV 70

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           L+KDI F+S CEHH++P +G  H+ YIP K   V GLSKL R++EVY+RR Q+QERLT Q
Sbjct: 71  LVKDIPFYSTCEHHLVPFYGSAHIGYIPGKGGKVTGLSKLARLVEVYARRPQVQERLTTQ 130

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           I  A+       G  V++E +HMCMSMRG+++ G  TVT+A  G+ 
Sbjct: 131 IVDALVEHLSPSGAIVVVECEHMCMSMRGVRKPGAKTVTSAVRGQL 176


>gi|300780436|ref|ZP_07090292.1| GTP cyclohydrolase I [Corynebacterium genitalium ATCC 33030]
 gi|300534546|gb|EFK55605.1| GTP cyclohydrolase I [Corynebacterium genitalium ATCC 33030]
          Length = 230

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 120/184 (65%), Gaps = 6/184 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  +G+DPDREGL DTP RV ++Y+E+FAG    PT      F    A  
Sbjct: 48  ERAEAAVRELLLAVGEDPDREGLVDTPARVARAYEEVFAGLHVDPTEVLDKTF----AEN 103

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           ++++VL++D+  +S CEHH++P +G  H+ YIP    HV GLSKL R+ ++Y++R Q+QE
Sbjct: 104 HEELVLVRDVPIYSTCEHHLVPFYGVAHIGYIPGSDGHVTGLSKLARLADMYAKRPQVQE 163

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT QIA A+     ++ V V+IE +H+CM+MRGI++ G TT T+A  G F R+      
Sbjct: 164 RLTSQIADALVDKLQAQSVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFKRNAASRAE 223

Query: 197 FLKM 200
            L +
Sbjct: 224 VLSL 227


>gi|261404724|ref|YP_003240965.1| GTP cyclohydrolase I [Paenibacillus sp. Y412MC10]
 gi|261281187|gb|ACX63158.1| GTP cyclohydrolase I [Paenibacillus sp. Y412MC10]
          Length = 197

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 120/182 (65%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ +  +  IL+ IG+DP REGL +TP RV + Y+E+FAGY+  P  +D     F E   
Sbjct: 17  EQIEYHVEQILKLIGEDPKREGLLETPARVTRMYEEIFAGYEVDP--KDVLGVTFDE--N 72

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           ++++V++KDI ++S CEHH+ P +GK+H+ Y+P   + GLSKL R++E  +RRLQ+QER+
Sbjct: 73  HEELVIVKDIVYYSQCEHHMAPFFGKVHIGYVPSGKIAGLSKLARLVEAVTRRLQVQERI 132

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA  +  +    GV V++EG+H+CM  RG+K+ G  TVT+A  G F  D  +   FL
Sbjct: 133 TSQIADIMVEALQPNGVMVVVEGEHLCMCARGVKKPGSKTVTSAVRGTFQSDSAQRSEFL 192

Query: 199 KM 200
            +
Sbjct: 193 SL 194


>gi|20804340|emb|CAD31124.1| GTP cyclohydrolase [Streptococcus pyogenes]
          Length = 194

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 115/168 (68%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F       
Sbjct: 12  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EH 67

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 68  HEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G
Sbjct: 128 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARG 175


>gi|29349339|ref|NP_812842.1| GTP cyclohydrolase I [Bacteroides thetaiotaomicron VPI-5482]
 gi|253570314|ref|ZP_04847723.1| GTP cyclohydrolase I [Bacteroides sp. 1_1_6]
 gi|298384872|ref|ZP_06994431.1| GTP cyclohydrolase I [Bacteroides sp. 1_1_14]
 gi|41017188|sp|Q8A0U0|GCH1_BACTN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|29341247|gb|AAO79036.1| GTP cyclohydrolase I [Bacteroides thetaiotaomicron VPI-5482]
 gi|251840695|gb|EES68777.1| GTP cyclohydrolase I [Bacteroides sp. 1_1_6]
 gi|298262016|gb|EFI04881.1| GTP cyclohydrolase I [Bacteroides sp. 1_1_14]
          Length = 196

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 121/190 (63%), Gaps = 5/190 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFG 74
           P +EE K     I+  +G+D  REGL  TP+RV K+   L  GY   P     +++F   
Sbjct: 10  PNLEELKSHYHSIITLLGEDAGREGLLKTPERVAKAMLSLTKGYHMDPHEVLRSAKFQ-- 67

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+
Sbjct: 68  --EEYSQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQV 125

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + 
Sbjct: 126 QERMTLQIKDCIQETLNPLGVMVVVEAKHMCMQMRGVEKQNSITTTSDFTGAFNQAKTRE 185

Query: 195 DFFLKMTHNQ 204
           +F   + H +
Sbjct: 186 EFMNLIQHGR 195


>gi|224025791|ref|ZP_03644157.1| hypothetical protein BACCOPRO_02533 [Bacteroides coprophilus DSM
           18228]
 gi|224019027|gb|EEF77025.1| hypothetical protein BACCOPRO_02533 [Bacteroides coprophilus DSM
           18228]
          Length = 197

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 115/171 (67%), Gaps = 5/171 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+DP+REGL  TP+RV K+   L  GY+  P    + ++F       Y  MV++K
Sbjct: 24  ILSLLGEDPEREGLLKTPERVAKAMLTLTRGYEVDPKAVLNAAKF----KEPYSQMVIVK 79

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+QER+T+QI   I
Sbjct: 80  DIDFFSMCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQVQERMTLQIKECI 139

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           + + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + +F 
Sbjct: 140 QETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAFNQAKTREEFM 190


>gi|196033603|ref|ZP_03101015.1| GTP cyclohydrolase I [Bacillus cereus W]
 gi|228926641|ref|ZP_04089710.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229160561|ref|ZP_04288556.1| GTP cyclohydrolase 1 [Bacillus cereus R309803]
 gi|229172248|ref|ZP_04299812.1| GTP cyclohydrolase 1 [Bacillus cereus MM3]
 gi|195994037|gb|EDX57993.1| GTP cyclohydrolase I [Bacillus cereus W]
 gi|228611236|gb|EEK68494.1| GTP cyclohydrolase 1 [Bacillus cereus MM3]
 gi|228622971|gb|EEK79802.1| GTP cyclohydrolase 1 [Bacillus cereus R309803]
 gi|228833017|gb|EEM78585.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 189

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 120/183 (65%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ + A+R+IL  IGDDP+REG+ DTP RV K Y E+FAG  + P        H
Sbjct: 1   MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFAGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  TVTTA  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|15805077|ref|NP_293762.1| GTP cyclohydrolase I [Deinococcus radiodurans R1]
 gi|9296985|sp|Q9RYB4|GCH1_DEIRA RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|6457696|gb|AAF09628.1|AE001867_3 GTP cyclohydrolase I [Deinococcus radiodurans R1]
          Length = 216

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 113/165 (68%), Gaps = 3/165 (1%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLI 85
           R  L  IG+DPDREGL+ TP RV K++  +  GY Q    Q      F  A++  +MV++
Sbjct: 37  REWLAAIGEDPDREGLQRTPQRVAKAWAYMTEGYGQT-LAQVVGEGVF--AAEGSEMVIV 93

Query: 86  KDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHA 145
           KDI F+S CEHH+LP +G+ H+AYIP   ++GLSK  RI+++YSRRLQ+QER+T Q+A A
Sbjct: 94  KDIEFYSMCEHHMLPFYGRAHVAYIPGTRILGLSKFARIVDLYSRRLQVQERITTQVADA 153

Query: 146 IESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +E     KGVAVL+EG H+CM+MRG+++   +T T+A  G F  D
Sbjct: 154 VEELLAPKGVAVLMEGIHLCMAMRGVQKQNSSTTTSAMRGLFRSD 198


>gi|315226206|ref|ZP_07867994.1| GTP cyclohydrolase I [Parascardovia denticolens DSM 10105]
 gi|315120338|gb|EFT83470.1| GTP cyclohydrolase I [Parascardovia denticolens DSM 10105]
          Length = 217

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 115/165 (69%), Gaps = 5/165 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           K A+R+ L+ IG+DPDREGLKDTPDR+ ++ +E+F+G  Q P     +RF+       +D
Sbjct: 35  KRAVRLYLQSIGEDPDREGLKDTPDRIARASQEIFSGMSQNPRDVLGARFNVA----TED 90

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQERLTM 140
           +V+++DI F+S CEHH+LP  G  H+ YIP K+ V+GLSKL R+++V++ R QIQER+T 
Sbjct: 91  LVVVRDIEFYSVCEHHLLPFHGLAHIGYIPDKNRVVGLSKLARLVQVFAHRPQIQERMTQ 150

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           QIA A+     +KG  V+ + +HMCMSMRG+K     TVT+A  G
Sbjct: 151 QIADALMDELGAKGAIVITDCEHMCMSMRGVKESQARTVTSAVRG 195


>gi|229029290|ref|ZP_04185380.1| GTP cyclohydrolase 1 [Bacillus cereus AH1271]
 gi|228732038|gb|EEL82930.1| GTP cyclohydrolase 1 [Bacillus cereus AH1271]
          Length = 189

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 120/183 (65%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ + A+R+IL  IGDDP+REG+ DTP RV K Y E+FAG  + P        H
Sbjct: 1   MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFAGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  TVTTA  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|198277658|ref|ZP_03210189.1| hypothetical protein BACPLE_03881 [Bacteroides plebeius DSM 17135]
 gi|198269355|gb|EDY93625.1| hypothetical protein BACPLE_03881 [Bacteroides plebeius DSM 17135]
          Length = 198

 Score =  171 bits (432), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 115/171 (67%), Gaps = 5/171 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+DP+REGL  TP+RV K+   L  GY+  P    + ++F       Y  MV++K
Sbjct: 25  ILSLLGEDPEREGLLKTPERVAKAMLTLTRGYEMDPREVLNAAKF----KEPYSQMVIVK 80

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++++S RLQ+QER+T+QI   I
Sbjct: 81  DIDFFSMCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFSHRLQVQERMTLQIKECI 140

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           + + +  GV V++E +HMCM MRG+++    T T+ FTG F++ K + +F 
Sbjct: 141 QETLNPLGVMVVVEAKHMCMQMRGVEKQNSVTTTSDFTGAFNQAKTREEFM 191


>gi|19553889|ref|NP_601891.1| GTP cyclohydrolase I [Corynebacterium glutamicum ATCC 13032]
 gi|62391532|ref|YP_226934.1| GTP cyclohydrolase I [Corynebacterium glutamicum ATCC 13032]
 gi|41326874|emb|CAF20718.1| GTP CYCLOHYDROLASE [Corynebacterium glutamicum ATCC 13032]
          Length = 201

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 118/174 (67%), Gaps = 6/174 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A  AIR +L  +G+DPDREGL +TP RV ++YKE FAG  + PTT     F  G    
Sbjct: 18  ERATAAIRELLIAVGEDPDREGLLETPARVARAYKETFAGLHEDPTTVLEKTFSEG---- 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++VL+++I  +S CEHH++P +G  H+ YIP K   V GLSKL R+ +++++R Q+QE
Sbjct: 74  HEELVLVREIPIYSMCEHHLVPFFGVAHIGYIPGKSGKVTGLSKLARLADMFAKRPQVQE 133

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLT QIA A+    D++ VAV+IE +H+CM+MRGI++ G  T T+A  G F  +
Sbjct: 134 RLTSQIADALVEKLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAVRGGFKNN 187


>gi|148553506|ref|YP_001261088.1| GTP cyclohydrolase [Sphingomonas wittichii RW1]
 gi|148498696|gb|ABQ66950.1| GTP cyclohydrolase [Sphingomonas wittichii RW1]
          Length = 206

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 115/179 (64%), Gaps = 2/179 (1%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           K K    E  +EAIR ++RW GD+PDREGL DTP RV +++KE   GY + P+   +  F
Sbjct: 16  KGKIAVPEHVQEAIRTLIRWSGDNPDREGLLDTPSRVGRAWKEYCQGYDEDPSVHLSRTF 75

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
              E   Y ++VL++DI F S+CEHH+ PI G  H+AY+P   V+G+SKL R+L  ++RR
Sbjct: 76  E--EVGGYDEIVLLRDIPFQSHCEHHMAPIIGHAHIAYLPHSRVVGISKLARVLHGFARR 133

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           LQIQERLT +IA  I ++ +  GVAV+I   H CM+ RG++  G+   T+   G F  D
Sbjct: 134 LQIQERLTAEIADCIWTNLEPLGVAVVIHATHACMTARGVRTPGVGMTTSRMMGVFRDD 192


>gi|290958425|ref|YP_003489607.1| GTP cyclohydrolase I [Streptomyces scabiei 87.22]
 gi|260647951|emb|CBG71056.1| putative GTP cyclohydrolase I [Streptomyces scabiei 87.22]
          Length = 201

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 117/169 (69%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGLK+TP RV ++Y+E+FAG  Q P    T+ F  G    + 
Sbjct: 21  AENAVRELLIAVGEDPDREGLKETPARVARAYQEIFAGLWQQPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  +S CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QER+
Sbjct: 77  EMVLVKDIEVYSTCEHHLVPFRGVAHVGYIPSTSGKITGLSKLARLVDVYARRPQVQERM 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    + +GV V++E +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TTQIADSLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTITSAVRGQL 185


>gi|154174139|ref|YP_001407434.1| GTP cyclohydrolase I [Campylobacter curvus 525.92]
 gi|166989686|sp|A7GW42|GCH1_CAMC5 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|112803226|gb|EAU00570.1| GTP cyclohydrolase I [Campylobacter curvus 525.92]
          Length = 190

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 125/181 (69%), Gaps = 6/181 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEAS 77
           E  + +++ IL+ IG+DP+REGL  TP RV K++K L +GY++ P    + + F     S
Sbjct: 3   ESFENSVKNILKIIGEDPNREGLLKTPSRVYKAFKFLTSGYEEDPKEVLNDALF----TS 58

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              +MVL+++I F+S CEHH+LPI G++H+AYIP   V+GLSK+ R++ +Y+RRLQIQE+
Sbjct: 59  SNNEMVLMRNIEFYSLCEHHLLPIIGRVHVAYIPNGKVVGLSKIPRMVNIYARRLQIQEQ 118

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDF 196
           +T QIA A+    + KGV V++E +HMC+ MRG+++   TT T+A  G F ++   + +F
Sbjct: 119 MTEQIAQALAEVIEPKGVGVVVEARHMCVEMRGVQKINSTTTTSALRGCFIKNADTRREF 178

Query: 197 F 197
           F
Sbjct: 179 F 179


>gi|302544354|ref|ZP_07296696.1| GTP cyclohydrolase I [Streptomyces hygroscopicus ATCC 53653]
 gi|302461972|gb|EFL25065.1| GTP cyclohydrolase I [Streptomyces himastatinicus ATCC 53653]
          Length = 201

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 122/183 (66%), Gaps = 13/183 (7%)

Query: 7   GVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQ 66
           GVF+ K        A+ AIR +L  +G+DPDREGL++TP RV ++YKE+FAG +Q P   
Sbjct: 14  GVFDEK-------RAENAIRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLRQEPEDV 66

Query: 67  DTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRI 124
            T+ F  G    + +MVL+KDI   S CEHH++P  G  H+ YIP     + GLSKL R+
Sbjct: 67  LTTTFDLG----HDEMVLVKDIEVMSSCEHHLVPFVGVAHVGYIPSHDGKITGLSKLARL 122

Query: 125 LEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFT 184
           ++V++RR Q+QERLT QIA ++    + +GV V++E +HMCM+MRG+++ G  T+T+A  
Sbjct: 123 VDVFARRPQVQERLTTQIADSLMRILEPRGVIVVVECEHMCMTMRGVRKPGAKTLTSAVR 182

Query: 185 GEF 187
           G+ 
Sbjct: 183 GQL 185


>gi|317128574|ref|YP_004094856.1| GTP cyclohydrolase I [Bacillus cellulosilyticus DSM 2522]
 gi|315473522|gb|ADU30125.1| GTP cyclohydrolase I [Bacillus cellulosilyticus DSM 2522]
          Length = 188

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 115/170 (67%), Gaps = 5/170 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+ +IL  IG+DP+REGL DTP RV + Y+E+F G KQ P     + F       +++
Sbjct: 10  QQAVTMILEAIGEDPNREGLLDTPKRVARMYEEVFEGVKQDPKEHFATVF----GEDHEE 65

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           +VL+KDI F+S CEHH++P +GK H+ YIPK   V GLSKL R LE  +RR Q+QER+T 
Sbjct: 66  LVLVKDIPFYSMCEHHLVPFYGKAHIGYIPKGGKVTGLSKLARALEAVTRRPQLQERITS 125

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            +A +I  + +  GV V++E +HMCM+MRG+K+ G  TVT+A  G F  +
Sbjct: 126 TVADSIVDTLEPLGVIVVVEAEHMCMTMRGVKKPGSKTVTSAVRGAFENN 175


>gi|307327052|ref|ZP_07606242.1| GTP cyclohydrolase I [Streptomyces violaceusniger Tu 4113]
 gi|306887350|gb|EFN18346.1| GTP cyclohydrolase I [Streptomyces violaceusniger Tu 4113]
          Length = 201

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 122/183 (66%), Gaps = 13/183 (7%)

Query: 7   GVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQ 66
           GVF+ K        A+ AIR +L  +G+DPDREGL++TP RV ++YKE+FAG +Q P   
Sbjct: 14  GVFDEK-------RAENAIRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLRQEPEDV 66

Query: 67  DTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRI 124
            T+ F  G    + +MVL+KDI   S CEHH++P  G  H+ YIP     + GLSKL R+
Sbjct: 67  LTTTFDLG----HDEMVLVKDIEVMSSCEHHLVPFVGVAHVGYIPSHDGKITGLSKLARL 122

Query: 125 LEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFT 184
           ++V++RR Q+QERLT Q+A ++    + +GV V++E +HMCM+MRG+++ G  T+T+A  
Sbjct: 123 VDVFARRPQVQERLTTQVAESLMRILEPRGVIVVVECEHMCMTMRGVRKPGAKTLTSAVR 182

Query: 185 GEF 187
           G+ 
Sbjct: 183 GQL 185


>gi|317133036|ref|YP_004092350.1| GTP cyclohydrolase I [Ethanoligenens harbinense YUAN-3]
 gi|315471015|gb|ADU27619.1| GTP cyclohydrolase I [Ethanoligenens harbinense YUAN-3]
          Length = 189

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 122/173 (70%), Gaps = 5/173 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A  AIR +L  +G++PDR GL++TP+RV + Y+ELFAG ++ P  +D   F  G    
Sbjct: 5   ERAARAIRELLAAVGENPDRPGLQETPERVARMYEELFAGLERDPL-EDVKLFGEGLPD- 62

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
             ++V+++DI F+S CEHH+LP +G+ H+AY+P+   ++GLSKL RI++  +R+ Q+QER
Sbjct: 63  --ELVVVRDIPFYSMCEHHLLPFYGQAHIAYLPRDGRILGLSKLARIVDTLARKPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           LT +IA A+E +  ++GVAV++  +H+CM+MRGIK+ G  TVT+   GE   D
Sbjct: 121 LTTEIADAVERAATTRGVAVVVVAEHLCMTMRGIKKPGAKTVTSRSIGELKTD 173


>gi|227546579|ref|ZP_03976628.1| GTP cyclohydrolase I [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|322691767|ref|YP_004221337.1| GTP cyclohydrolase [Bifidobacterium longum subsp. longum JCM 1217]
 gi|227212896|gb|EEI80775.1| GTP cyclohydrolase I [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|320456623|dbj|BAJ67245.1| GTP cyclohydrolase [Bifidobacterium longum subsp. longum JCM 1217]
          Length = 199

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 115/168 (68%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  +EA+R+ L+ IG+DP+REGL +TPDR+ ++ +ELFAG +  P   D    HF     
Sbjct: 18  EGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQASPA--DVLEKHFD--VD 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
             ++VL+KDI  +S CEHH+LP  G  H+ YIP K  V+GLSKL R++EVY+RR Q+QER
Sbjct: 74  TDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYARRPQVQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+     ++GV V+ E +H+CMSMRGIK+    TVT+A  G
Sbjct: 134 LTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG 181


>gi|317404099|gb|EFV84551.1| GTP cyclohydrolase 1 2 [Achromobacter xylosoxidans C54]
          Length = 181

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 114/174 (65%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+DP REGL DTP R  K+ + L  GY Q +    + + F     S  +++VL+K
Sbjct: 10  ILEALGEDPSREGLADTPARAAKAMRHLCRGYNQNLEEIVNGALF----TSDTREIVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I  +S CEHH+LP  GK H+AY+P   V+GLSK+ RI+E+Y+RRLQIQE L+ Q+A A+
Sbjct: 66  NIELYSLCEHHMLPFIGKAHVAYLPNGKVLGLSKVARIVEMYARRLQIQENLSRQVAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +S T + GVAV+IE QHMCM MRG+++   + VT+   GEF  +      FL +
Sbjct: 126 QSVTGAAGVAVVIEAQHMCMMMRGVEKQNSSMVTSVMLGEFHDNPSTRAEFLSL 179


>gi|300770748|ref|ZP_07080627.1| GTP cyclohydrolase I [Sphingobacterium spiritivorum ATCC 33861]
 gi|300763224|gb|EFK60041.1| GTP cyclohydrolase I [Sphingobacterium spiritivorum ATCC 33861]
          Length = 210

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 118/174 (67%), Gaps = 3/174 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL+ +G+DP REGL  TP+RV K+ K L  GY   P         F E   Y  MV++KD
Sbjct: 36  ILQALGEDPAREGLLKTPERVAKALKFLTHGYDLDPAAVLKGAM-FEE--DYSQMVVVKD 92

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP +GK H+AYIP  H++GLSK+ R++++++RRLQ+QERLT +I   I+
Sbjct: 93  IEVYSLCEHHMLPFFGKAHVAYIPNGHIVGLSKIPRVVDIFARRLQVQERLTNEIRDCIQ 152

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
            +  ++GVAV++E +HMCM+MRG+++    T T+AFTG F  D  +++F   +T
Sbjct: 153 ETLGAQGVAVVMECKHMCMAMRGVQKQNSVTTTSAFTGAFQNDVTRSEFLRLIT 206


>gi|295696396|ref|YP_003589634.1| GTP cyclohydrolase I [Bacillus tusciae DSM 2912]
 gi|295411998|gb|ADG06490.1| GTP cyclohydrolase I [Bacillus tusciae DSM 2912]
          Length = 207

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 123/174 (70%), Gaps = 5/174 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           V++ + A+R+IL  IG+DP+REGL+DTP RV + Y+E+F G  Q P  +  + F+     
Sbjct: 24  VDKIQTAVRMILEAIGEDPEREGLQDTPARVARMYQEVFRGLHQDPREELNAIFNI---- 79

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQE 136
           +++++VL++DI F+S CEHH++P +GK H+AY+P+   V GLSKL R++E  +RR Q+QE
Sbjct: 80  EHEELVLVRDILFYSMCEHHLVPFFGKAHVAYLPRGGRVTGLSKLARLVETVARRPQLQE 139

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           R+T  +A AI    +++G  V++E +HMCM+MRG+ + G  TVT+A  G F +D
Sbjct: 140 RITSTVADAIMDKLEARGAVVVLEAEHMCMTMRGVNKPGSQTVTSAVRGVFLQD 193


>gi|317482114|ref|ZP_07941138.1| GTP cyclohydrolase I [Bifidobacterium sp. 12_1_47BFAA]
 gi|322689828|ref|YP_004209562.1| GTP cyclohydrolase [Bifidobacterium longum subsp. infantis 157F]
 gi|316916473|gb|EFV37871.1| GTP cyclohydrolase I [Bifidobacterium sp. 12_1_47BFAA]
 gi|320461164|dbj|BAJ71784.1| GTP cyclohydrolase [Bifidobacterium longum subsp. infantis 157F]
          Length = 199

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 115/168 (68%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  +EA+R+ L+ IG+DP+REGL +TPDR+ ++ +ELFAG +  P   D    HF     
Sbjct: 18  EGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQASPA--DVLEKHFD--VD 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
             ++VL+KDI  +S CEHH+LP  G  H+ YIP K  V+GLSKL R++EVY+RR Q+QER
Sbjct: 74  TDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYARRPQVQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+     ++GV V+ E +H+CMSMRGIK+    TVT+A  G
Sbjct: 134 LTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG 181


>gi|328774287|gb|EGF84324.1| hypothetical protein BATDEDRAFT_9124 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 211

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 83/186 (44%), Positives = 119/186 (63%), Gaps = 5/186 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEA 76
           +E   E+++ IL  +G+D DREGL  TP R  K+      GY++ + T  + + F     
Sbjct: 28  LESMAESVQSILNCVGEDADREGLVKTPMRYAKALMFFTKGYEENLATVVNDAVFE---- 83

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             + +MV++KDI  FS CEHH++P  GKIH+ Y+P K V+GLSK  RI E++SRRLQ+QE
Sbjct: 84  EDHDEMVIVKDIDVFSLCEHHMVPFTGKIHIGYLPDKRVMGLSKFARIAEMFSRRLQVQE 143

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT Q+A AI+     +GVAV++E  HMCM MRG+++ G TT+T+   GEF  D    + 
Sbjct: 144 RLTKQVAVAIDEILKPRGVAVIMEATHMCMVMRGVQKPGSTTITSCMLGEFRNDPKTREE 203

Query: 197 FLKMTH 202
           FL +T 
Sbjct: 204 FLSLTQ 209


>gi|213691455|ref|YP_002322041.1| GTP cyclohydrolase I [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|213522916|gb|ACJ51663.1| GTP cyclohydrolase I [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|320457527|dbj|BAJ68148.1| GTP cyclohydrolase [Bifidobacterium longum subsp. infantis ATCC
           15697]
          Length = 193

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 115/168 (68%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  +EA+R+ L+ IG+DP+REGL +TPDR+ ++ +ELFAG +  P   D    HF     
Sbjct: 12  EGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQASPA--DVLEKHFD--VD 67

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
             ++VL+KDI  +S CEHH+LP  G  H+ YIP K  V+GLSKL R++EVY+RR Q+QER
Sbjct: 68  TDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYARRPQVQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+     ++GV V+ E +H+CMSMRGIK+    TVT+A  G
Sbjct: 128 LTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG 175


>gi|23821576|sp|Q8NM84|GCH1_CORGL RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|21325467|dbj|BAC00089.1| GTP cyclohydrolase I [Corynebacterium glutamicum ATCC 13032]
          Length = 196

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 118/174 (67%), Gaps = 6/174 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A  AIR +L  +G+DPDREGL +TP RV ++YKE FAG  + PTT     F  G    
Sbjct: 13  ERATAAIRELLIAVGEDPDREGLLETPARVARAYKETFAGLHEDPTTVLEKTFSEG---- 68

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++VL+++I  +S CEHH++P +G  H+ YIP K   V GLSKL R+ +++++R Q+QE
Sbjct: 69  HEELVLVREIPIYSMCEHHLVPFFGVAHIGYIPGKSGKVTGLSKLARLADMFAKRPQVQE 128

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLT QIA A+    D++ VAV+IE +H+CM+MRGI++ G  T T+A  G F  +
Sbjct: 129 RLTSQIADALVEKLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAVRGGFKNN 182


>gi|91217460|ref|ZP_01254419.1| GTP cyclohydrolase I [Psychroflexus torquis ATCC 700755]
 gi|91184345|gb|EAS70729.1| GTP cyclohydrolase I [Psychroflexus torquis ATCC 700755]
          Length = 194

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 115/183 (62%), Gaps = 3/183 (1%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P V+E K +   IL+ IG+D  R G+  TP+R  K+ + L  GY   P         F 
Sbjct: 11  QPYVDEIKSSYESILKNIGEDTTRNGIVKTPERAAKAMRFLTQGYNMNPEEILLGAM-FE 69

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y+DMVLIKDI  +S CEHH+LP +GK+H+ YIP   ++GLSK+ RI++V++RRLQ+
Sbjct: 70  EP--YEDMVLIKDIELYSLCEHHMLPFFGKVHVGYIPNGKIVGLSKIPRIVDVFARRLQV 127

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QERLT  I   I  +   KGV V+IE QHMCM MRG+++    T T+ F GEF   + ++
Sbjct: 128 QERLTHDILECINDTLQPKGVGVVIEAQHMCMMMRGVQKQNSATTTSGFRGEFKNQETRS 187

Query: 195 DFF 197
           +F 
Sbjct: 188 EFL 190


>gi|325105591|ref|YP_004275245.1| GTP cyclohydrolase I [Pedobacter saltans DSM 12145]
 gi|324974439|gb|ADY53423.1| GTP cyclohydrolase I [Pedobacter saltans DSM 12145]
          Length = 211

 Score =  170 bits (431), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 118/170 (69%), Gaps = 3/170 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  IG+D  R+GL  TP+R  K+ + L  GY      ++  R    E  +Y  MV++KD
Sbjct: 36  ILNEIGEDTSRDGLLKTPERYAKALQFLTHGYDL--NAEEILRSAMFE-EEYSQMVIVKD 92

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHHI+P +GK H+AYIP  H++GLSK+ RI++V++RRLQ+QERLT +I   I+
Sbjct: 93  IEVYSLCEHHIIPFFGKAHIAYIPNGHIVGLSKIPRIVDVFARRLQVQERLTNEIRDCIQ 152

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           ++ +  GVAV++E +HMCMSMRGI++    T T+AFTGEF+ D+ +++F 
Sbjct: 153 NTLNPAGVAVVLECKHMCMSMRGIQKQNSVTTTSAFTGEFANDRTRSEFL 202


>gi|303242180|ref|ZP_07328669.1| GTP cyclohydrolase I [Acetivibrio cellulolyticus CD2]
 gi|302590262|gb|EFL60021.1| GTP cyclohydrolase I [Acetivibrio cellulolyticus CD2]
          Length = 187

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 117/173 (67%), Gaps = 5/173 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  K A+R IL  IG++PDREGL +TPDRV + Y+E+FAG  Q P           +   
Sbjct: 5   ERVKAAVREILIAIGENPDREGLLETPDRVARMYEEIFAGLHQDPK----ELVKVFQEEN 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +++MVL+KDI  +S CEHH+LP  G  H+ YIPKK  V+GLSKL RI+++ +++ Q+QER
Sbjct: 61  HEEMVLVKDIPLYSVCEHHLLPFVGVAHVVYIPKKGKVMGLSKLARIVDLLAKKPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           L+ ++A+ I  + D  GVAV++E +H+CM+MRGIK+ G  TVT+A  G    D
Sbjct: 121 LSSEVANVIMDTIDPLGVAVVVEAEHLCMTMRGIKKPGSKTVTSALRGIIKTD 173


>gi|269128699|ref|YP_003302069.1| GTP cyclohydrolase I [Thermomonospora curvata DSM 43183]
 gi|268313657|gb|ACZ00032.1| GTP cyclohydrolase I [Thermomonospora curvata DSM 43183]
          Length = 210

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 119/178 (66%), Gaps = 7/178 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  + A+R IL  IG+DPDREGL++TP RV ++Y E FAG +Q P       F     + 
Sbjct: 25  ERLERAVREILIAIGEDPDREGLRETPARVARAYAEQFAGLRQRPEDVLNKVFE----AD 80

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILEVYSRRLQIQE 136
           + +MVL+KDI  +S CEHH++P  G  H+ Y P  K  + GLSKL R+++VY+RR Q+QE
Sbjct: 81  HDEMVLVKDIEVYSTCEHHLVPFHGLAHVGYTPNAKGQITGLSKLARLVDVYARRPQVQE 140

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           RLT QIA A+    + +GV V+IE +H+CM+MRG+++ G  TVT+A  G+F RD  +T
Sbjct: 141 RLTSQIADALMEILEPRGVIVVIEAEHLCMTMRGVRKPGAKTVTSAVRGDF-RDHAET 197


>gi|118477064|ref|YP_894215.1| GTP cyclohydrolase I [Bacillus thuringiensis str. Al Hakam]
 gi|166218209|sp|A0RBW5|GCH1_BACAH RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|118416289|gb|ABK84708.1| GTP cyclohydrolase I [Bacillus thuringiensis str. Al Hakam]
          Length = 189

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 122/189 (64%), Gaps = 9/189 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ + A+R+IL  IGDDP+REG+ DTP RV K Y E+F+G  + P        H
Sbjct: 1   MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  TVTTA  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLEN 174

Query: 190 DKGKTDFFL 198
           D    +  L
Sbjct: 175 DAAARNEIL 183


>gi|302553171|ref|ZP_07305513.1| GTP cyclohydrolase I [Streptomyces viridochromogenes DSM 40736]
 gi|302470789|gb|EFL33882.1| GTP cyclohydrolase I [Streptomyces viridochromogenes DSM 40736]
          Length = 201

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 116/169 (68%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DP+REGL++TP RV ++Y+EL AG +Q P    T+ F  G    + 
Sbjct: 21  AENAVRELLIAVGEDPNREGLRETPARVARAYRELLAGLRQEPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI   S CEHH+LP  G  H+ YIP +   + GLSKL R++EV++RR Q+QERL
Sbjct: 77  EMVLVKDIEIVSLCEHHLLPFHGVAHVGYIPAETGKITGLSKLARLVEVFARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    +++G  V+IE +HMCMS+RGI++ G  T T+A  G+ 
Sbjct: 137 TTQIADSLMKILEARGAIVVIEAEHMCMSVRGIRKPGAKTTTSAVRGQL 185


>gi|72163293|ref|YP_290950.1| GTP cyclohydrolase I [Thermobifida fusca YX]
 gi|123628621|sp|Q47KU5|GCH1_THEFY RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|71917025|gb|AAZ56927.1| GTP cyclohydrolase [Thermobifida fusca YX]
          Length = 207

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 82/191 (42%), Positives = 126/191 (65%), Gaps = 10/191 (5%)

Query: 6   TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT 65
            G+    + +P +E+A   +R IL  IG+DPDR+GL +TP RV +++ E FAG  Q P  
Sbjct: 13  AGLAPAGIDQPRIEKA---VREILLAIGEDPDRDGLVETPARVARAFAEQFAGLSQRPED 69

Query: 66  QDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVR 123
             T+ F     + +++MVL+KDI  +S CEHH++P +G  H+ YIP     + GLSKL R
Sbjct: 70  VLTTVFE----ANHEEMVLVKDIELYSTCEHHLVPFYGAAHVGYIPNTDGRITGLSKLAR 125

Query: 124 ILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAF 183
           ++++Y+RR Q+QERLT Q+A A+    + +GV V++E +H+CM+MRG+++ G  TVT+A 
Sbjct: 126 LVDIYARRPQVQERLTSQVADALMERLEPRGVIVVVEAEHLCMTMRGVRKPGAKTVTSAV 185

Query: 184 TGEFSRDKGKT 194
            G F R+  KT
Sbjct: 186 RGAF-RESYKT 195


>gi|319945754|ref|ZP_08020005.1| GTP cyclohydrolase I [Streptococcus australis ATCC 700641]
 gi|319748114|gb|EFW00357.1| GTP cyclohydrolase I [Streptococcus australis ATCC 700641]
          Length = 184

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 119/182 (65%), Gaps = 5/182 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+++I+  +G+D  REGL++TP+R+ K Y+E+FAG  Q      +  F   +     +
Sbjct: 7   QEAVKMIIDAVGEDGSREGLQETPERIAKMYQEIFAGLNQTAEVHLSKSFEIVD----NN 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+ KDI F S CEHH LP +GK+H+AYIP   V GLSKL R +EVY+++ QIQERLT++
Sbjct: 63  MVVEKDIFFHSMCEHHFLPFYGKVHIAYIPNGRVAGLSKLARTVEVYAKKPQIQERLTVE 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFFLKM 200
           IA A+     ++G  V +E +HMCM+MRG+++ G  TVTTA  G    DK  K + +  M
Sbjct: 123 IADALMEYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGLLETDKDLKNEAYKLM 182

Query: 201 TH 202
            H
Sbjct: 183 GH 184


>gi|152991606|ref|YP_001357327.1| GTP cyclohydrolase I [Sulfurovum sp. NBC37-1]
 gi|151423467|dbj|BAF70970.1| GTP cyclohydrolase I [Sulfurovum sp. NBC37-1]
          Length = 192

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 121/180 (67%), Gaps = 6/180 (3%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEASK 78
           E +EA+  +L  +G+DP REGL  TP+RV K+   L  GY Q P    + + F    ++ 
Sbjct: 6   EFEEAVTKVLELLGEDPQREGLLKTPNRVAKALTFLTEGYHQDPKEILNQALF----STS 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MVL++DI F+S CEHH+LPI G+ H+AYIP   V+GLSK+ RI+ VY+RRLQIQE++
Sbjct: 62  NDEMVLVRDIEFYSMCEHHMLPIIGRAHVAYIPDGKVVGLSKIPRIVNVYARRLQIQEQM 121

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           T QIA AI  +   KGVAV++  +HMCM MRG+++   TTV++A  G F  D + + +F+
Sbjct: 122 TEQIADAILGTIKPKGVAVVVHARHMCMEMRGVQKINSTTVSSALRGLFKSDERTRNEFY 181


>gi|288927025|ref|ZP_06420918.1| GTP cyclohydrolase I [Prevotella buccae D17]
 gi|315606306|ref|ZP_07881322.1| GTP cyclohydrolase I [Prevotella buccae ATCC 33574]
 gi|288336199|gb|EFC74587.1| GTP cyclohydrolase I [Prevotella buccae D17]
 gi|315251997|gb|EFU31970.1| GTP cyclohydrolase I [Prevotella buccae ATCC 33574]
          Length = 197

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 81/170 (47%), Positives = 113/170 (66%), Gaps = 3/170 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           +L  +G+DPDR+GL+ TP RV K+ + L  GY Q P    T    F E  KY  MV++KD
Sbjct: 21  VLTLLGEDPDRDGLQKTPMRVAKAMQVLTRGYTQDPHKVLTDAL-FEE--KYNQMVIVKD 77

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I FFS CEHHILP +GK H+AYIP  ++ GLSK+ R++++YS RLQ+QERLT QI   I+
Sbjct: 78  IDFFSMCEHHILPFYGKAHVAYIPNGYITGLSKIARVVDIYSHRLQVQERLTQQIKDCIQ 137

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
            +   +GV V+IE +HMCM MRG+++    T T+ F+G F+    + +F 
Sbjct: 138 ETLKPQGVMVVIEAKHMCMQMRGVEKQNSITTTSDFSGVFNSLTTRQEFM 187


>gi|78186629|ref|YP_374672.1| GTP cyclohydrolase I [Chlorobium luteolum DSM 273]
 gi|78166531|gb|ABB23629.1| GTP cyclohydrolase I [Chlorobium luteolum DSM 273]
          Length = 216

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 119/177 (67%), Gaps = 3/177 (1%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           ++  +L  +G+DP REGL  TP+RV +S   L  GY+Q P  +   +  F E+  Y +MV
Sbjct: 40  SVSTMLESVGEDPMREGLLKTPERVARSLAFLTRGYRQDPE-EMLKKAVFTES--YDEMV 96

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           L++DI  FS CEHH+LP +GK H+AYIP   ++GLSKL R++EV++RRLQ+QERLT QI 
Sbjct: 97  LVRDIDIFSMCEHHMLPFFGKAHVAYIPDGKIVGLSKLARVVEVFARRLQVQERLTQQIR 156

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
            AI+   + KGV V+IE +HMCM MRG+++    T T+A +G+F   +     FL++
Sbjct: 157 DAIQDVLNPKGVGVVIEAKHMCMVMRGVEKLNSVTTTSAMSGQFITSESTRGEFLRL 213


>gi|293609698|ref|ZP_06692000.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|224713538|gb|ACN62074.1| GTP cyclohydrolase I [Acinetobacter genomosp. 3]
 gi|292828150|gb|EFF86513.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 184

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 114/172 (66%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D DR GLKDTP R  K++  L +GY K +    + + F     S   +MVL+K
Sbjct: 10  ILTAVGEDLDRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVF----PSDNHEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 66  NIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 126 AEVTGARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFL 177


>gi|317122231|ref|YP_004102234.1| GTP cyclohydrolase I [Thermaerobacter marianensis DSM 12885]
 gi|315592211|gb|ADU51507.1| GTP cyclohydrolase I [Thermaerobacter marianensis DSM 12885]
          Length = 196

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/171 (47%), Positives = 119/171 (69%), Gaps = 5/171 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +E  + A+  IL  +G+DP REGL DTP RV ++Y+ELF+G  + P  + +  F    ++
Sbjct: 10  LERIQRAVLDILEAVGEDPTREGLVDTPRRVAEAYQELFSGLGRDPADELSVFF----ST 65

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQE 136
            + ++VL+KDI F+S CEHH+LP  G+ H+AY+P+   + GLSKL R +EV SRR Q+QE
Sbjct: 66  DHDEVVLVKDIPFYSICEHHLLPFHGRAHVAYLPRNGRITGLSKLARAVEVASRRPQLQE 125

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           RLT+QIA AIE   + +GV V+IE +H+CM+MRGI++ G   VT+A  G F
Sbjct: 126 RLTVQIADAIEQRLNPRGVVVVIEAEHLCMTMRGIQKPGSYAVTSAVRGLF 176


>gi|325122916|gb|ADY82439.1| GTP cyclohydrolase I [Acinetobacter calcoaceticus PHEA-2]
          Length = 182

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 114/172 (66%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D DR GLKDTP R  K++  L +GY K +    + + F     S   +MVL+K
Sbjct: 8   ILTAVGEDLDRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVF----PSDNHEMVLVK 63

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 64  NIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIAEAV 123

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 124 AEVTGARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFL 175


>gi|34540431|ref|NP_904910.1| GTP cyclohydrolase I [Porphyromonas gingivalis W83]
 gi|188994531|ref|YP_001928783.1| GTP cyclohydrolase I [Porphyromonas gingivalis ATCC 33277]
 gi|41017102|sp|Q7MWI5|GCH1_PORGI RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|229487981|sp|B2RIJ1|GCH1_PORG3 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|34396744|gb|AAQ65809.1| GTP cyclohydrolase I [Porphyromonas gingivalis W83]
 gi|188594211|dbj|BAG33186.1| putative GTP cyclohydrolase I [Porphyromonas gingivalis ATCC 33277]
          Length = 193

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 112/170 (65%), Gaps = 3/170 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           +L  +G+DP REGL  TP RV K+ + L  GY + P  +   R    E   YQ MV++KD
Sbjct: 20  VLSLLGEDPKREGLLKTPLRVAKAMQFLTKGYNEDP--EAILRAAMFE-EDYQQMVIVKD 76

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I FFS CEHH+LP +GK H+ YIP +++ GLSKL R+++V++RRLQ+QERLT QI   I+
Sbjct: 77  IDFFSMCEHHMLPFFGKAHVGYIPNRYITGLSKLPRVVDVFARRLQVQERLTTQIKECIQ 136

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           ++ +  GV V+IE QHMCM MRG+++    T T+ FTG F     + +F 
Sbjct: 137 NTLNPLGVIVVIEAQHMCMQMRGVEKQNSLTTTSDFTGAFEESTTREEFL 186


>gi|253577627|ref|ZP_04854937.1| GTP cyclohydrolase I [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251842997|gb|EES71035.1| GTP cyclohydrolase I [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 197

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 120/182 (65%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ +  +R IL+ IG+D  REGL +TP RV + Y+E+FAGY+  P  +D     F E   
Sbjct: 17  EQIEYHVREILKLIGEDVKREGLLETPARVTRMYEEIFAGYEVDP--RDVLGVTFEE--N 72

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           ++++V++KDI ++S CEHH+ P +GK H+ YIP   + GLSKL R++E  +RRLQ+QER+
Sbjct: 73  HEELVIVKDIVYYSQCEHHMAPFFGKAHIGYIPSGRIAGLSKLARLVEAVTRRLQVQERI 132

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA  +E     KGV V++EG+H+CM  RG+K+ G  TVT+A  G F +D      FL
Sbjct: 133 TSQIADIMEEVLQPKGVMVVVEGEHLCMCSRGVKKPGSKTVTSAVRGSFRKDAASRAEFL 192

Query: 199 KM 200
            +
Sbjct: 193 SL 194


>gi|315446251|ref|YP_004079130.1| GTP cyclohydrolase I [Mycobacterium sp. Spyr1]
 gi|315264554|gb|ADU01296.1| GTP cyclohydrolase I [Mycobacterium sp. Spyr1]
          Length = 202

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 116/174 (66%), Gaps = 6/174 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL+DTP RV +SY+E+FAG    P    T+ F      ++ 
Sbjct: 21  AEAAVRELLIAVGEDPDREGLRDTPARVARSYREIFAGLYTDPDEVLTTMFD----EQHD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  +S CEHH++   G  H+ YIP     V GLSKL R++++Y++R Q+QERL
Sbjct: 77  EMVLVKDIPMYSTCEHHLVSFHGVAHVGYIPGVDGRVTGLSKLARVVDLYAKRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           T QIA A+    D +G  V+IE +H+CM+MRGI++ G  T T+A  G+F  DK 
Sbjct: 137 TAQIADALMRKLDPRGAIVVIEAEHLCMAMRGIRKPGAVTTTSAVRGQFKTDKA 190


>gi|147677734|ref|YP_001211949.1| GTP cyclohydrolase I [Pelotomaculum thermopropionicum SI]
 gi|189045192|sp|A5D2D8|GCH1_PELTS RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|146273831|dbj|BAF59580.1| GTP cyclohydrolase I [Pelotomaculum thermopropionicum SI]
          Length = 188

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 120/170 (70%), Gaps = 5/170 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R+IL  IG++P+REGLK TP RV + Y+E+F+G ++ P       F    + ++++
Sbjct: 8   EKAVRLILEAIGENPEREGLKGTPARVARMYEEIFSGLQEDPEEHLQKIF----SEEHEE 63

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           MV++KDI  +S CEHH+LP +GK H+AYIP+K  V GLSKL R++E +++R Q+QERLT 
Sbjct: 64  MVIVKDIPLYSICEHHLLPFYGKAHVAYIPRKGKVTGLSKLARVVEGFAKRPQLQERLTS 123

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           QIA  I    +  GV V+IE +HMCM+ RG+K+ G  TVT+A  G F ++
Sbjct: 124 QIADTIMRRLNPIGVLVVIEAEHMCMTFRGVKKPGSKTVTSAVRGLFRKN 173


>gi|13699226|gb|AAK38364.1|AF177165_1 GTP cyclohydrolase I [Physarum polycephalum]
          Length = 228

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 118/181 (65%), Gaps = 5/181 (2%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQD 81
           ++ R IL  IG+DPDREGL+ TP R+ K+      GY+Q +    + + F+      + +
Sbjct: 50  DSTRNILVNIGEDPDREGLQQTPMRMAKAMMFFTQGYEQSLSDVLNGAIFN----EDHNE 105

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+++DI  FS CEHH++P +GK H+ YIP   V+GLSKL RI E+++RRLQ+QERLT Q
Sbjct: 106 MVVVRDIDIFSLCEHHLVPFFGKCHIGYIPNGKVLGLSKLARIAEIFARRLQVQERLTRQ 165

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA A+E +    GVAV+IE  HMCM MRG+++ G +TVT++  G F +D      F  + 
Sbjct: 166 IALALEEAIQPLGVAVVIEASHMCMVMRGVQKSGASTVTSSVLGVFQQDSRTRGEFFSLI 225

Query: 202 H 202
           H
Sbjct: 226 H 226


>gi|326798732|ref|YP_004316551.1| GTP cyclohydrolase 1 [Sphingobacterium sp. 21]
 gi|326549496|gb|ADZ77881.1| GTP cyclohydrolase 1 [Sphingobacterium sp. 21]
          Length = 218

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 119/174 (68%), Gaps = 3/174 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G++P R+GL  TP+R+ K+ + L  GY   P     S   F E   Y  MV++KD
Sbjct: 44  ILSQLGENPKRQGLLKTPERIAKALQYLTHGYDIDPAAILKSAM-FEE--DYSQMVVVKD 100

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP +GK H+AYIPK H++GLSK+ R+++ ++RRLQ+QERLT +I   I+
Sbjct: 101 IEVYSMCEHHLLPFFGKAHIAYIPKGHIVGLSKIPRVVDAFARRLQVQERLTNEIRDCIQ 160

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
            + +  GVAV+IE +H+CM+MRGI++    T T+AFTGEF+ ++ + +F   +T
Sbjct: 161 ETLNPAGVAVVIECKHLCMAMRGIQKQNSVTTTSAFTGEFAHERTRAEFLRLIT 214


>gi|262372124|ref|ZP_06065403.1| GTP cyclohydrolase I [Acinetobacter junii SH205]
 gi|262312149|gb|EEY93234.1| GTP cyclohydrolase I [Acinetobacter junii SH205]
          Length = 184

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 115/172 (66%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +R GLKDTP R  K++  L +GY K +    +++ F     S   +MVL+K
Sbjct: 10  ILTAVGEDLNRPGLKDTPMRAAKAFSFLTSGYSKTLEEVTNSAVF----PSDNHEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 66  NIEFYSLCEHHLLPFYGRVHIAYLPEGQVLGLSKFARITEMFARRLQIQENLTQQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 126 AEVTQARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKDARREFL 177


>gi|56808707|ref|ZP_00366428.1| COG0302: GTP cyclohydrolase I [Streptococcus pyogenes M49 591]
          Length = 188

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 118/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F      +
Sbjct: 6   EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EQ 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++K ISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 62  HEDVVIVKGISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 121

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 122 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 177


>gi|20804352|emb|CAD31134.1| GTP cyclohydrolase [Streptococcus pyogenes]
          Length = 194

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 5/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F      +
Sbjct: 12  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EQ 67

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H++Y+P    V GLSKL R +EV S+R Q+QER
Sbjct: 68  HEDVVIVKDISFYSMCEHHLVPFYGKAHISYLPSDGRVTGLSKLARAVEVASKRPQLQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LT QIA A+  + + KG  V++E +HMCM+MRGIK  G  T+TT   G +   +
Sbjct: 128 LTAQIADALVEALNPKGTLVMVEAEHMCMTMRGIKMPGSKTITTTARGLYKESR 181


>gi|311743362|ref|ZP_07717169.1| GTP cyclohydrolase I [Aeromicrobium marinum DSM 15272]
 gi|311313430|gb|EFQ83340.1| GTP cyclohydrolase I [Aeromicrobium marinum DSM 15272]
          Length = 188

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/169 (48%), Positives = 115/169 (68%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A  AIR +L  IG+DPDR+GL DTP RV +SY EL AG  Q P    T+ F  G    + 
Sbjct: 8   AAAAIRELLFAIGEDPDRDGLVDTPARVARSYVELVAGLDQDPAEVLTATFDVG----HD 63

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           ++VL+KDI  +S CEHH++P +G  H+ YIP+   +V GLSKL R+++V++RR Q+QERL
Sbjct: 64  ELVLVKDIELWSMCEHHLVPFFGVAHIGYIPEDGGYVTGLSKLARLVDVFARRPQVQERL 123

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA A+      +GV V+IE +H+CM+MRG+++ G  TVT+A  G+ 
Sbjct: 124 TTQIADALSDVLKPRGVIVVIEAEHLCMAMRGVRKGGAKTVTSAVRGQL 172


>gi|154486837|ref|ZP_02028244.1| hypothetical protein BIFADO_00669 [Bifidobacterium adolescentis
           L2-32]
 gi|154084700|gb|EDN83745.1| hypothetical protein BIFADO_00669 [Bifidobacterium adolescentis
           L2-32]
          Length = 211

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 113/168 (67%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  ++A+R+ L+ IG+DP+REGL DTPDR+ ++ KELFAG    P     +RF       
Sbjct: 28  EGVRQAVRLFLKSIGEDPEREGLLDTPDRIGRACKELFAGLGHGPEEVLKTRFKV----D 83

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
             +MVL++DI  FS CEHH+LP  G  H+ YIP+   V GLSKL R++E+Y+RR Q+QER
Sbjct: 84  TDEMVLVRDIELFSVCEHHLLPFHGVAHVGYIPQNGQVAGLSKLARLVELYARRPQVQER 143

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT Q+A A+    D++GV V+ E  HMCM+MRG+K+    TVT+A  G
Sbjct: 144 LTQQVADALMEGIDARGVIVVTECDHMCMAMRGVKKAQSRTVTSAVRG 191


>gi|319651352|ref|ZP_08005481.1| GTP cyclohydrolase I [Bacillus sp. 2_A_57_CT2]
 gi|317396883|gb|EFV77592.1| GTP cyclohydrolase I [Bacillus sp. 2_A_57_CT2]
          Length = 188

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/170 (47%), Positives = 119/170 (70%), Gaps = 5/170 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R+IL  IG+DP+REGL DTP RV K Y+E+F G  Q P  ++     FGE   +++
Sbjct: 10  EDAVRLILEAIGEDPNREGLLDTPKRVAKMYEEVFMGLNQDP--KEYFETVFGE--DHEE 65

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           +VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R +E  ++R Q+QER+T 
Sbjct: 66  LVLVKDIPFYSMCEHHLVPFFGVAHVAYIPRGGRVTGLSKLARAVEAVAKRPQLQERITS 125

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            +A++I    +  GV V++E +HMCM+MRG+K+ G  TVT+A  G F+ D
Sbjct: 126 TVANSILEKLEPHGVMVVVEAEHMCMTMRGVKKPGSKTVTSAVRGVFAED 175


>gi|295395572|ref|ZP_06805766.1| GTP cyclohydrolase I [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971591|gb|EFG47472.1| GTP cyclohydrolase I [Brevibacterium mcbrellneri ATCC 49030]
          Length = 188

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/185 (43%), Positives = 120/185 (64%), Gaps = 9/185 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + +P +E A   +R IL  IG+DP+R+GL++TP RV ++Y ELFAG  Q P    ++ F 
Sbjct: 2   VDQPRIEAA---VREILYAIGEDPNRDGLQETPGRVARAYAELFAGIGQDPAEVLSTTFE 58

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSR 130
            G    + +MVL+++I  FS CEHH+LP  G  H+ YIP     V GLSKL R++E+Y+R
Sbjct: 59  IG----HDEMVLVRNIEMFSTCEHHLLPFHGVAHVGYIPNTSGRVTGLSKLARLVELYAR 114

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           R Q+QERLT QIA A+    + +G  V+IE +H+CMSMRG+ + G +T+T+A  G   + 
Sbjct: 115 RPQVQERLTGQIADALMEHLEPRGAIVVIEAEHLCMSMRGVDKAGASTITSAVRGSLRKP 174

Query: 191 KGKTD 195
             + +
Sbjct: 175 TSRAE 179


>gi|313901703|ref|ZP_07835133.1| GTP cyclohydrolase I [Thermaerobacter subterraneus DSM 13965]
 gi|313468021|gb|EFR63505.1| GTP cyclohydrolase I [Thermaerobacter subterraneus DSM 13965]
          Length = 196

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 116/167 (69%), Gaps = 5/167 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           K A+  IL  +G+DP REGL DTP RV ++Y+ELF+G  + P  + +  F     + + +
Sbjct: 14  KRAVLDILEAVGEDPRREGLVDTPRRVAEAYQELFSGLGRDPADELSVFFE----TDHDE 69

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           +VL+KDI F+S CEHH+LP  G+ H+AY+P+   + GLSKL R +EV SRR Q+QERLT+
Sbjct: 70  VVLVKDIPFYSMCEHHLLPFHGRAHVAYLPRNGRITGLSKLARAVEVASRRPQLQERLTV 129

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           QIA AIE   + +GV V+IE +H+CM+MRGI++ G   VT+A  G F
Sbjct: 130 QIADAIEERLNPRGVVVVIEAEHLCMTMRGIQKPGSYAVTSAVRGLF 176


>gi|209559383|ref|YP_002285855.1| GTP cyclohydrolase I [Streptococcus pyogenes NZ131]
 gi|229488001|sp|B5XLE8|GCH1_STRPZ RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|209540584|gb|ACI61160.1| GTP cyclohydrolase I type 1 [Streptococcus pyogenes NZ131]
          Length = 194

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 118/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F      +
Sbjct: 12  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EQ 67

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++K ISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 68  HEDVVIVKGISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 127

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 128 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 183


>gi|163783635|ref|ZP_02178624.1| GTP cyclohydrolase I [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881128|gb|EDP74643.1| GTP cyclohydrolase I [Hydrogenivirga sp. 128-5-R1-1]
          Length = 183

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 115/180 (63%), Gaps = 7/180 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           KEAIR+ L  IG+DPDREGLK+TP+R+ + ++E         + +      F E   Y +
Sbjct: 8   KEAIRLFLEGIGEDPDREGLKETPERIARMWEEF-------ESMRSFDMKLFEEFGDYNE 60

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL+KDI F+S CEHH+LP +GK+H+AYIP   + GLSKLVR +  ++ R Q+QERLT +
Sbjct: 61  MVLVKDIQFYSLCEHHLLPFYGKVHIAYIPDGVICGLSKLVRTVRAFALRPQVQERLTDE 120

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA  +E     KGV V++E +H+CMSMRG    G  T T+A  G F  D    + FLK+T
Sbjct: 121 IADFLERELKPKGVGVIVEAEHLCMSMRGAMSPGHVTTTSALRGVFLSDMKTREEFLKLT 180


>gi|94990446|ref|YP_598546.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS10270]
 gi|94543954|gb|ABF34002.1| GTP cyclohydrolase I [Streptococcus pyogenes MGAS10270]
          Length = 202

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 118/176 (67%), Gaps = 5/176 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+A+ AI   L  IG++P+REGL DTP RV K Y E+F G  + P  + T+ F       
Sbjct: 20  EKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGKDPKEEFTAVFK----EH 75

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S++ Q+QER
Sbjct: 76  HEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKQPQLQER 135

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           LT QIA A+  + + KG  V++E +HMCM+MRGIK+ G  T+TT   G +   + +
Sbjct: 136 LTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTARGLYKESRAE 191


>gi|283780114|ref|YP_003370869.1| GTP cyclohydrolase I [Pirellula staleyi DSM 6068]
 gi|283438567|gb|ADB17009.1| GTP cyclohydrolase I [Pirellula staleyi DSM 6068]
          Length = 191

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 121/176 (68%), Gaps = 5/176 (2%)

Query: 13  LKKPT-VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           +K P  ++  + A+R IL  +G+DPDREGL +TP RV + Y E+F+G K  P  ++ +R 
Sbjct: 1   MKSPVDLQRIERAVREILAAVGEDPDREGLLETPARVARMYAEMFSGLKLDP--REHTRK 58

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRR 131
            F E  +Y ++VL++DISF S CEHH+LP  G  H+AYIP   VIGLSK+ R++EV SRR
Sbjct: 59  FFTE--QYDEVVLVRDISFCSMCEHHLLPFIGHAHVAYIPNGKVIGLSKIARVVEVISRR 116

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            Q+QER+T  IA+ +     +KGVAV++E  H CM++RG+++ G + VT+A  G F
Sbjct: 117 PQVQERMTEDIANLLVDELHAKGVAVVVEASHSCMTIRGVRKPGSSMVTSAMKGLF 172


>gi|254478758|ref|ZP_05092127.1| GTP cyclohydrolase I [Carboxydibrachium pacificum DSM 12653]
 gi|214035323|gb|EEB76028.1| GTP cyclohydrolase I [Carboxydibrachium pacificum DSM 12653]
          Length = 188

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/188 (43%), Positives = 126/188 (67%), Gaps = 5/188 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+R IL  IG+DPDREGL +TPDRV + Y+E+F+G      T         +  +
Sbjct: 5   EKIKKAVREILEAIGEDPDREGLLETPDRVARMYEEIFSGLH----TDVKDVIKIFQEDE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +Q+++L+KDI  +S CEHH+LP  G  H+AY+P+K  ++GLSK+ RI++V S+R Q+QER
Sbjct: 61  HQEIILVKDIPLYSMCEHHLLPFIGVAHVAYLPRKGRILGLSKVARIVDVLSKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT +IA  I  + +  GVAV+IE +H+CM+MRG+K+    TVT+A  G F  D+      
Sbjct: 121 LTSEIADTIMEAVNPLGVAVVIEAEHLCMTMRGVKKPDSKTVTSALRGIFRTDQKARAEV 180

Query: 198 LKMTHNQR 205
           + + +++R
Sbjct: 181 MALINSKR 188


>gi|163939426|ref|YP_001644310.1| GTP cyclohydrolase I [Bacillus weihenstephanensis KBAB4]
 gi|229010918|ref|ZP_04168114.1| GTP cyclohydrolase 1 [Bacillus mycoides DSM 2048]
 gi|229132418|ref|ZP_04261272.1| GTP cyclohydrolase 1 [Bacillus cereus BDRD-ST196]
 gi|229166457|ref|ZP_04294213.1| GTP cyclohydrolase 1 [Bacillus cereus AH621]
 gi|229487621|sp|A9VMC0|GCH1_BACWK RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|163861623|gb|ABY42682.1| GTP cyclohydrolase I [Bacillus weihenstephanensis KBAB4]
 gi|228617031|gb|EEK74100.1| GTP cyclohydrolase 1 [Bacillus cereus AH621]
 gi|228651124|gb|EEL07105.1| GTP cyclohydrolase 1 [Bacillus cereus BDRD-ST196]
 gi|228750318|gb|EEM00148.1| GTP cyclohydrolase 1 [Bacillus mycoides DSM 2048]
          Length = 189

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 120/183 (65%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ + A+R+IL  IGDDP+REG+ DTP RV K Y E+F+G  + P        H
Sbjct: 1   MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  TVTTA  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|159896664|ref|YP_001542911.1| GTP cyclohydrolase I [Herpetosiphon aurantiacus ATCC 23779]
 gi|159889703|gb|ABX02783.1| GTP cyclohydrolase I [Herpetosiphon aurantiacus ATCC 23779]
          Length = 206

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 85/190 (44%), Positives = 120/190 (63%), Gaps = 5/190 (2%)

Query: 16  PTVEEAKEA-IRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           P V E  EA +R IL  +G+D DREGL+ TP RV K + EL AGY   P           
Sbjct: 16  PAVREDMEAAVRTILEGLGEDVDREGLQRTPHRVAKMFGELTAGYHTDPVALINDAIFTV 75

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
           E   Y +MVL++DI F S CEHH+LP WGK H+AY+P   V+GLSK+ RI++++++RLQ+
Sbjct: 76  E---YNEMVLVRDIEFSSLCEHHMLPFWGKAHVAYVPNGKVLGLSKIPRIVDMFAKRLQV 132

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGK 193
           QERLT +IA  +  + D+ GVAV+++G HMC  +RG+K+     VT +  G F  D + +
Sbjct: 133 QERLTREIADFVAQTIDASGVAVVVQGAHMCSMIRGVKKANARMVTQSLQGVFKTDPQIR 192

Query: 194 TDFFLKMTHN 203
            +F   +T N
Sbjct: 193 AEFMGHITAN 202


>gi|257064780|ref|YP_003144452.1| GTP cyclohydrolase I [Slackia heliotrinireducens DSM 20476]
 gi|256792433|gb|ACV23103.1| GTP cyclohydrolase I [Slackia heliotrinireducens DSM 20476]
          Length = 195

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 118/169 (69%), Gaps = 4/169 (2%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ AIR  L  IG+DPDREG+++TP+RV ++  E+F G +  P      +F   +   ++
Sbjct: 16  AEAAIREFLIAIGEDPDREGIRETPNRVARACAEIFGGLQSDPCEPLRKQF---QEEHHE 72

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLT 139
           +MV++KDI F S CEHH+LP  GK+H+AYIP+K  + GLSK+ R +E Y+RR Q+QERLT
Sbjct: 73  EMVIVKDIPFASMCEHHLLPFTGKVHVAYIPRKGRITGLSKIARCVEGYARRPQLQERLT 132

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
            Q+A A+ S+ + +GV V+ E +H CM+MRG+++ G  TVT+A  G F+
Sbjct: 133 SQVADAMMSTLEPRGVLVVAEAEHSCMTMRGVRKPGSVTVTSAVRGCFA 181


>gi|323344426|ref|ZP_08084651.1| GTP cyclohydrolase I [Prevotella oralis ATCC 33269]
 gi|323094553|gb|EFZ37129.1| GTP cyclohydrolase I [Prevotella oralis ATCC 33269]
          Length = 199

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 116/180 (64%), Gaps = 3/180 (1%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +EE     + IL  +G++PDR+GL+ TP R+ K+ + L  GY Q P    T       A 
Sbjct: 13  LEELAAHYKDILSLLGENPDRDGLQKTPLRMAKAMQILTRGYGQDPHRVLTDALF---AE 69

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
            Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R++++YS RLQ+QER
Sbjct: 70  TYNQMVIVKDIDFFSMCEHHLLPFYGKAHVAYIPNGYITGLSKIARVVDIYSHRLQVQER 129

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           +T QI   I+ +    GV V+IE +HMCM MRG+++    T T+ F+G F++ K + +F 
Sbjct: 130 MTQQIKDCIQETLKPLGVMVVIEAKHMCMQMRGVEKQNAITTTSDFSGAFNQAKTREEFM 189


>gi|257068459|ref|YP_003154714.1| GTP cyclohydrolase I [Brachybacterium faecium DSM 4810]
 gi|256559277|gb|ACU85124.1| GTP cyclohydrolase I [Brachybacterium faecium DSM 4810]
          Length = 188

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 118/185 (63%), Gaps = 9/185 (4%)

Query: 11  MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR 70
           M + KP +E A   +R IL  IG+DPDR+GL DTP RV + Y E+F G  Q      ++ 
Sbjct: 1   MAVDKPRIEAA---VREILAAIGEDPDRDGLLDTPSRVARMYDEVFEGLAQDAREPLSTT 57

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVI-GLSKLVRILEVYS 129
           F      ++Q++VL++DI+F+S CEHH+LP  G  H+ YIP   V+ GLSKL R++ +Y+
Sbjct: 58  FDI----EHQELVLVRDIAFYSMCEHHLLPFHGTAHIGYIPGGGVVTGLSKLARLVNIYA 113

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QERLT QIA A+     + G  V+IE +HMCMSMRG++  G  TVT+A  G   R
Sbjct: 114 RRPQVQERLTFQIADALMEELGAGGAIVVIEAEHMCMSMRGVRAAGARTVTSAVRGML-R 172

Query: 190 DKGKT 194
           D   T
Sbjct: 173 DSPST 177


>gi|163755288|ref|ZP_02162408.1| GTP cyclohydrolase I [Kordia algicida OT-1]
 gi|161324708|gb|EDP96037.1| GTP cyclohydrolase I [Kordia algicida OT-1]
          Length = 198

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 117/189 (61%), Gaps = 6/189 (3%)

Query: 12  KLKKPTVE---EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT 68
           KL++  +E   E K+  + I+  +G+D  REGL  TP+R  K+ + L  GY   P     
Sbjct: 5   KLEEYNIEVTNEVKDRYKAIIEELGEDTTREGLLKTPERAAKAMQFLTQGYDMDPAEILK 64

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
                  A  Y +MV++KDI  +S CEHHILP +GK H+AYIP  H++GLSKL RI++V+
Sbjct: 65  GAMF---AEDYNEMVIVKDIELYSLCEHHILPFFGKAHIAYIPNGHIVGLSKLPRIVDVF 121

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           SRRLQ+QERLT  I   I ++   KGVAV+IE  HMCM MRG+++    T T+ F G F 
Sbjct: 122 SRRLQVQERLTHDILECINNTLKPKGVAVVIEASHMCMMMRGVQKQNSVTTTSGFRGAFE 181

Query: 189 RDKGKTDFF 197
             + +T+F 
Sbjct: 182 TIETRTEFL 190


>gi|195978185|ref|YP_002123429.1| GTP cyclohydrolase I FolE [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|195974890|gb|ACG62416.1| GTP cyclohydrolase I FolE [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 188

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 121/175 (69%), Gaps = 7/175 (4%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           ++A+ AI  +L  IG+DP+REGL+DTP RV K Y E+ +G ++    + T+ F       
Sbjct: 6   KKAEAAIYQLLEAIGEDPNREGLRDTPKRVAKMYLEMLSGLEKDAKDEFTAVF----TEH 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           + D+V++KDISF+S CEHH++P +GK H+AY+P    V GLSKL R +EV S+R Q+QER
Sbjct: 62  HDDLVIVKDISFYSMCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARAVEVASKRPQLQER 121

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF--SRD 190
           LT QIA+A+  +   KGV V++E +HMCM+MRG+K+ G  T+TT   G +  SRD
Sbjct: 122 LTAQIANALVDALQPKGVFVMVEAEHMCMTMRGVKKPGSKTITTTARGIYKDSRD 176


>gi|322390745|ref|ZP_08064257.1| dihydrofolate synthase [Streptococcus parasanguinis ATCC 903]
 gi|321142572|gb|EFX38038.1| dihydrofolate synthase [Streptococcus parasanguinis ATCC 903]
          Length = 624

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 120/182 (65%), Gaps = 5/182 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+++I+  +G+D +REGL++TP R+ K Y+E+FAG  Q      +  F   +     +
Sbjct: 447 EEAVKMIIEAVGEDENREGLQETPTRIAKMYQEIFAGLGQTAEEHLSKSFEIID----NN 502

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+ KDI F S CEHH LP +GK+H+AYIP   V GLSKL R +EVY+++ QIQERLT++
Sbjct: 503 MVVEKDIFFHSMCEHHFLPFYGKVHIAYIPNGRVAGLSKLARTVEVYAKKPQIQERLTVE 562

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFFLKM 200
           IA A+     ++G  V +E +HMCM+MRG+++ G  TVTTA  G  + DK  K + +  M
Sbjct: 563 IADALMEYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGLLATDKDLKNEAYKLM 622

Query: 201 TH 202
            H
Sbjct: 623 GH 624


>gi|30019659|ref|NP_831290.1| GTP cyclohydrolase I [Bacillus cereus ATCC 14579]
 gi|30261606|ref|NP_843983.1| GTP cyclohydrolase I [Bacillus anthracis str. Ames]
 gi|42780712|ref|NP_977959.1| GTP cyclohydrolase I [Bacillus cereus ATCC 10987]
 gi|47526806|ref|YP_018155.1| GTP cyclohydrolase I [Bacillus anthracis str. 'Ames Ancestor']
 gi|47565973|ref|ZP_00237011.1| GTP cyclohydrolase I [Bacillus cereus G9241]
 gi|49184438|ref|YP_027690.1| GTP cyclohydrolase I [Bacillus anthracis str. Sterne]
 gi|49481023|ref|YP_035727.1| GTP cyclohydrolase I [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|52143838|ref|YP_082991.1| GTP cyclohydrolase I [Bacillus cereus E33L]
 gi|65318876|ref|ZP_00391835.1| COG0302: GTP cyclohydrolase I [Bacillus anthracis str. A2012]
 gi|75764067|ref|ZP_00743669.1| GTP cyclohydrolase I [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
 gi|165869376|ref|ZP_02214035.1| GTP cyclohydrolase I [Bacillus anthracis str. A0488]
 gi|167633379|ref|ZP_02391704.1| GTP cyclohydrolase I [Bacillus anthracis str. A0442]
 gi|167639123|ref|ZP_02397396.1| GTP cyclohydrolase I [Bacillus anthracis str. A0193]
 gi|170686044|ref|ZP_02877266.1| GTP cyclohydrolase I [Bacillus anthracis str. A0465]
 gi|170706569|ref|ZP_02897029.1| GTP cyclohydrolase I [Bacillus anthracis str. A0389]
 gi|177650393|ref|ZP_02933360.1| GTP cyclohydrolase I [Bacillus anthracis str. A0174]
 gi|190568684|ref|ZP_03021589.1| GTP cyclohydrolase I [Bacillus anthracis Tsiankovskii-I]
 gi|196039090|ref|ZP_03106397.1| GTP cyclohydrolase I [Bacillus cereus NVH0597-99]
 gi|196046591|ref|ZP_03113815.1| GTP cyclohydrolase I [Bacillus cereus 03BB108]
 gi|206970747|ref|ZP_03231699.1| GTP cyclohydrolase I [Bacillus cereus AH1134]
 gi|206974911|ref|ZP_03235826.1| GTP cyclohydrolase I [Bacillus cereus H3081.97]
 gi|217959088|ref|YP_002337636.1| GTP cyclohydrolase I [Bacillus cereus AH187]
 gi|218235884|ref|YP_002366292.1| GTP cyclohydrolase I [Bacillus cereus B4264]
 gi|218896540|ref|YP_002444951.1| GTP cyclohydrolase I [Bacillus cereus G9842]
 gi|218902722|ref|YP_002450556.1| GTP cyclohydrolase I [Bacillus cereus AH820]
 gi|222095240|ref|YP_002529300.1| gtp cyclohydrolase i [Bacillus cereus Q1]
 gi|225863474|ref|YP_002748852.1| GTP cyclohydrolase I [Bacillus cereus 03BB102]
 gi|227815642|ref|YP_002815651.1| GTP cyclohydrolase I [Bacillus anthracis str. CDC 684]
 gi|228900191|ref|ZP_04064423.1| GTP cyclohydrolase 1 [Bacillus thuringiensis IBL 4222]
 gi|228907243|ref|ZP_04071103.1| GTP cyclohydrolase 1 [Bacillus thuringiensis IBL 200]
 gi|228914186|ref|ZP_04077802.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228920321|ref|ZP_04083668.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228932898|ref|ZP_04095764.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228945210|ref|ZP_04107566.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228951987|ref|ZP_04114084.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228957886|ref|ZP_04119626.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228984689|ref|ZP_04144862.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|229016867|ref|ZP_04173795.1| GTP cyclohydrolase 1 [Bacillus cereus AH1273]
 gi|229023073|ref|ZP_04179587.1| GTP cyclohydrolase 1 [Bacillus cereus AH1272]
 gi|229043355|ref|ZP_04191073.1| GTP cyclohydrolase 1 [Bacillus cereus AH676]
 gi|229069163|ref|ZP_04202454.1| GTP cyclohydrolase 1 [Bacillus cereus F65185]
 gi|229078793|ref|ZP_04211346.1| GTP cyclohydrolase 1 [Bacillus cereus Rock4-2]
 gi|229090572|ref|ZP_04221807.1| GTP cyclohydrolase 1 [Bacillus cereus Rock3-42]
 gi|229109066|ref|ZP_04238666.1| GTP cyclohydrolase 1 [Bacillus cereus Rock1-15]
 gi|229121153|ref|ZP_04250390.1| GTP cyclohydrolase 1 [Bacillus cereus 95/8201]
 gi|229126924|ref|ZP_04255935.1| GTP cyclohydrolase 1 [Bacillus cereus BDRD-Cer4]
 gi|229138304|ref|ZP_04266899.1| GTP cyclohydrolase 1 [Bacillus cereus BDRD-ST26]
 gi|229144209|ref|ZP_04272623.1| GTP cyclohydrolase 1 [Bacillus cereus BDRD-ST24]
 gi|229149808|ref|ZP_04278037.1| GTP cyclohydrolase 1 [Bacillus cereus m1550]
 gi|229155176|ref|ZP_04283288.1| GTP cyclohydrolase 1 [Bacillus cereus ATCC 4342]
 gi|229178018|ref|ZP_04305390.1| GTP cyclohydrolase 1 [Bacillus cereus 172560W]
 gi|229183805|ref|ZP_04311022.1| GTP cyclohydrolase 1 [Bacillus cereus BGSC 6E1]
 gi|229189692|ref|ZP_04316706.1| GTP cyclohydrolase 1 [Bacillus cereus ATCC 10876]
 gi|229195811|ref|ZP_04322571.1| GTP cyclohydrolase 1 [Bacillus cereus m1293]
 gi|229602317|ref|YP_002866014.1| GTP cyclohydrolase I [Bacillus anthracis str. A0248]
 gi|254683098|ref|ZP_05146959.1| GTP cyclohydrolase I [Bacillus anthracis str. CNEVA-9066]
 gi|254723686|ref|ZP_05185472.1| GTP cyclohydrolase I [Bacillus anthracis str. A1055]
 gi|254734447|ref|ZP_05192159.1| GTP cyclohydrolase I [Bacillus anthracis str. Western North America
           USA6153]
 gi|254740858|ref|ZP_05198546.1| GTP cyclohydrolase I [Bacillus anthracis str. Kruger B]
 gi|254755096|ref|ZP_05207130.1| GTP cyclohydrolase I [Bacillus anthracis str. Vollum]
 gi|254759633|ref|ZP_05211657.1| GTP cyclohydrolase I [Bacillus anthracis str. Australia 94]
 gi|296502180|ref|YP_003663880.1| GTP cyclohydrolase I [Bacillus thuringiensis BMB171]
 gi|301053148|ref|YP_003791359.1| GTP cyclohydrolase I [Bacillus anthracis CI]
 gi|41017151|sp|Q81FQ8|GCH1_BACCR RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|41017156|sp|Q81SW2|GCH1_BACAN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|81569695|sp|Q73AY4|GCH1_BACC1 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|81613873|sp|Q6HL44|GCH1_BACHK RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|81688705|sp|Q63DM1|GCH1_BACCZ RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|226709633|sp|B7JGZ6|GCH1_BACC0 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|226709634|sp|B7IP89|GCH1_BACC2 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|226709635|sp|B7HHR5|GCH1_BACC4 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|226709636|sp|B7HL21|GCH1_BACC7 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|254791030|sp|C3P598|GCH1_BACAA RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|254791031|sp|C3L8S8|GCH1_BACAC RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|254791032|sp|C1EN08|GCH1_BACC3 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|254791033|sp|B9IVN3|GCH1_BACCQ RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|29895203|gb|AAP08491.1| GTP cyclohydrolase I [Bacillus cereus ATCC 14579]
 gi|30255460|gb|AAP25469.1| GTP cyclohydrolase I [Bacillus anthracis str. Ames]
 gi|42736632|gb|AAS40567.1| GTP cyclohydrolase I [Bacillus cereus ATCC 10987]
 gi|47501954|gb|AAT30630.1| GTP cyclohydrolase I [Bacillus anthracis str. 'Ames Ancestor']
 gi|47556890|gb|EAL15220.1| GTP cyclohydrolase I [Bacillus cereus G9241]
 gi|49178365|gb|AAT53741.1| GTP cyclohydrolase I [Bacillus anthracis str. Sterne]
 gi|49332579|gb|AAT63225.1| GTP cyclohydrolase I [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|51977307|gb|AAU18857.1| GTP cyclohydrolase I [Bacillus cereus E33L]
 gi|74488446|gb|EAO52060.1| GTP cyclohydrolase I [Bacillus thuringiensis serovar israelensis
           ATCC 35646]
 gi|164714816|gb|EDR20334.1| GTP cyclohydrolase I [Bacillus anthracis str. A0488]
 gi|167512913|gb|EDR88286.1| GTP cyclohydrolase I [Bacillus anthracis str. A0193]
 gi|167531417|gb|EDR94095.1| GTP cyclohydrolase I [Bacillus anthracis str. A0442]
 gi|170128667|gb|EDS97534.1| GTP cyclohydrolase I [Bacillus anthracis str. A0389]
 gi|170669741|gb|EDT20482.1| GTP cyclohydrolase I [Bacillus anthracis str. A0465]
 gi|172083537|gb|EDT68597.1| GTP cyclohydrolase I [Bacillus anthracis str. A0174]
 gi|190560284|gb|EDV14264.1| GTP cyclohydrolase I [Bacillus anthracis Tsiankovskii-I]
 gi|196022524|gb|EDX61207.1| GTP cyclohydrolase I [Bacillus cereus 03BB108]
 gi|196030235|gb|EDX68835.1| GTP cyclohydrolase I [Bacillus cereus NVH0597-99]
 gi|206734383|gb|EDZ51553.1| GTP cyclohydrolase I [Bacillus cereus AH1134]
 gi|206746930|gb|EDZ58322.1| GTP cyclohydrolase I [Bacillus cereus H3081.97]
 gi|217066808|gb|ACJ81058.1| GTP cyclohydrolase I [Bacillus cereus AH187]
 gi|218163841|gb|ACK63833.1| GTP cyclohydrolase I [Bacillus cereus B4264]
 gi|218539278|gb|ACK91676.1| GTP cyclohydrolase I [Bacillus cereus AH820]
 gi|218541705|gb|ACK94099.1| GTP cyclohydrolase I [Bacillus cereus G9842]
 gi|221239298|gb|ACM12008.1| GTP cyclohydrolase I [Bacillus cereus Q1]
 gi|225787635|gb|ACO27852.1| GTP cyclohydrolase I [Bacillus cereus 03BB102]
 gi|227005316|gb|ACP15059.1| GTP cyclohydrolase I [Bacillus anthracis str. CDC 684]
 gi|228587708|gb|EEK45766.1| GTP cyclohydrolase 1 [Bacillus cereus m1293]
 gi|228593741|gb|EEK51546.1| GTP cyclohydrolase 1 [Bacillus cereus ATCC 10876]
 gi|228599654|gb|EEK57257.1| GTP cyclohydrolase 1 [Bacillus cereus BGSC 6E1]
 gi|228605506|gb|EEK62955.1| GTP cyclohydrolase 1 [Bacillus cereus 172560W]
 gi|228628303|gb|EEK85018.1| GTP cyclohydrolase 1 [Bacillus cereus ATCC 4342]
 gi|228633672|gb|EEK90272.1| GTP cyclohydrolase 1 [Bacillus cereus m1550]
 gi|228639217|gb|EEK95633.1| GTP cyclohydrolase 1 [Bacillus cereus BDRD-ST24]
 gi|228645196|gb|EEL01433.1| GTP cyclohydrolase 1 [Bacillus cereus BDRD-ST26]
 gi|228656524|gb|EEL12351.1| GTP cyclohydrolase 1 [Bacillus cereus BDRD-Cer4]
 gi|228662272|gb|EEL17875.1| GTP cyclohydrolase 1 [Bacillus cereus 95/8201]
 gi|228674344|gb|EEL29588.1| GTP cyclohydrolase 1 [Bacillus cereus Rock1-15]
 gi|228692775|gb|EEL46499.1| GTP cyclohydrolase 1 [Bacillus cereus Rock3-42]
 gi|228704475|gb|EEL56908.1| GTP cyclohydrolase 1 [Bacillus cereus Rock4-2]
 gi|228713915|gb|EEL65799.1| GTP cyclohydrolase 1 [Bacillus cereus F65185]
 gi|228726003|gb|EEL77242.1| GTP cyclohydrolase 1 [Bacillus cereus AH676]
 gi|228738219|gb|EEL88701.1| GTP cyclohydrolase 1 [Bacillus cereus AH1272]
 gi|228744428|gb|EEL94502.1| GTP cyclohydrolase 1 [Bacillus cereus AH1273]
 gi|228775083|gb|EEM23476.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|228801802|gb|EEM48679.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228807712|gb|EEM54234.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228814445|gb|EEM60710.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228826764|gb|EEM72532.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228839344|gb|EEM84638.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228845390|gb|EEM90425.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228852383|gb|EEM97177.1| GTP cyclohydrolase 1 [Bacillus thuringiensis IBL 200]
 gi|228859461|gb|EEN03889.1| GTP cyclohydrolase 1 [Bacillus thuringiensis IBL 4222]
 gi|229266725|gb|ACQ48362.1| GTP cyclohydrolase I [Bacillus anthracis str. A0248]
 gi|296323232|gb|ADH06160.1| GTP cyclohydrolase I [Bacillus thuringiensis BMB171]
 gi|300375317|gb|ADK04221.1| GTP cyclohydrolase I [Bacillus cereus biovar anthracis str. CI]
 gi|324325627|gb|ADY20887.1| GTP cyclohydrolase I [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 189

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 120/183 (65%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ + A+R+IL  IGDDP+REG+ DTP RV K Y E+F+G  + P        H
Sbjct: 1   MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  TVTTA  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|323489684|ref|ZP_08094911.1| GTP cyclohydrolase I [Planococcus donghaensis MPA1U2]
 gi|323396815|gb|EGA89634.1| GTP cyclohydrolase I [Planococcus donghaensis MPA1U2]
          Length = 194

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/187 (43%), Positives = 125/187 (66%), Gaps = 5/187 (2%)

Query: 8   VFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQD 67
           + ++K +K  +++ ++A+ +IL  +G+D  REGL+DTP RV K Y E+F+G K+ P    
Sbjct: 1   MIDVKAQKVDLDKIEQAVSMILEAVGEDISREGLQDTPKRVAKMYAEVFSGLKEDPKEYF 60

Query: 68  TSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVI-GLSKLVRILE 126
            + FH G    ++++VL+KDI F+S CEHH++P +GK H+AYIP+  V+ GLSKL R +E
Sbjct: 61  KTVFHEG----HEELVLVKDIPFYSMCEHHLVPFFGKAHIAYIPRDGVVTGLSKLARAVE 116

Query: 127 VYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGE 186
             S+R Q+QER+T  IA ++  + +  GV V++E +HMCM+MRGIK+ G  TVT    G 
Sbjct: 117 TVSKRPQLQERITSSIAESLMETLNPHGVYVMVEAEHMCMTMRGIKKPGAKTVTAVSRGI 176

Query: 187 FSRDKGK 193
              D  K
Sbjct: 177 LETDAVK 183


>gi|23336232|ref|ZP_00121457.1| COG0302: GTP cyclohydrolase I [Bifidobacterium longum DJO10A]
 gi|189440712|ref|YP_001955793.1| GTP cyclohydrolase I [Bifidobacterium longum DJO10A]
 gi|229487626|sp|B3DR12|GCH1_BIFLD RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|189429147|gb|ACD99295.1| GTP cyclohydrolase I [Bifidobacterium longum DJO10A]
          Length = 199

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 114/168 (67%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  +EA+R+ L+ IG+DP REGL +TPDR+ ++ +ELFAG +  P   D    HF     
Sbjct: 18  EGVREAVRLFLKSIGEDPGREGLVETPDRIARACRELFAGLQASPA--DVLEKHFD--VD 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
             ++VL+KDI  +S CEHH+LP  G  H+ YIP K  V+GLSKL R++EVY+RR Q+QER
Sbjct: 74  TDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYARRPQVQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+     ++GV V+ E +H+CMSMRGIK+    TVT+A  G
Sbjct: 134 LTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG 181


>gi|228938722|ref|ZP_04101326.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228971604|ref|ZP_04132227.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228978214|ref|ZP_04138591.1| GTP cyclohydrolase 1 [Bacillus thuringiensis Bt407]
 gi|228781231|gb|EEM29432.1| GTP cyclohydrolase 1 [Bacillus thuringiensis Bt407]
 gi|228788127|gb|EEM36083.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228820963|gb|EEM66984.1| GTP cyclohydrolase 1 [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|326939228|gb|AEA15124.1| GTP cyclohydrolase I [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 189

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 120/183 (65%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ + A+R+IL  IGDDP+REG+ DTP RV K Y E+F+G  + P        H
Sbjct: 1   MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  TVTTA  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|299769289|ref|YP_003731315.1| GTP cyclohydrolase I [Acinetobacter sp. DR1]
 gi|298699377|gb|ADI89942.1| GTP cyclohydrolase I [Acinetobacter sp. DR1]
          Length = 184

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +R GLKDTP R  K++  L +GY K +    + + F     S   +MVL+K
Sbjct: 10  ILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVF----PSDNHEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 66  NIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 126 AEVTSARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFL 177


>gi|297201401|ref|ZP_06918798.1| GTP cyclohydrolase I [Streptomyces sviceus ATCC 29083]
 gi|197713810|gb|EDY57844.1| GTP cyclohydrolase I [Streptomyces sviceus ATCC 29083]
          Length = 201

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 117/169 (69%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL++TP RV ++Y+E+FAG  Q P    T+ F  G    + 
Sbjct: 21  AENAVRELLIAVGEDPDREGLRETPGRVARAYREIFAGLWQKPEDVLTTTFDIG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  +S CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVYSTCEHHLVPFRGVAHVGYIPATTGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    + +GV V++E +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TTQIADSLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRGQL 185


>gi|260905555|ref|ZP_05913877.1| GTP cyclohydrolase [Brevibacterium linens BL2]
          Length = 207

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 117/174 (67%), Gaps = 6/174 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R IL  +G+DPDREGL +TPDRV ++Y+E+FAG  + P       F       +++MV
Sbjct: 30  AVREILIAVGEDPDREGLVETPDRVARAYEEVFAGLHRDPAEVLGVTFDI----SHEEMV 85

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERLTMQ 141
           L++DI  +S CEHH++P  G  H+ YIP K+  V GLSKL R++E+Y+RR Q+QERLT Q
Sbjct: 86  LVRDIDLYSTCEHHLVPFHGVAHIGYIPSKNGKVTGLSKLARLVEIYARRPQVQERLTTQ 145

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           IA A+    + +G  V++E +H+CM+MRG+++ G +T+T+A  G+      + +
Sbjct: 146 IADALVEHLEPQGAIVVVEAEHLCMTMRGVRKPGASTITSAVRGQLRETASRAE 199


>gi|327403032|ref|YP_004343870.1| GTP cyclohydrolase 1 [Fluviicola taffensis DSM 16823]
 gi|327318540|gb|AEA43032.1| GTP cyclohydrolase 1 [Fluviicola taffensis DSM 16823]
          Length = 196

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 120/182 (65%), Gaps = 6/182 (3%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPT-TQDTSRFHFGE 75
           T E      + IL  IG++P+REGL  TP+RV K+ + L  GY   P     ++ FH   
Sbjct: 10  TTENISTIYKSILSQIGENPEREGLLKTPERVAKALQFLTQGYDIKPADILKSALFH--- 66

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
             +Y +MV++KDI  +S CEHH+LP +GK H+AYIP   ++GLSK+ R+++ +SRRLQ+Q
Sbjct: 67  -EEYSEMVIVKDIEVYSMCEHHMLPFFGKAHIAYIPNGTIVGLSKIPRVVDAFSRRLQVQ 125

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKT 194
           ERLT++I   I+ +   KGVAV++E QHMCM MRG+++    T ++AFTG F S D  + 
Sbjct: 126 ERLTIEIRDCIQETLKPKGVAVVLECQHMCMQMRGVQKQNSVTTSSAFTGLFLSNDSTRK 185

Query: 195 DF 196
           +F
Sbjct: 186 EF 187


>gi|329929490|ref|ZP_08283224.1| GTP cyclohydrolase I [Paenibacillus sp. HGF5]
 gi|328936378|gb|EGG32825.1| GTP cyclohydrolase I [Paenibacillus sp. HGF5]
          Length = 197

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 120/182 (65%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ +  +  IL+ IG+DP REGL +TP RV + Y+E+FAGY+  P  ++     F E   
Sbjct: 17  EQIEYHVEQILKLIGEDPKREGLLETPARVTRMYEEIFAGYEVDP--KEVLGVTFDE--N 72

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           ++++V++KDI ++S CEHH+ P +GK+H+ Y+P   + GLSKL R++E  +RRLQ+QER+
Sbjct: 73  HEELVIVKDIVYYSQCEHHMAPFFGKVHIGYVPSGKIAGLSKLARLVEAVTRRLQVQERI 132

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA  +  +    GV V++EG+H+CM  RG+K+ G  TVT+A  G F  D  +   FL
Sbjct: 133 TSQIADIMVEALQPNGVMVVVEGEHLCMCARGVKKPGSKTVTSAVRGTFQSDSAQRSEFL 192

Query: 199 KM 200
            +
Sbjct: 193 SL 194


>gi|291298363|ref|YP_003509641.1| GTP cyclohydrolase I [Stackebrandtia nassauensis DSM 44728]
 gi|290567583|gb|ADD40548.1| GTP cyclohydrolase I [Stackebrandtia nassauensis DSM 44728]
          Length = 214

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 115/173 (66%), Gaps = 7/173 (4%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R IL  IG+DPDREGL  TP RV ++Y ELFAG +  P     + F    +  + +++
Sbjct: 34  AVREILYAIGEDPDREGLAKTPGRVARAYAELFAGLRVDPAQVLKTVF----SEDHDELI 89

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +++DI  FS+CEHH+LP  G  H+ YIP  H  + GLSKL R++E Y+RR Q+QERLT Q
Sbjct: 90  VVRDIEVFSFCEHHLLPFTGVAHIGYIPGAHGRITGLSKLARLVEAYARRPQVQERLTSQ 149

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           IA  +  + ++ GV V++E +HMCMSMRGI++ G  T+T+A  G   RD  K+
Sbjct: 150 IADQLHETLEANGVIVVVECEHMCMSMRGIRKPGARTLTSAVRG-ILRDNAKS 201


>gi|229058246|ref|ZP_04196634.1| GTP cyclohydrolase 1 [Bacillus cereus AH603]
 gi|228720110|gb|EEL71694.1| GTP cyclohydrolase 1 [Bacillus cereus AH603]
          Length = 189

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 120/183 (65%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ + A+R+IL  IGDDP+REG+ DTP RV K Y E+F+G  + P        H
Sbjct: 1   MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPRGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  T+TTA  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTITTAVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|315645153|ref|ZP_07898279.1| GTP cyclohydrolase I [Paenibacillus vortex V453]
 gi|315279574|gb|EFU42879.1| GTP cyclohydrolase I [Paenibacillus vortex V453]
          Length = 197

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 117/173 (67%), Gaps = 4/173 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL+ IG+D +REGL +TP RV + Y+E+FAGY+  P  +D     F E   ++++V++KD
Sbjct: 26  ILKLIGEDTEREGLLETPARVTRMYEEIFAGYEVDP--KDVLGVTFDE--NHEELVIVKD 81

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I ++S CEHH+ P +GK+H+ Y+P   + GLSKL R++E  +RRLQ+QER+T QIA  + 
Sbjct: 82  IVYYSQCEHHMAPFFGKVHIGYVPSGKIAGLSKLARLVEAVTRRLQVQERITSQIADIMV 141

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
            + +  GV V++EG+H+CM  RG+K+ G  TVT+A  G F  D  +   FL +
Sbjct: 142 EALEPNGVMVVVEGEHLCMCARGVKKPGSKTVTSAVRGSFRSDSAQRSEFLSL 194


>gi|111225922|ref|YP_716716.1| GTP cyclohydrolase I [Frankia alni ACN14a]
 gi|111153454|emb|CAJ65212.1| GTP cyclohydrolase I [Frankia alni ACN14a]
          Length = 183

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/166 (47%), Positives = 117/166 (70%), Gaps = 6/166 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R +L  IG+DPDREGL+ TPDRV ++Y+E   G  + P+   T+ F  G    + +MV
Sbjct: 4   AVRELLIGIGEDPDREGLRKTPDRVARAYREAVEGLGREPSEVLTTVFDEG----HDEMV 59

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           L++DI F S CEHH++   G+ H+AYIP  +  + GLSKL R++++Y+RR Q+QERLT Q
Sbjct: 60  LVRDIDFSSLCEHHLVVFSGRAHVAYIPNNRGQITGLSKLARLVDLYARRPQVQERLTSQ 119

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           IA A+    + +GV V++E +H+CMSMRG+++ G TTVT+A  G+F
Sbjct: 120 IADALVDVLEPRGVMVVVEAEHLCMSMRGVRKPGATTVTSAVRGQF 165


>gi|145296691|ref|YP_001139512.1| GTP cyclohydrolase I [Corynebacterium glutamicum R]
 gi|166220271|sp|A4QH94|GCH1_CORGB RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|140846611|dbj|BAF55610.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 196

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 117/174 (67%), Gaps = 6/174 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A  AIR +L  +G+DPDREGL +TP RV ++YKE FAG  + PTT     F  G    
Sbjct: 13  ERATAAIRELLIAVGEDPDREGLLETPARVARAYKETFAGLHEDPTTVLEKTFSEG---- 68

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++VL+++I  +S CEHH++P +G  H+ YIP K   V GLSKL R+ ++ ++R Q+QE
Sbjct: 69  HEELVLVREIPIYSMCEHHLVPFFGVAHIGYIPGKSGKVTGLSKLARLADMLAKRPQVQE 128

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLT QIA A+    D++ VAV+IE +H+CM+MRGI++ G  T T+A  G F  +
Sbjct: 129 RLTSQIADALVEKLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAVRGGFKNN 182


>gi|296877155|ref|ZP_06901195.1| GTP cyclohydrolase I [Streptococcus parasanguinis ATCC 15912]
 gi|296431675|gb|EFH17482.1| GTP cyclohydrolase I [Streptococcus parasanguinis ATCC 15912]
          Length = 184

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 120/182 (65%), Gaps = 5/182 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+++I+  +G+D +REGL++TP R+ K Y+E+FAG  Q      +  F   +     +
Sbjct: 7   EEAVKMIIEAVGEDENREGLQETPTRIAKMYQEIFAGLGQTAEEHLSKSFEIID----NN 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+ KDI F S CEHH LP +GK+H+AYIP   V GLSKL R +EVY+++ QIQERLT++
Sbjct: 63  MVVEKDIFFHSMCEHHFLPFYGKVHIAYIPNGRVAGLSKLARTVEVYAKKPQIQERLTVE 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFFLKM 200
           IA A+     ++G  V +E +HMCM+MRG+++ G  TVTTA  G  + +K  K + +  M
Sbjct: 123 IADALMEYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGVLATNKDLKNEAYKLM 182

Query: 201 TH 202
            H
Sbjct: 183 GH 184


>gi|256833316|ref|YP_003162043.1| GTP cyclohydrolase I [Jonesia denitrificans DSM 20603]
 gi|256686847|gb|ACV09740.1| GTP cyclohydrolase I [Jonesia denitrificans DSM 20603]
          Length = 200

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 118/172 (68%), Gaps = 6/172 (3%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           ++ A  A+R +L  +G+DPDREGL+DTP RV K+Y E+FAG +Q PT    + F  G   
Sbjct: 17  LDRAAAAVRELLTAVGEDPDREGLRDTPRRVAKAYAEVFAGLRQNPTDVLNTVFDIG--- 73

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQ 135
            + +M+L++DI  +S CEHH++P  G  H+ YIP +   V GLSKL R+++VY++R Q+Q
Sbjct: 74  -HDEMILVRDIDVYSTCEHHLVPFHGVAHVGYIPGEDGRVTGLSKLARLVDVYAKRPQVQ 132

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           ERLT QIA ++      +GV V++E +H+CM+MRG+++ G  T+T+A  G+ 
Sbjct: 133 ERLTTQIADSLVDVLHPRGVIVVVECEHLCMTMRGVRKPGARTITSAVRGQL 184


>gi|300117461|ref|ZP_07055251.1| GTP cyclohydrolase I [Bacillus cereus SJ1]
 gi|298725296|gb|EFI65948.1| GTP cyclohydrolase I [Bacillus cereus SJ1]
          Length = 189

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 120/183 (65%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ + A+R+IL  IGDDP+REG+ DTP RV K Y E+F+G  + P        H
Sbjct: 1   MAKVNLEQIEHAVRLILEAIGDDPNREGVFDTPKRVAKMYAEVFSGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  TVTTA  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|103487395|ref|YP_616956.1| GTP cyclohydrolase I [Sphingopyxis alaskensis RB2256]
 gi|98977472|gb|ABF53623.1| GTP cyclohydrolase [Sphingopyxis alaskensis RB2256]
          Length = 200

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 114/173 (65%), Gaps = 2/173 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           +   +A+R ++ W GDDP REGL DTP RV +++KE  +GY + P+   +  F   E   
Sbjct: 18  DHVADAVRTLIEWAGDDPAREGLLDTPRRVARAWKEYCSGYGEDPSIHLSRTFE--EVGG 75

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y ++VL++DI F S+CEHH+ PI GK  +AY+P+  V+G+SKL R+L  Y+RRLQ+QERL
Sbjct: 76  YDEVVLLRDIPFQSHCEHHMAPITGKASIAYLPRDRVVGISKLARVLNGYARRLQVQERL 135

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           T ++A  I  +    GVAV+I+ QH CM+ RG++  G+  VT+   G F  D+
Sbjct: 136 TAEVAQCIWDNLQPHGVAVVIDAQHGCMTGRGVRTPGVGMVTSRLLGCFLEDQ 188


>gi|260437276|ref|ZP_05791092.1| GTP cyclohydrolase I [Butyrivibrio crossotus DSM 2876]
 gi|292810586|gb|EFF69791.1| GTP cyclohydrolase I [Butyrivibrio crossotus DSM 2876]
          Length = 200

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/179 (49%), Positives = 119/179 (66%), Gaps = 6/179 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY----KQIPTT-QDTSRFHF 73
           E  K+ IR IL  +GDDPDREGLKDTP+RV K Y+E+F G     K+I      T     
Sbjct: 6   EAIKKHIRGILIALGDDPDREGLKDTPERVAKMYEEVFEGMNYSNKEIAEMFNKTFEQGL 65

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWG-KIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
              +  +DMVL+KDI  FSYCEHH+  ++  K+ +AYIP   VIGLSK+ RI ++  +RL
Sbjct: 66  DTITDSKDMVLVKDIDIFSYCEHHLALMYDVKVSVAYIPNGKVIGLSKIARIADMVGKRL 125

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           Q+QE++   IA  +E+ T+S+ +AV IEG H CM+ RGIK++   TVTT F GEFS+DK
Sbjct: 126 QLQEKIGSDIAEIMETVTESEDIAVYIEGCHSCMTARGIKKNNSKTVTTTFRGEFSKDK 184


>gi|332520248|ref|ZP_08396710.1| GTP cyclohydrolase I [Lacinutrix algicola 5H-3-7-4]
 gi|332043601|gb|EGI79796.1| GTP cyclohydrolase I [Lacinutrix algicola 5H-3-7-4]
          Length = 198

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/191 (42%), Positives = 123/191 (64%), Gaps = 11/191 (5%)

Query: 9   FNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT 68
           +N+K+     ++ K+  + I+  +G+D  REGL  TP+R  K+ + L  GY      Q+ 
Sbjct: 9   YNIKV----TDDVKDRYKKIIEDLGEDTSREGLVKTPERAAKAMQFLTQGY-----NQNA 59

Query: 69  SRFHFGEASK--YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILE 126
           +    G   K  Y DMV++KDI F+S CEHHILP +GK H+AYIP  H++GLSKL RI++
Sbjct: 60  AEILKGAMFKEDYNDMVVVKDIEFYSLCEHHILPFFGKAHIAYIPNGHIVGLSKLPRIVD 119

Query: 127 VYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGE 186
           V++RRLQ+QERLT +I + I+ +   +GVAV++E  HMCM MRG+++    T T+ F G 
Sbjct: 120 VFARRLQVQERLTHEILNCIDDTLKPEGVAVVLEASHMCMQMRGVQKQSSVTTTSGFRGA 179

Query: 187 FSRDKGKTDFF 197
           F   + +T+F 
Sbjct: 180 FKNIETRTEFL 190


>gi|37521149|ref|NP_924526.1| GTP cyclohydrolase I [Gloeobacter violaceus PCC 7421]
 gi|41017110|sp|Q7NK98|GCH1_GLOVI RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|35212145|dbj|BAC89521.1| GTP cyclohydrolase I [Gloeobacter violaceus PCC 7421]
          Length = 214

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 120/183 (65%), Gaps = 5/183 (2%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQD 81
           +A+R +L  +G+DP+R GL+ TP RV ++ K L  GY Q +    + + F  G    + +
Sbjct: 33  DAVRTLLVGVGEDPERNGLERTPKRVAEALKFLTKGYGQSLEELLNGAIFDLG----HDE 88

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL++DI  FS CEHH+LP  G+ H+ YIP + V+GLSKL RI+E+Y+RRLQ+QERLT Q
Sbjct: 89  LVLVRDIDLFSMCEHHMLPFIGRAHVGYIPDQKVVGLSKLARIVEMYARRLQVQERLTRQ 148

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA A++     +GVAV+IE  HMCM MRG+++    TVT++  G F   +     FL + 
Sbjct: 149 IAEALQEVLQPRGVAVVIEASHMCMVMRGVQKPNSWTVTSSMVGVFKESQSTRQEFLDLI 208

Query: 202 HNQ 204
           H++
Sbjct: 209 HHK 211


>gi|302521007|ref|ZP_07273349.1| GTP cyclohydrolase I [Streptomyces sp. SPB78]
 gi|318061595|ref|ZP_07980316.1| GTP cyclohydrolase I [Streptomyces sp. SA3_actG]
 gi|318077179|ref|ZP_07984511.1| GTP cyclohydrolase I [Streptomyces sp. SA3_actF]
 gi|333025312|ref|ZP_08453376.1| putative GTP cyclohydrolase I [Streptomyces sp. Tu6071]
 gi|302429902|gb|EFL01718.1| GTP cyclohydrolase I [Streptomyces sp. SPB78]
 gi|332745164|gb|EGJ75605.1| putative GTP cyclohydrolase I [Streptomyces sp. Tu6071]
          Length = 201

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 116/169 (68%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL++TP RV ++YKE+FAG  Q P    T+ F  G    + 
Sbjct: 21  AENAVRELLLAVGEDPDREGLRETPGRVARAYKEIFAGLWQEPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI   S CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVQSTCEHHLVPFVGVAHVGYIPASDGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T Q+A A+    + +GV V+IE +H+CMSMRG+++ G  T+T+A  G+ 
Sbjct: 137 TTQVAEALMRILEPRGVIVVIECEHLCMSMRGVRKPGAKTLTSAVRGQL 185


>gi|169632918|ref|YP_001706654.1| GTP cyclohydrolase I [Acinetobacter baumannii SDF]
 gi|239502493|ref|ZP_04661803.1| GTP cyclohydrolase I [Acinetobacter baumannii AB900]
 gi|260549747|ref|ZP_05823964.1| GTP cyclohydrolase I [Acinetobacter sp. RUH2624]
 gi|301512112|ref|ZP_07237349.1| GTP cyclohydrolase I [Acinetobacter baumannii AB058]
 gi|169151710|emb|CAP00507.1| GTP cyclohydrolase I [Acinetobacter baumannii]
 gi|193077895|gb|ABO12785.2| GTP cyclohydrolase I [Acinetobacter baumannii ATCC 17978]
 gi|260407264|gb|EEX00740.1| GTP cyclohydrolase I [Acinetobacter sp. RUH2624]
 gi|322508858|gb|ADX04312.1| folE [Acinetobacter baumannii 1656-2]
 gi|323518855|gb|ADX93236.1| GTP cyclohydrolase I [Acinetobacter baumannii TCDC-AB0715]
          Length = 184

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +R GLKDTP R  K++  L +GY K +    + + F     S   +MVL+K
Sbjct: 10  ILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVF----PSDNHEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 66  NIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 126 AEVTGARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFL 177


>gi|164661621|ref|XP_001731933.1| hypothetical protein MGL_1201 [Malassezia globosa CBS 7966]
 gi|159105834|gb|EDP44719.1| hypothetical protein MGL_1201 [Malassezia globosa CBS 7966]
          Length = 228

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 120/182 (65%), Gaps = 6/182 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R IL  +G+DPDR GL+DTP R  ++   +  GY++       S   F E   + +MV
Sbjct: 51  AVRTILECLGEDPDRSGLQDTPKRYARALLWMTKGYEE-RLCDVISNAIFDE--NHDEMV 107

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           +++DI  FS CEHH++P  GKIH+ YIP + VIGLSKL RI E ++RRL +QERLT Q+A
Sbjct: 108 IVRDIDVFSLCEHHLVPFKGKIHIGYIPNRMVIGLSKLARIAETFARRLSVQERLTRQVA 167

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT--DFFLKMT 201
            A+  +   +GVAV++E +HMCM+MRG+++ G  TVT+   G F RD+ KT  +F   + 
Sbjct: 168 LALNEALKPRGVAVVMECEHMCMAMRGVQKPGSNTVTSCMLGVF-RDRAKTREEFLSLIR 226

Query: 202 HN 203
           HN
Sbjct: 227 HN 228


>gi|225012774|ref|ZP_03703208.1| GTP cyclohydrolase I [Flavobacteria bacterium MS024-2A]
 gi|225003048|gb|EEG41024.1| GTP cyclohydrolase I [Flavobacteria bacterium MS024-2A]
          Length = 197

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/189 (43%), Positives = 118/189 (62%), Gaps = 4/189 (2%)

Query: 9   FNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT 68
           FN++   P  E+ +     IL  +G+D  REGL  TP+R  K+ + L  GY+Q P     
Sbjct: 5   FNLE-TLPETEKIQTNYEDILHLLGEDKAREGLLKTPERAAKAMRFLTEGYEQDPKKILK 63

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
           S   F E   Y +MV++KDI  +S CEHH+LP +GK H+AYIP  H++GLSK+ R+++V+
Sbjct: 64  SAM-FEET--YNEMVIVKDIELYSLCEHHMLPFFGKAHIAYIPNGHIVGLSKIPRVVDVF 120

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           +RRLQ+QERLT QI   I  +    GVAV+IE  HMCM MRG+++   TT T+ F G F 
Sbjct: 121 ARRLQVQERLTEQILDCINETLQPTGVAVVIEASHMCMMMRGVQKQNSTTTTSGFRGAFK 180

Query: 189 RDKGKTDFF 197
               +++F 
Sbjct: 181 ETDTRSEFL 189


>gi|329948203|ref|ZP_08295075.1| GTP cyclohydrolase I [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328522936|gb|EGF50041.1| GTP cyclohydrolase I [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 190

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 114/169 (67%), Gaps = 6/169 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  + A+R +L  IG+DPDR+GL+DTP+R+ ++Y E+FAG  Q P       F  G    
Sbjct: 6   EGVRRAVRDLLVAIGEDPDRDGLRDTPERMARAYAEMFAGLGQDPAEHVERVFDVG---- 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +++MVL++DI  +S CEHH+LP  G  H+ YIP     V GLSK+ R+++ Y+RR Q+QE
Sbjct: 62  HEEMVLVRDIPMYSVCEHHLLPFHGAAHVGYIPGADGRVTGLSKVARLVDGYARRPQVQE 121

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           RLT QIA A+    + +GV V++E +H+CMSMRG+++ G  TVT+A  G
Sbjct: 122 RLTRQIADALVERLECRGVLVVVEAEHLCMSMRGVRKPGSNTVTSAVRG 170


>gi|229096102|ref|ZP_04227075.1| GTP cyclohydrolase 1 [Bacillus cereus Rock3-29]
 gi|229102214|ref|ZP_04232923.1| GTP cyclohydrolase 1 [Bacillus cereus Rock3-28]
 gi|229115058|ref|ZP_04244468.1| GTP cyclohydrolase 1 [Bacillus cereus Rock1-3]
 gi|228668198|gb|EEL23630.1| GTP cyclohydrolase 1 [Bacillus cereus Rock1-3]
 gi|228681115|gb|EEL35283.1| GTP cyclohydrolase 1 [Bacillus cereus Rock3-28]
 gi|228687062|gb|EEL40967.1| GTP cyclohydrolase 1 [Bacillus cereus Rock3-29]
          Length = 189

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 120/183 (65%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ + A+R+IL  IGDDP+REG+ DTP RV K Y E+F+G  + P        H
Sbjct: 1   MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPK----EHLH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A++I    +  GV V++E +HMCM+MRG+K+ G  T+TTA  G    
Sbjct: 115 RRPQLQERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTITTAVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|225022113|ref|ZP_03711305.1| hypothetical protein CORMATOL_02146 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945046|gb|EEG26255.1| hypothetical protein CORMATOL_02146 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 206

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 121/172 (70%), Gaps = 6/172 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  IG+DPDREGL++TP RV ++Y E+FAG    PT      F    +  
Sbjct: 24  ERAERAVRELLLAIGEDPDREGLRETPARVARAYAEIFAGLHTDPTAVLDRTF----SED 79

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++V++KDI  +S CEHH++P +G+ H+ YIP +   VIGLSKL R+++++++R Q+QE
Sbjct: 80  HRELVVVKDIPIYSTCEHHLVPFFGRAHIGYIPGESGKVIGLSKLARVVDLFAKRPQVQE 139

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           RLT Q+A A+ +  +  GV V+IE +H+CM+MRGI++ G  TVT+A  G F+
Sbjct: 140 RLTRQVADALVTKLEPHGVIVVIECEHLCMAMRGIRKPGAATVTSAVRGGFA 191


>gi|332873669|ref|ZP_08441613.1| GTP cyclohydrolase I [Acinetobacter baumannii 6014059]
 gi|332738151|gb|EGJ69034.1| GTP cyclohydrolase I [Acinetobacter baumannii 6014059]
          Length = 182

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +R GLKDTP R  K++  L +GY K +    + + F     S   +MVL+K
Sbjct: 8   ILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVF----PSDNHEMVLVK 63

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 64  NIEFYSLCEHHLLPFYGRVHVAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIAEAV 123

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 124 AEVTGARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKEARREFL 175


>gi|302559294|ref|ZP_07311636.1| GTP cyclohydrolase I [Streptomyces griseoflavus Tu4000]
 gi|302476912|gb|EFL40005.1| GTP cyclohydrolase I [Streptomyces griseoflavus Tu4000]
          Length = 201

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 116/169 (68%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL +TP RV ++Y+E+FAG  Q P    T+ F  G    + 
Sbjct: 21  ARNAVRELLIAVGEDPDREGLLETPARVARAYREIFAGLWQKPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  +S CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVYSTCEHHLVPFRGVAHVGYIPATSGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    + +GV V++E +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TTQIADSLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSAVRGQL 185


>gi|305680565|ref|ZP_07403373.1| GTP cyclohydrolase I [Corynebacterium matruchotii ATCC 14266]
 gi|305660096|gb|EFM49595.1| GTP cyclohydrolase I [Corynebacterium matruchotii ATCC 14266]
          Length = 206

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 121/172 (70%), Gaps = 6/172 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  IG+DPDREGL++TP RV ++Y E+FAG    PT      F    +  
Sbjct: 24  ERAERAVRELLLAIGEDPDREGLRETPARVARAYAEIFAGLHTDPTAVLDRTF----SED 79

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++V++KDI  +S CEHH++P +G+ H+ YIP +   VIGLSKL R+++++++R Q+QE
Sbjct: 80  HRELVVVKDIPIYSTCEHHLVPFFGRAHIGYIPGESGKVIGLSKLARVVDLFAKRPQVQE 139

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           RLT Q+A A+ +  +  GV V+IE +H+CM+MRGI++ G  TVT+A  G F+
Sbjct: 140 RLTRQVADALVTKLEPHGVIVVIECEHLCMAMRGIRKPGAATVTSAVRGGFA 191


>gi|84495017|ref|ZP_00994136.1| GTP cyclohydrolase I [Janibacter sp. HTCC2649]
 gi|84384510|gb|EAQ00390.1| GTP cyclohydrolase I [Janibacter sp. HTCC2649]
          Length = 221

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 117/171 (68%), Gaps = 6/171 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  IG+DPDREGL+DTPDRV ++  +L+AG  Q P+   ++RF       
Sbjct: 37  ERARAAVRELLFAIGEDPDREGLRDTPDRVARAATQLYAGLSQDPSDVLSARFSI----D 92

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++++++DI  FS CEHH+LP  G  H+ YIP     V GLSKL R+++V++RR Q+QE
Sbjct: 93  HEELIIVRDIEIFSTCEHHLLPFHGVAHVGYIPAPDGTVTGLSKLARLVDVFARRPQVQE 152

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           R+T Q+A A+      +GV V+IE +H+CMSMRG+ + G  T+T+A  G+ 
Sbjct: 153 RITTQVADALVEHLGVQGVIVVIEAEHLCMSMRGVHKPGSRTITSAVRGQL 203


>gi|332374032|gb|AEE62157.1| unknown [Dendroctonus ponderosae]
          Length = 286

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 119/186 (63%), Gaps = 7/186 (3%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEA 76
           + E   A R +L  +G++PDREGL  TP+R  K+      GY Q +    + + F     
Sbjct: 103 IPEMTSAYRSLLSSLGENPDREGLLKTPERAAKAMLYFTKGYDQSLEEILNDAIFD---- 158

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             + +MV++KDI  FS CEHH++P +GK+ + Y+P   V+GLSKL RI+EVYSRRLQ+QE
Sbjct: 159 ENHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPSGKVLGLSKLARIVEVYSRRLQVQE 218

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT-D 195
           RLT QIA A+  +    GVAV++EG HMCM MRG+++    TVT+   GEF RD  KT +
Sbjct: 219 RLTKQIAVAVLKAVQPTGVAVVVEGSHMCMVMRGVQKINSKTVTSTMLGEF-RDNQKTRE 277

Query: 196 FFLKMT 201
            FLK+ 
Sbjct: 278 EFLKLA 283


>gi|311897758|dbj|BAJ30166.1| putative GTP cyclohydrolase I [Kitasatospora setae KM-6054]
          Length = 201

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 115/169 (68%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL +TP RV ++Y+E+FAG  Q P    T+ F  G    + 
Sbjct: 21  AENAVRELLIAVGEDPDREGLLETPARVARAYREIFAGLWQRPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  FS CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPSASGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T Q+A A+    + +G  V+IE +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TSQVADALMRILEPRGAIVVIECEHMCMSMRGIRKPGAKTLTSAVRGQL 185


>gi|306823450|ref|ZP_07456825.1| GTP cyclohydrolase I [Bifidobacterium dentium ATCC 27679]
 gi|309802646|ref|ZP_07696750.1| GTP cyclohydrolase I [Bifidobacterium dentium JCVIHMP022]
 gi|304553157|gb|EFM41069.1| GTP cyclohydrolase I [Bifidobacterium dentium ATCC 27679]
 gi|308220710|gb|EFO77018.1| GTP cyclohydrolase I [Bifidobacterium dentium JCVIHMP022]
          Length = 212

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 113/168 (67%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  ++A+R+ LR IG+DPDREGL DTPDR+ ++ +ELFAG    P     ++F       
Sbjct: 29  EGVRQAVRLFLRSIGEDPDREGLLDTPDRIGRACRELFAGLGHGPEEVLKTKFKV----D 84

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
             +MVL++DI  FS CEHH+LP  G  H+ YIP    V GLSKL R++E+Y+RR Q+QER
Sbjct: 85  TDEMVLVRDIELFSVCEHHLLPFHGVAHVGYIPSNGQVAGLSKLARLVELYARRPQVQER 144

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT Q+A A+ +  +++GV V+ E  HMCM+MRG+K+    TVT+A  G
Sbjct: 145 LTQQVADALMTGIEARGVIVVTECDHMCMAMRGVKKPQSRTVTSAVRG 192


>gi|117927414|ref|YP_871965.1| GTP cyclohydrolase I [Acidothermus cellulolyticus 11B]
 gi|117647877|gb|ABK51979.1| GTP cyclohydrolase I [Acidothermus cellulolyticus 11B]
          Length = 200

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 128/192 (66%), Gaps = 13/192 (6%)

Query: 4   LRTGVFNMKLKKPTVEEAK--EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ 61
           LRTG      + P V+ A+  +A+R IL  IG+DPDR+GL+DTP RV ++Y E FAG +Q
Sbjct: 6   LRTGE-----RAPGVDLARIEDAVREILLAIGEDPDRDGLRDTPARVARAYAEQFAGLRQ 60

Query: 62  IPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLS 119
            P  +D     F   + + +MVL++DI  +S CEHH+ P  G  H+ YIP  +  + GLS
Sbjct: 61  RP--EDVLSVVFD--ANHDEMVLVRDIEVYSTCEHHLTPFHGVAHVGYIPNARGQITGLS 116

Query: 120 KLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTV 179
           K+ R++++++RR Q+QERLT+QIA A+E     +GV V+++ +H+CMSMRG+++ G  TV
Sbjct: 117 KIARLVDIFARRPQVQERLTVQIAEAMERILQPRGVIVVVDCEHLCMSMRGVRKPGARTV 176

Query: 180 TTAFTGEFSRDK 191
           T+A  G F  D+
Sbjct: 177 TSAVRGVFRSDE 188


>gi|29831210|ref|NP_825844.1| GTP cyclohydrolase I [Streptomyces avermitilis MA-4680]
 gi|41017160|sp|Q82EE8|GCH1_STRAW RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|29608324|dbj|BAC72379.1| putative GTP cyclohydrolase I [Streptomyces avermitilis MA-4680]
          Length = 201

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 116/169 (68%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL++TP RV ++Y+E+FAG  Q P    T+ F  G    + 
Sbjct: 21  AENAVRELLIAVGEDPDREGLRETPGRVARAYREIFAGLWQKPEDVLTTTFDIG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI   S CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVLSSCEHHLVPFVGVAHVGYIPSTDGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T Q+A ++    + +GV V++E +HMCMSMRG+++ G  T+T+A  G+ 
Sbjct: 137 TTQVADSLMEILEPRGVIVVVECEHMCMSMRGVRKPGAKTITSAVRGQL 185


>gi|168700066|ref|ZP_02732343.1| GTP cyclohydrolase I [Gemmata obscuriglobus UQM 2246]
          Length = 214

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 111/166 (66%), Gaps = 4/166 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           + A+R IL  +G+DPDREGL +TPDRV + Y E+FAG +  P       F      K+ +
Sbjct: 35  RSAVREILLAVGEDPDREGLLETPDRVARMYAEVFAGLQTDPAVYLQKTF----TQKHDE 90

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL+KDI F S CEHH+LP +GK H+AY+P   ++GLSKL R+++  +RR Q+QER+T  
Sbjct: 91  MVLVKDIEFASCCEHHLLPFFGKAHIAYLPNGQIVGLSKLARVVDAVARRPQVQERMTEN 150

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           IA  + +   ++GV V+IE  H CM++RG+++ G  T+T++  G F
Sbjct: 151 IADLVMTHLKARGVGVVIEASHSCMTIRGVRKPGAMTITSSMRGGF 196


>gi|304406397|ref|ZP_07388053.1| GTP cyclohydrolase I [Paenibacillus curdlanolyticus YK9]
 gi|304344455|gb|EFM10293.1| GTP cyclohydrolase I [Paenibacillus curdlanolyticus YK9]
          Length = 197

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 121/179 (67%), Gaps = 4/179 (2%)

Query: 25  IRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVL 84
           ++ IL+ IG+D +REGL +TP RV + Y+E+FAGY+  P  +D     F E  +++++V+
Sbjct: 23  VKEILKLIGEDVEREGLLETPARVARMYEEIFAGYEVDP--RDVLGVTFDE--QHEELVI 78

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +KDI F+S CEHH+ P +GK+H+ YIP   + GLSKL R++E  +R+LQ+QER+T QIA 
Sbjct: 79  VKDIVFYSQCEHHMAPFFGKVHIGYIPSGKIAGLSKLARLVEAVTRKLQVQERITSQIAD 138

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHN 203
            +  +    GV V++EG+H+CM  RG+K+ G  T+T+A  G+F R+      F+ +  +
Sbjct: 139 ILAETLSPHGVMVVVEGEHLCMCARGVKKPGSKTITSAVRGQFHRNAAARAEFMALIRD 197


>gi|291457317|ref|ZP_06596707.1| GTP cyclohydrolase I [Bifidobacterium breve DSM 20213]
 gi|291381152|gb|EFE88670.1| GTP cyclohydrolase I [Bifidobacterium breve DSM 20213]
          Length = 221

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 115/168 (68%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  ++A+R+ L+ IG+DP+REGL +TPDR+ ++ +ELFAG +  P   D    HF     
Sbjct: 40  EGVRQAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQASPA--DVLEKHFD--VD 95

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
             ++VL+KDI  +S CEHH+LP  G  H+ YIP K  V+GLSKL R++EVY+RR Q+QER
Sbjct: 96  TDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYARRPQVQER 155

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+     ++GV V+ E +H+CMSMRGIK+    TVT+A  G
Sbjct: 156 LTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG 203


>gi|118475027|ref|YP_892814.1| GTP cyclohydrolase I [Campylobacter fetus subsp. fetus 82-40]
 gi|118414253|gb|ABK82673.1| GTP cyclohydrolase I [Campylobacter fetus subsp. fetus 82-40]
          Length = 195

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 126/179 (70%), Gaps = 4/179 (2%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKY 79
           E ++ ++ +L  +G++PDREGL +TP RV K+Y+ + +GY Q P  +D       ++S  
Sbjct: 9   EFEKCVKTMLEILGENPDREGLLNTPKRVAKAYEFITSGYWQDP--KDVLNDAMFDSSN- 65

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            +MVL+KDI F+S CEHH+LPI G+ H+AYIP   V+GLSK+ R++ +Y+RRLQIQE++T
Sbjct: 66  NEMVLLKDIEFYSICEHHLLPIIGRAHVAYIPDGKVVGLSKIPRMVNIYARRLQIQEQMT 125

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
            QIA A++ +   KGV V++E +HMC+ MRG+++   TT T+A  G F ++ + + +FF
Sbjct: 126 EQIAQALQDAISPKGVGVVVEARHMCIEMRGVEKINSTTTTSALRGIFIKNAETRKEFF 184


>gi|332881853|ref|ZP_08449496.1| GTP cyclohydrolase I [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332680197|gb|EGJ53151.1| GTP cyclohydrolase I [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 195

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 120/178 (67%), Gaps = 6/178 (3%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEASKYQDMVL 84
           + +L  +G+D +REGL+ TP RV K+ + L  GY + P    ++++F       Y+ MV+
Sbjct: 19  KAVLALLGEDTEREGLQKTPYRVAKAMQTLTRGYAEDPKEILNSAKF----KEDYRHMVI 74

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R+++ +S RLQ+QER+T+QI  
Sbjct: 75  VKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDCFSHRLQVQERMTLQIRD 134

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTH 202
            I+ + D  GV V++E +HMCM MRG+++    T T+ FTG F++ K + + FL + H
Sbjct: 135 CIQEALDPLGVMVVVEARHMCMQMRGVEKQNSVTTTSDFTGAFNQAKTREE-FLNLIH 191


>gi|262278341|ref|ZP_06056126.1| GTP cyclohydrolase I [Acinetobacter calcoaceticus RUH2202]
 gi|262258692|gb|EEY77425.1| GTP cyclohydrolase I [Acinetobacter calcoaceticus RUH2202]
          Length = 184

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 5/172 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +R GLKDTP R  K++  L +GY K +    + + F     S   +MVL+K
Sbjct: 10  ILTAVGEDLNRPGLKDTPVRAAKAFSYLTSGYSKTLEEVTNNAVF----PSDNHEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 66  NIEFYSLCEHHLLPFYGRVHIAYLPEGKVLGLSKFARITEMFARRLQIQENLTQQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
              T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL
Sbjct: 126 AEVTGARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFIGDFKTDKESRREFL 177


>gi|226312046|ref|YP_002771940.1| GTP cyclohydrolase I [Brevibacillus brevis NBRC 100599]
 gi|254791034|sp|C0ZCC7|GCH1_BREBN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|226094994|dbj|BAH43436.1| GTP cyclohydrolase I [Brevibacillus brevis NBRC 100599]
          Length = 187

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 118/176 (67%), Gaps = 5/176 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +++ ++A+R+IL  +GDDPDREG+ DTP RV K Y E+F G        +   F    + 
Sbjct: 6   LDKIQQAVRMILEAVGDDPDREGVLDTPKRVAKMYAEVFEGMH----IDEEQYFETVFSE 61

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQE 136
            +++MVL+KDI F+S CEHH++P +GK H+AY+P+   V+GLSKL R ++  ++R Q+QE
Sbjct: 62  DHEEMVLVKDIPFYSMCEHHLVPFFGKAHVAYVPRGGRVVGLSKLARAVDTVAKRPQLQE 121

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           R+T  +A +I    D  GV V++E +HMCM+MRG+K+ G  T+T+A  G F +D  
Sbjct: 122 RITATVADSIMRKLDPHGVVVVVEAEHMCMTMRGVKKPGSKTITSAVRGMFEKDAA 177


>gi|289548056|ref|YP_003473044.1| GTP cyclohydrolase I [Thermocrinis albus DSM 14484]
 gi|289181673|gb|ADC88917.1| GTP cyclohydrolase I [Thermocrinis albus DSM 14484]
          Length = 185

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 120/183 (65%), Gaps = 9/183 (4%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH-FGEAS 77
           E+ K+A+R+ L  IG+DPDREGLK+TPDR+ + ++E           Q    F  F E  
Sbjct: 6   EKIKQAVRLFLEGIGEDPDREGLKETPDRIARMWEEF--------ERQREFNFKLFEEFG 57

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
           +Y +MV++KDI+ +S+CEHH+LP +GK H+AY+P + V GLSKLVR ++ ++ R Q+QER
Sbjct: 58  QYNEMVVVKDITIYSFCEHHLLPFFGKAHVAYVPDRVVCGLSKLVRTVKAFALRPQVQER 117

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QIA  +      KGVAV++E +H+CMSMRG+   G  T T+A  G F  D    + F
Sbjct: 118 LTAQIADFLMEQLKPKGVAVVLECEHLCMSMRGVMSPGHITTTSALRGIFLSDIRTREEF 177

Query: 198 LKM 200
           LK+
Sbjct: 178 LKL 180


>gi|150389929|ref|YP_001319978.1| GTP cyclohydrolase I [Alkaliphilus metalliredigens QYMF]
 gi|149949791|gb|ABR48319.1| GTP cyclohydrolase I [Alkaliphilus metalliredigens QYMF]
          Length = 188

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/173 (48%), Positives = 115/173 (66%), Gaps = 4/173 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ + A+R IL  IG+DPDREGL DTP R+ K Y E+F G    P  +D    +F E  K
Sbjct: 4   EKIQRAVRDILEAIGEDPDREGLIDTPKRIAKMYDEIFEGLVADP--KDHLDIYF-EDEK 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +++MVL+KDI F+S CEHH++P +GK H+ YIPK   + GLSKL R+++  ++R Q+QER
Sbjct: 61  HEEMVLVKDIPFYSVCEHHLVPFFGKAHVGYIPKGGKLTGLSKLARVVDTVAKRPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           LT  IA  I    D  GV V++E +HMCM+MRG+K+ G  TVT+   G F  D
Sbjct: 121 LTSMIAETIMDKLDPHGVIVVVEAEHMCMTMRGVKKSGSKTVTSVVRGIFKTD 173


>gi|315091127|gb|EFT63103.1| GTP cyclohydrolase I [Propionibacterium acnes HL110PA4]
          Length = 199

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 117/182 (64%), Gaps = 7/182 (3%)

Query: 6   TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT 65
           + V +MKL     E A  AIR  L  +G+DPDREGL+DTP RV ++ +ELF G  Q P  
Sbjct: 4   SAVSSMKLSVDR-ERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGE 62

Query: 66  QDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVR 123
              + F       + +MVL++DI   S CEHH+LP  G  H+ YIP +   V GLSK+ R
Sbjct: 63  LLATTFDI----SHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIAR 118

Query: 124 ILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAF 183
           ++EVY+RR Q+QERLT Q+A A+    D++GV V++E +HMCM+ RG+++ G  TVT+A 
Sbjct: 119 LVEVYARRPQVQERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAV 178

Query: 184 TG 185
            G
Sbjct: 179 RG 180


>gi|23466231|ref|NP_696834.1| GTP cyclohydrolase I [Bifidobacterium longum NCC2705]
 gi|239621580|ref|ZP_04664611.1| GTP cyclohydrolase I [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|41017201|sp|Q8G3S1|GCH1_BIFLO RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|23326976|gb|AAN25470.1| GTP cyclohydrolase I [Bifidobacterium longum NCC2705]
 gi|239515455|gb|EEQ55322.1| GTP cyclohydrolase I [Bifidobacterium longum subsp. infantis CCUG
           52486]
          Length = 199

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 114/168 (67%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  +EA+R+ L+ IG+DP+REGL +TPDR+ ++ +ELF G +  P   D    HF     
Sbjct: 18  EGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFTGLQASPA--DALEKHFD--VD 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQER 137
             ++VL+KDI  +S CEHH+LP  G  H+ YIP K  V+GLSKL R++EVY+RR Q+QER
Sbjct: 74  TDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYARRPQVQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT QIA A+     ++GV V+ E +H+CMSMRGIK+    TVT+A  G
Sbjct: 134 LTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRG 181


>gi|307566418|ref|ZP_07628855.1| GTP cyclohydrolase I [Prevotella amnii CRIS 21A-A]
 gi|307344890|gb|EFN90290.1| GTP cyclohydrolase I [Prevotella amnii CRIS 21A-A]
          Length = 195

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 113/169 (66%), Gaps = 3/169 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+DP REGL+ TP RV K+ + L  GY Q P    T    F E  KY  MV++KD
Sbjct: 21  ILSLLGEDPSREGLEKTPMRVAKAMQVLTRGYTQDPHKVLTDAL-FEE--KYNQMVIVKD 77

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I FFS CEHH+LP +GK H+AYIP   + GLSK+ R+++++S RLQ+QERLT QI   I+
Sbjct: 78  IDFFSMCEHHMLPFYGKAHVAYIPNGKITGLSKVARVIDIFSHRLQVQERLTEQIKDCIQ 137

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
            +    GV V++E +HMCM MRG+++    T T++F+G F++ K + +F
Sbjct: 138 DTLCPLGVMVVLEAKHMCMQMRGVEKQNAITTTSSFSGAFNQAKTREEF 186


>gi|325282317|ref|YP_004254858.1| GTP cyclohydrolase 1 [Deinococcus proteolyticus MRP]
 gi|324314126|gb|ADY25241.1| GTP cyclohydrolase 1 [Deinococcus proteolyticus MRP]
          Length = 208

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 113/165 (68%), Gaps = 9/165 (5%)

Query: 29  LRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE---ASKYQDMVLI 85
           L  IG+DP REGL+ TP RV K++  +  GY Q  T  D      GE   A++  +MV++
Sbjct: 32  LSAIGEDPQREGLQRTPHRVAKAWAYMTEGYGQ--TLADV----VGEGVFAAEGSEMVIV 85

Query: 86  KDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHA 145
           KDI F+S CEHH+LP +G+ H+AYIP   ++GLSK  RI+++YSRRLQ+QER+T Q+A A
Sbjct: 86  KDIEFYSMCEHHMLPFYGRAHVAYIPDGKILGLSKFARIVDLYSRRLQVQERITTQVAEA 145

Query: 146 IESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +E     KGVAVL+EG H+CM+MRG+++   +T T+A  G F  D
Sbjct: 146 VEELLQPKGVAVLMEGVHLCMAMRGVQKQNSSTTTSAMRGLFRTD 190


>gi|260062984|ref|YP_003196064.1| GTP cyclohydrolase I [Robiginitalea biformata HTCC2501]
 gi|88784552|gb|EAR15722.1| GTP cyclohydrolase I [Robiginitalea biformata HTCC2501]
          Length = 198

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 113/170 (66%), Gaps = 3/170 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           ILR IG+DP REGL  TP+R  K+   L  GY+Q    +      F E+  Y +MVLIKD
Sbjct: 24  ILREIGEDPAREGLLKTPERAAKAMLFLTQGYRQ-DAVEILKGAMFRES--YSEMVLIKD 80

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP +GK H+AYIP  H++GLSK+ R+++V++RRLQ+QERLT  I   I 
Sbjct: 81  IEVYSLCEHHMLPFYGKAHVAYIPDGHIVGLSKIPRVVDVFARRLQVQERLTDDILECIN 140

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           ++   +GVAV+IE  HMCM MRG+++    T T+ F G+F + + + +F 
Sbjct: 141 TTLKPRGVAVVIEAAHMCMMMRGVQKQNSVTTTSGFRGQFEKSETRNEFL 190


>gi|269957761|ref|YP_003327550.1| GTP cyclohydrolase I [Xylanimonas cellulosilytica DSM 15894]
 gi|269306442|gb|ACZ31992.1| GTP cyclohydrolase I [Xylanimonas cellulosilytica DSM 15894]
          Length = 202

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 123/185 (66%), Gaps = 8/185 (4%)

Query: 7   GVFNMKLKKPTVE--EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPT 64
           GV     + P V+   A+ A+R +L  +G++PDREGL++TP RV ++Y+E+FAG +Q P 
Sbjct: 6   GVTRPATEVPPVDLARAEAAVRELLLAVGENPDREGLRETPARVARAYQEVFAGLRQEPE 65

Query: 65  TQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLV 122
              T+ F  G    +++MVL+KDI  +S CEHH++P  G  H+ YIP     + GLSK+ 
Sbjct: 66  DVLTTTFDIG----HEEMVLVKDIEVYSTCEHHLVPFHGVAHVGYIPSTDGVITGLSKIA 121

Query: 123 RILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTA 182
           R+++VY+RR Q+QERLT Q+A A+      +GV V+IE +H+CMSMRG+ + G  TVT+A
Sbjct: 122 RLVDVYARRPQVQERLTSQVADALVKILRPRGVIVVIECEHLCMSMRGVHKPGSRTVTSA 181

Query: 183 FTGEF 187
             G+ 
Sbjct: 182 VRGQM 186


>gi|154149253|ref|YP_001405663.1| GTP cyclohydrolase I [Campylobacter hominis ATCC BAA-381]
 gi|153805262|gb|ABS52269.1| GTP cyclohydrolase I [Campylobacter hominis ATCC BAA-381]
          Length = 194

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 125/180 (69%), Gaps = 6/180 (3%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEASK 78
           E ++ ++ ILR IG++P+R+GL  TP+RV KS + L +GY+  P    + + F    +S 
Sbjct: 8   EIEKHMQEILRLIGENPERDGLVKTPERVAKSLEFLTSGYRMEPKNVLNDALF----SST 63

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             +MVL+K+I F+S CEHH+LPI G++H+AYIP K V+GLSK+ R++ +++RRLQIQE++
Sbjct: 64  NNEMVLMKNIEFYSLCEHHLLPIIGRVHVAYIPNKKVVGLSKIPRMVNIFARRLQIQEQM 123

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTDFF 197
           T QIA+AI+      GV V++E +HMC+ MRG+++    T T+A  G F +R   + +FF
Sbjct: 124 TEQIANAIQEVVHPLGVGVVVEARHMCVEMRGVEKINSITTTSALRGSFITRADTRKEFF 183


>gi|323453834|gb|EGB09705.1| hypothetical protein AURANDRAFT_24239 [Aureococcus anophagefferens]
          Length = 265

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 116/183 (63%), Gaps = 6/183 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDM 82
           A+  IL  +G+D  REGL+DTP R+ K   +  +GY K++    + + F    A  Y  M
Sbjct: 85  AVSTILDALGEDTGREGLQDTPRRMAKLLVDCTSGYAKRLEDVLNGAVF----AEDYSQM 140

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           VL+KDI  +S CEHH++P +GK H+AYIP   V+GLSKL RI  ++++RLQ+QERLT QI
Sbjct: 141 VLVKDIQLYSLCEHHVVPFFGKCHIAYIPNGKVLGLSKLARIAHMFAKRLQVQERLTTQI 200

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFFLKMT 201
           A A+  +    GV V++E  HMCM MRG++  G +TVT+A  G F  D + + +FF  + 
Sbjct: 201 AEAVAEACGPCGVGVVVEATHMCMCMRGVQATGSSTVTSALLGSFKSDPRTRAEFFASVG 260

Query: 202 HNQ 204
             Q
Sbjct: 261 RPQ 263


>gi|254385664|ref|ZP_05000987.1| GTP cyclohydrolase I [Streptomyces sp. Mg1]
 gi|194344532|gb|EDX25498.1| GTP cyclohydrolase I [Streptomyces sp. Mg1]
          Length = 202

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 115/169 (68%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL +TP RV ++Y+E+ AG +Q P    T+ F  G    + 
Sbjct: 22  AEAAVRELLIAVGEDPDREGLLETPARVARAYREILAGLRQQPEDVLTTTFDLG----HD 77

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI   S CEHH+LP  G  H+ YIP +   + GLSKL R++EV++RR Q+QERL
Sbjct: 78  EMVLVKDIEIVSLCEHHLLPFHGVAHVGYIPAESGKITGLSKLARLVEVFARRPQVQERL 137

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    +++G  V+IE +HMCMS+RGI++ G  T T+A  G+ 
Sbjct: 138 TTQIADSLMRILEARGAIVVIEAEHMCMSVRGIRKPGAKTTTSAVRGQL 186


>gi|289208960|ref|YP_003461026.1| GTP cyclohydrolase I [Thioalkalivibrio sp. K90mix]
 gi|288944591|gb|ADC72290.1| GTP cyclohydrolase I [Thioalkalivibrio sp. K90mix]
          Length = 198

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 82/191 (42%), Positives = 120/191 (62%), Gaps = 5/191 (2%)

Query: 16  PTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFG 74
           P  E      R IL  + +DP+REGL DTP R  K+ + L  GY Q + T  + + F   
Sbjct: 11  PAPEALARHYREILAGLNEDPNREGLLDTPMRAAKAMQYLTRGYHQDLDTIVNGALF--- 67

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
            +S   +MVL++DI  +S CEHH+LPI GK+H+AY+P   VIGLSK+ RI+++++ RLQI
Sbjct: 68  -SSDNDEMVLLRDIELYSLCEHHLLPIIGKVHVAYLPNGKVIGLSKIARIVDMFAARLQI 126

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QE +T QIA A+   TD+KGV V+++ +HMCM+MRG+++   +  T+   G F +D    
Sbjct: 127 QENMTRQIAEALMQVTDAKGVGVVVDAKHMCMTMRGVEKQHSSMATSVMLGAFRKDARTR 186

Query: 195 DFFLKMTHNQR 205
             FL + H  R
Sbjct: 187 REFLNLIHGSR 197


>gi|169616165|ref|XP_001801498.1| hypothetical protein SNOG_11256 [Phaeosphaeria nodorum SN15]
 gi|160703127|gb|EAT81755.2| hypothetical protein SNOG_11256 [Phaeosphaeria nodorum SN15]
          Length = 325

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 116/178 (65%), Gaps = 5/178 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDM 82
           A+R +L  +G+DPDREGL+DTPDR  K+      GY++ +    + + FH      + ++
Sbjct: 148 AVRTMLECLGEDPDREGLRDTPDRYAKALLFFTKGYEENLRDIVNGAVFH----EDHDEL 203

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           V++KDI  FS CEHH++P  GK+H+ YIP + VIGLSKL RI E++SRRLQ+QERLT Q+
Sbjct: 204 VIVKDIEIFSLCEHHLVPFTGKMHIGYIPNRRVIGLSKLARIAEMFSRRLQVQERLTKQV 263

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           A A+      +GVAV++E  H+CM MRG+++ G TT T+   G         + FL++
Sbjct: 264 ALALSEMLQPQGVAVVVESSHLCMVMRGVQKTGATTTTSCMLGRMRSTAKTREEFLRL 321


>gi|261856698|ref|YP_003263981.1| GTP cyclohydrolase I [Halothiobacillus neapolitanus c2]
 gi|261837167|gb|ACX96934.1| GTP cyclohydrolase I [Halothiobacillus neapolitanus c2]
          Length = 203

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 117/179 (65%), Gaps = 3/179 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           + A+  IL  +G+DP+REGL+DTP RV K+   L  G  + P         F  AS   +
Sbjct: 24  EAAVHQILDALGEDPNREGLQDTPKRVAKALLYLTHGLNK-PLESAIGNALF--ASDNDE 80

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV++++I F+S CEHH+LPI G + + YIP+  VIGLSKL RI+++Y+RRLQIQE +T Q
Sbjct: 81  MVVVRNIEFYSLCEHHMLPIIGHVDIGYIPQGKVIGLSKLARIVDLYARRLQIQENMTQQ 140

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           IA A+  STD++GVAV +   HMCM+MRG+++    T+T+   G F  D    + FL++
Sbjct: 141 IADAVRESTDARGVAVQVRAAHMCMAMRGVEKVNAETITSMMLGTFRSDARARNEFLQL 199


>gi|152975034|ref|YP_001374551.1| GTP cyclohydrolase I [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|189045182|sp|A7GN48|GCH1_BACCN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|152023786|gb|ABS21556.1| GTP cyclohydrolase I [Bacillus cytotoxicus NVH 391-98]
          Length = 189

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 119/183 (65%), Gaps = 9/183 (4%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + K  +E+ + A+R+IL  IGDDP+REG+ DTP RV K Y E+F+G  + P        H
Sbjct: 1   MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPRRVAKMYAEVFSGMHEDPKEH----LH 56

Query: 73  --FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYS 129
             FGE   ++++VL+KDI F+S CEHH++P +G  H+AYIP+   V GLSKL R ++  +
Sbjct: 57  KVFGE--DHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPRGGKVTGLSKLARTVDTIA 114

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           RR Q+QER+T  +A +I    +  GV V++E +HMCM+MRG+K+ G  TVTTA  G    
Sbjct: 115 RRPQLQERITSTVADSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLEN 174

Query: 190 DKG 192
           D  
Sbjct: 175 DAA 177


>gi|301107826|ref|XP_002902995.1| GTP cyclohydrolase I [Phytophthora infestans T30-4]
 gi|262098113|gb|EEY56165.1| GTP cyclohydrolase I [Phytophthora infestans T30-4]
          Length = 246

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 83/189 (43%), Positives = 118/189 (62%), Gaps = 5/189 (2%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHF 73
           K  +E+   A+  +L  IG+DP REGL  TP R+ K+      GY Q +    + + F  
Sbjct: 60  KEKLEKMAAAVTTLLECIGEDPQREGLVKTPMRMAKALLYNTKGYGQSLSDVLNEAVFE- 118

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
                + +MV+++DI  +S CEHH++P  GK+H+ YIP   V+GLSKL R+ EV+SRRLQ
Sbjct: 119 ---EDHDEMVIVRDIDLYSMCEHHMVPFTGKVHIGYIPNGKVLGLSKLARVSEVFSRRLQ 175

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           +QERLT QIA+AI    + KGVAV+IE  HMCM MRG+++ G +TVT++  G F  D   
Sbjct: 176 VQERLTKQIANAIMGVIEPKGVAVVIEATHMCMVMRGVEKSGASTVTSSVLGVFKSDPRT 235

Query: 194 TDFFLKMTH 202
              F+ + H
Sbjct: 236 RSEFMSLIH 244


>gi|295397467|ref|ZP_06807550.1| GTP cyclohydrolase I [Aerococcus viridans ATCC 11563]
 gi|294974267|gb|EFG50011.1| GTP cyclohydrolase I [Aerococcus viridans ATCC 11563]
          Length = 184

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 121/184 (65%), Gaps = 6/184 (3%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +E  ++A+R IL  +G++PDREGL +TP+RV K Y E+F G  + P       F    + 
Sbjct: 3   MERIEKAVREILLAVGENPDREGLIETPERVAKMYAEVFDGLNRNPRIHTEKTF----SE 58

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQE 136
              + VL+KDISF S CEHH+LP+ G+ H+AYIPK   VIGLSKL RI+E ++ R Q+QE
Sbjct: 59  SASEFVLVKDISFHSTCEHHLLPVIGQAHVAYIPKNGQVIGLSKLARIVEDFALRPQLQE 118

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT Q+A  +     ++GV V++E +HMCM++RGIK+ G  TVT A  G ++ D+G+   
Sbjct: 119 RLTNQVADVLAKELGAEGVFVVLEAEHMCMTLRGIKKPGAKTVTYATRGAYT-DRGRRQE 177

Query: 197 FLKM 200
            L M
Sbjct: 178 VLDM 181


>gi|312962975|ref|ZP_07777461.1| GTP cyclohydrolase I [Pseudomonas fluorescens WH6]
 gi|311282744|gb|EFQ61339.1| GTP cyclohydrolase I [Pseudomonas fluorescens WH6]
          Length = 186

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/176 (47%), Positives = 116/176 (65%), Gaps = 5/176 (2%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVL 84
           R IL+ +G+DP+REGL DTP R  K+ + L  GY+Q + T  + + F    AS   +MV+
Sbjct: 10  REILKGLGEDPEREGLLDTPKRAAKAMQYLCHGYEQNLETIVNGALF----ASDNDEMVI 65

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +KDI  +S CEHH+LP  GK H+AYIP   V+GLSKL RI+++++RRLQIQE LT QIA 
Sbjct: 66  LKDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKLARIVDMFARRLQIQENLTRQIAD 125

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           AI+  T + GVAV+IE +HMCM MRG+++   T  T+   G F         FL++
Sbjct: 126 AIQDVTQAAGVAVVIEARHMCMMMRGVEKQNSTMNTSVMLGAFRESNTTRMEFLQL 181


>gi|14009659|gb|AAK51701.1|AF318067_1 GTP cyclohydrolase I [Physarum polycephalum]
          Length = 216

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 115/169 (68%), Gaps = 5/169 (2%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQD 81
           ++ R IL  IG+DPDREGL+ TP R+ K+      GY+Q +    + + F+      + +
Sbjct: 47  DSTRNILVNIGEDPDREGLQQTPMRMAKAMMFFTQGYEQSLSDVLNGAIFN----EDHNE 102

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+++DI  FS CEHH++P +GK H+ YIP   V+GLSKL RI E+++RRLQ+QERLT Q
Sbjct: 103 MVVVRDIDIFSLCEHHLVPFFGKCHIGYIPNGKVLGLSKLARIAEIFARRLQVQERLTRQ 162

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           IA A+E +    GVAV+IE  HMCM MRG+++ G +TVT++  G F +D
Sbjct: 163 IALALEEAIQPLGVAVVIEASHMCMVMRGVQKSGASTVTSSVLGVFQQD 211


>gi|149376887|ref|ZP_01894642.1| GTP cyclohydrolase I [Marinobacter algicola DG893]
 gi|149358779|gb|EDM47248.1| GTP cyclohydrolase I [Marinobacter algicola DG893]
          Length = 188

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 80/178 (44%), Positives = 118/178 (66%), Gaps = 5/178 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           I+  +G++PDREGL+DTP R  K+ + L  GY+Q + T  + + F     S   +MV+++
Sbjct: 15  IIAGLGENPDREGLQDTPIRAAKAMQFLTQGYRQSLDTLVNNAVFE----SAMDEMVVVQ 70

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  GK H+AY+P   V+GLSK  RI+++Y+RRLQIQE LT +IA AI
Sbjct: 71  DIELYSMCEHHMLPFIGKCHIAYLPSGKVLGLSKFARIVDMYARRLQIQENLTREIAEAI 130

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQ 204
           E+ T +KGVAV+IE QHMCM MRG+++      T+   G+F + +     FL +  ++
Sbjct: 131 ETVTGAKGVAVVIEAQHMCMMMRGVEKQNSRMKTSMMLGQFRKSQATRTEFLTLIRDR 188


>gi|227505942|ref|ZP_03935991.1| GTP cyclohydrolase I [Corynebacterium striatum ATCC 6940]
 gi|227197464|gb|EEI77512.1| GTP cyclohydrolase I [Corynebacterium striatum ATCC 6940]
          Length = 196

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 118/175 (67%), Gaps = 6/175 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL++TP RV ++YKE+FAG    PT       H   A ++Q
Sbjct: 16  AEAAVRELLIAVGEDPDREGLQETPARVARAYKEVFAGLHADPT----EVLHKTFAEEHQ 71

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           ++VL++DI  +S CEHH++P +G  H+ YIP     V GLSKL R+ ++Y++R Q+QERL
Sbjct: 72  ELVLVRDIPIYSTCEHHLVPFYGVAHIGYIPGPDGQVTGLSKLARLADMYAKRPQVQERL 131

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           T QIA+A+     ++ V V+IE +H+CM+MRGI++ G TT T+A  G F  +   
Sbjct: 132 TSQIANALVDVLHAQSVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGFKSNAAS 186


>gi|298372525|ref|ZP_06982515.1| GTP cyclohydrolase I [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275429|gb|EFI16980.1| GTP cyclohydrolase I [Bacteroidetes oral taxon 274 str. F0058]
          Length = 196

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 83/190 (43%), Positives = 123/190 (64%), Gaps = 6/190 (3%)

Query: 8   VFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPT-TQ 66
           VFN  L +   ++  +    ++  +G+D  REGL+ TP RV K+ + L +GY+Q P    
Sbjct: 6   VFN-DLNEEVTQKLSKYYSDVITALGEDVGREGLQKTPRRVAKAMQFLTSGYRQDPAEVL 64

Query: 67  DTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILE 126
            ++RFH      Y+ MV++KDI FFS CEHH+LP +GK H+AYIP   V GLSK+ R+++
Sbjct: 65  LSARFH----EDYRQMVIVKDIEFFSMCEHHLLPFFGKAHVAYIPNGTVTGLSKIARVVD 120

Query: 127 VYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGE 186
           +++ RLQ+QERLT QI   I+ + +  GV V+IE QH+CM MRG+++   TT T+ FTG 
Sbjct: 121 IFAHRLQLQERLTSQIKDCIQETLNPMGVMVVIEAQHLCMQMRGVQKQHSTTTTSDFTGI 180

Query: 187 FSRDKGKTDF 196
           F   K + +F
Sbjct: 181 FKVQKTREEF 190


>gi|145222009|ref|YP_001132687.1| GTP cyclohydrolase I [Mycobacterium gilvum PYR-GCK]
 gi|189045191|sp|A4T5P2|GCH1_MYCGI RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|145214495|gb|ABP43899.1| GTP cyclohydrolase I [Mycobacterium gilvum PYR-GCK]
          Length = 202

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 84/192 (43%), Positives = 122/192 (63%), Gaps = 8/192 (4%)

Query: 5   RTGVFNMKLKKPTVEEAKE--AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQI 62
           R+   +  L  P  ++A+   A+R +L  +G+DPDREGL DTP RV +SY+E+FAG    
Sbjct: 3   RSHNHSATLTTPDFDQARAEAAVRELLIAVGEDPDREGLLDTPARVARSYREIFAGLYTD 62

Query: 63  PTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSK 120
           P    T+ F      ++ +MVL+KDI  +S CEHH++   G  H+ YIP     V GLSK
Sbjct: 63  PDEVLTTMFD----EQHDEMVLVKDIPMYSTCEHHLVSFHGVAHVGYIPGVDGRVTGLSK 118

Query: 121 LVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVT 180
           L R++++Y++R Q+QERLT QIA A+    D +G  V+IE +H+CM+MRGI++ G  T T
Sbjct: 119 LARVVDLYAKRPQVQERLTSQIADALMRKLDPRGAIVVIEAEHLCMAMRGIRKPGAVTTT 178

Query: 181 TAFTGEFSRDKG 192
           +A  G+F  DK 
Sbjct: 179 SAVRGQFKTDKA 190


>gi|226952593|ref|ZP_03823057.1| GTP cyclohydrolase I [Acinetobacter sp. ATCC 27244]
 gi|294649890|ref|ZP_06727289.1| GTP cyclohydrolase I [Acinetobacter haemolyticus ATCC 19194]
 gi|226836673|gb|EEH69056.1| GTP cyclohydrolase I [Acinetobacter sp. ATCC 27244]
 gi|292824222|gb|EFF83026.1| GTP cyclohydrolase I [Acinetobacter haemolyticus ATCC 19194]
          Length = 184

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 114/173 (65%), Gaps = 5/173 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D  R GL+DTP R  K++  L +GY K +    +++ F     S   +MVL+K
Sbjct: 10  ILTAVGEDLTRPGLQDTPMRAAKAFSFLTSGYSKTLAEVTNSAVF----PSDNHEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+  V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 66  NIEFYSLCEHHLLPFYGRVHIAYLPEGQVLGLSKFARITEMFARRLQIQENLTQQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
              T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  DK     FL 
Sbjct: 126 AEVTQARGVAVVIDSAHMCMMMRGVGKQESTTRTVSFVGDFKTDKDARREFLS 178


>gi|325287903|ref|YP_004263693.1| GTP cyclohydrolase 1 [Cellulophaga lytica DSM 7489]
 gi|324323357|gb|ADY30822.1| GTP cyclohydrolase 1 [Cellulophaga lytica DSM 7489]
          Length = 199

 Score =  167 bits (424), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 114/179 (63%), Gaps = 3/179 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  KE    I+  +G+D  REGL  TP+R  K+   L  GY+Q P  +      F E   
Sbjct: 16  ESVKEKYAKIIEGVGEDVSREGLVKTPERAAKAMMFLTQGYEQDPV-EILKAAMFKE--D 72

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y DMV+IKDI  +S CEHH+LP +GK H+AYIP  H++GLSK+ RI++V++RRLQ+QERL
Sbjct: 73  YDDMVIIKDIELYSLCEHHMLPFFGKAHVAYIPNGHIVGLSKIPRIVDVFARRLQVQERL 132

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           T  I   + ++   +GVAV+IE  HMCM MRG+++    T T+ F G+F + + + +F 
Sbjct: 133 THDILECLNNTLKPQGVAVVIEASHMCMMMRGVQKQNSVTTTSGFRGQFEKQETRNEFL 191


>gi|126664511|ref|ZP_01735495.1| GTP cyclohydrolase I [Marinobacter sp. ELB17]
 gi|126630837|gb|EBA01451.1| GTP cyclohydrolase I [Marinobacter sp. ELB17]
          Length = 190

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 121/181 (66%), Gaps = 6/181 (3%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVL 84
           R I+  +G++ DREGL+ TP R  K+ + L  GY+Q +    + + F     S   +MV+
Sbjct: 14  RAIINGLGENCDREGLQSTPLRAAKAMQFLTRGYQQDLNKLVNNAVFE----SAMDEMVV 69

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           I+DI  +S CEHH+LP  GK H+AY+P+  V+GLSK  RI+++Y+RRLQIQE LT QIA 
Sbjct: 70  IQDIELYSMCEHHVLPFIGKCHIAYLPQGKVLGLSKFARIVDMYARRLQIQENLTRQIAE 129

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFFLKMTHN 203
           A+ES T++KGVAV+IE QHMCM MRG+++      T+   G+F + +  + +FF  ++ N
Sbjct: 130 AVESVTNAKGVAVVIEAQHMCMMMRGVEKQNSKMKTSMMLGQFRKSQATRLEFFNLISTN 189

Query: 204 Q 204
           +
Sbjct: 190 R 190


>gi|124027744|ref|YP_001013064.1| GTP cyclohydrolase I [Hyperthermus butylicus DSM 5456]
 gi|229487971|sp|A2BL58|GCH1_HYPBU RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|123978438|gb|ABM80719.1| GTP cyclohydrolase I [Hyperthermus butylicus DSM 5456]
          Length = 193

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 121/182 (66%), Gaps = 12/182 (6%)

Query: 11  MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR 70
           M + K  +E+A   +R+IL  IG+DP+REGL++TP RV   ++EL  GY     T++ + 
Sbjct: 1   MPIDKAKIEKA---VRMILEAIGEDPEREGLRETPRRVADMFEELLEGYD---FTEEYTW 54

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
           F     ++  D+V++  I F+S CEHH+LP +G  H+AY+P+  VIGLSK+VRI+  YSR
Sbjct: 55  F-----TEATDLVVVSGIRFYSLCEHHLLPFFGVAHVAYLPRGKVIGLSKIVRIVNKYSR 109

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQIQER+T QIA  I  +T S  V V+ E  H+CM+MRG+ R+G  TV  A  GEF RD
Sbjct: 110 RLQIQERMTKQIADEISKATGSPDVMVITEAVHLCMAMRGV-RNGAPTVVAAVRGEFERD 168

Query: 191 KG 192
           + 
Sbjct: 169 QS 170


>gi|225872554|ref|YP_002754009.1| GTP cyclohydrolase I [Acidobacterium capsulatum ATCC 51196]
 gi|225792988|gb|ACO33078.1| GTP cyclohydrolase I [Acidobacterium capsulatum ATCC 51196]
          Length = 215

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 115/171 (67%), Gaps = 5/171 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPT-TQDTSRFHFGEASKYQDMVLIK 86
           +LR   +DP R+GL  TP+RV K+ K L  GY Q P      + F       Y +MVL+K
Sbjct: 38  LLRRYDEDPTRDGLLRTPERVEKAMKYLTQGYHQEPAGILQGALFDV----DYDEMVLVK 93

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  FS CEHH+LP +G++H+AYIP   V+GLSK+ R++EV++RRLQ+QER+T QIA AI
Sbjct: 94  DIEMFSLCEHHMLPFFGRVHVAYIPNGKVVGLSKIPRLVEVFARRLQVQERMTRQIAEAI 153

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           + + + +GV V+IE +H+CM MRG+++   +TVT+A  G F +   + +F 
Sbjct: 154 QDAINPQGVGVVIEARHLCMMMRGVEKQNSSTVTSAMLGVFQQQNTRGEFL 204


>gi|297192937|ref|ZP_06910335.1| GTP cyclohydrolase I [Streptomyces pristinaespiralis ATCC 25486]
 gi|197722658|gb|EDY66566.1| GTP cyclohydrolase I [Streptomyces pristinaespiralis ATCC 25486]
          Length = 201

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 117/169 (69%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL++TP RV ++Y+E+FAG  Q P    T+ F  G    + 
Sbjct: 21  AENAVRELLIAVGEDPDREGLRETPARVARAYREIFAGLWQQPEDVLTTTFDIG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  +S CEHH++P  G  H+ YIP     + GLSKL R+++V++RR Q+QER+
Sbjct: 77  EMVLVKDIEVYSTCEHHLVPFRGVAHVGYIPSTTGKITGLSKLARLVDVFARRPQVQERM 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    + +GV V++E +HMCMSMRGI++ G  T+T+A  G+ 
Sbjct: 137 TTQIADSLMEILEPRGVIVVVECEHMCMSMRGIRKPGAKTITSAVRGQL 185


>gi|229819200|ref|YP_002880726.1| GTP cyclohydrolase I [Beutenbergia cavernae DSM 12333]
 gi|229565113|gb|ACQ78964.1| GTP cyclohydrolase I [Beutenbergia cavernae DSM 12333]
          Length = 200

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 115/168 (68%), Gaps = 6/168 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           + A+R +L  IG+DPDR+GL++TP+R+ +SY+E+FAG    P     + F      ++ +
Sbjct: 20  ERAVRDLLIAIGEDPDRDGLRETPERLARSYEEMFAGLHTDPREAVQTFFDL----EHNE 75

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERLT 139
           +V++ DI+ +S CEHH+LP  G  H+ YIP    HV GLSKL R++E Y+RR Q+QERLT
Sbjct: 76  LVIVSDIAVYSVCEHHLLPFHGVAHVGYIPAPSGHVTGLSKLARLVEAYARRPQVQERLT 135

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QIA A+  + + +GV V++E +HMCMSMRG+++ G  TVT+A  G  
Sbjct: 136 TQIADALVHALEPRGVVVVLECEHMCMSMRGVRKPGARTVTSAVRGAL 183


>gi|229818437|ref|ZP_04448718.1| hypothetical protein BIFANG_03744 [Bifidobacterium angulatum DSM
           20098]
 gi|229784307|gb|EEP20421.1| hypothetical protein BIFANG_03744 [Bifidobacterium angulatum DSM
           20098]
          Length = 199

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 119/174 (68%), Gaps = 6/174 (3%)

Query: 14  KKPTVEEA-KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           ++P  EE  ++A+R+ L+ IG+DP+REGL +TPDR+ ++ +ELF+G    P   D    H
Sbjct: 12  RRPYDEEGVRQAVRLFLQSIGEDPEREGLLETPDRIARACRELFSGLDTSPA--DVLEKH 69

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRR 131
           F       ++VL+KDI  +S CEHH+LP  G  H+ YIP K+ V+GLSKL R++EVY+RR
Sbjct: 70  FD--VDTDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKNGVMGLSKLARLVEVYARR 127

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
            Q+QERLT QIA A+     ++GV V+ E +H+CMSMRGIK+    TVT+A  G
Sbjct: 128 PQVQERLTQQIADALVDYAGARGVIVVTECEHLCMSMRGIKKSEARTVTSAVRG 181


>gi|119960970|ref|YP_945967.1| GTP cyclohydrolase I [Arthrobacter aurescens TC1]
 gi|119947829|gb|ABM06740.1| GTP cyclohydrolase I [Arthrobacter aurescens TC1]
          Length = 211

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 82/180 (45%), Positives = 119/180 (66%), Gaps = 9/180 (5%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           + K+ +P +E A   +R IL  IG+DP+R GL DTP RV K+Y E+FAG  Q P    ++
Sbjct: 23  DHKVDRPRIEAA---VREILLAIGEDPERGGLLDTPKRVAKAYAEMFAGLHQHPVDVLST 79

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEV 127
            F       ++++VL+KDI F+S CEHH++P  G  H+ YIP     V GLSKL R++++
Sbjct: 80  TFDL----DHEELVLVKDIPFYSTCEHHLVPFHGVAHVGYIPSHDGKVTGLSKLARLVDI 135

Query: 128 YSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           Y+RR Q+QERLT QI  A+ +  + +G  V++E +HMCMSMRGI++ G  TVT+A  G+ 
Sbjct: 136 YARRPQVQERLTTQIVEALVTHLNPRGAIVVVECEHMCMSMRGIRKPGAKTVTSAVRGQL 195


>gi|281204123|gb|EFA78319.1| GTP cyclohydrolase I [Polysphondylium pallidum PN500]
          Length = 234

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 122/181 (67%), Gaps = 4/181 (2%)

Query: 25  IRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVL 84
           ++ +L  IG+DP+REGL+ TP R+ K+      GY ++   +      F E   + +MV+
Sbjct: 57  VKSLLESIGEDPEREGLQKTPLRMAKALMYFTHGY-ELSVDEIIGGAIFNE--NHHEMVV 113

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           ++DI  FS CEHH++P +GK H+ YIP + V+GLSKL RI E+++RRLQ+QERLT QIA 
Sbjct: 114 VRDIDIFSLCEHHMVPFYGKCHIGYIPDRKVLGLSKLARIAEIFARRLQVQERLTRQIAL 173

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFFLKMTHN 203
           AI  + +  GVAV+IE  HMCM MRG+++ G +TVT++  G F +D + +++FF  +  N
Sbjct: 174 AINEALNPMGVAVVIEASHMCMVMRGVQKPGSSTVTSSVCGVFEQDSRTRSEFFSLIRSN 233

Query: 204 Q 204
           +
Sbjct: 234 K 234


>gi|281422473|ref|ZP_06253472.1| GTP cyclohydrolase I [Prevotella copri DSM 18205]
 gi|281403456|gb|EFB34136.1| GTP cyclohydrolase I [Prevotella copri DSM 18205]
          Length = 197

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 119/183 (65%), Gaps = 9/183 (4%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA- 76
           ++E  E    +L+ +G+DP+REGL  TP RV K+ + L  GY     TQD  +    +A 
Sbjct: 11  LDELAEHYTEVLKLLGEDPEREGLVKTPMRVAKAMQILTRGY-----TQDAHKV-LTDAL 64

Query: 77  --SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              KY  MV++KDI FFS CEHH+LP +GK+H+AYIP   + GLSK+ R++++YS RLQ+
Sbjct: 65  FEEKYNQMVIVKDIDFFSMCEHHMLPFYGKVHVAYIPNGKITGLSKIARVVDIYSHRLQV 124

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QERLT QI   I+ + + +GV V+IE +HMCM MRG+++    T T+ ++G F+    + 
Sbjct: 125 QERLTQQIKDCIQETLNPQGVMVVIEAKHMCMQMRGVEKQNSITTTSDYSGVFNSLNTRQ 184

Query: 195 DFF 197
           +F 
Sbjct: 185 EFM 187


>gi|293605158|ref|ZP_06687547.1| GTP cyclohydrolase I [Achromobacter piechaudii ATCC 43553]
 gi|292816414|gb|EFF75506.1| GTP cyclohydrolase I [Achromobacter piechaudii ATCC 43553]
          Length = 181

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 113/174 (64%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+DP REGL DTP R  K+ + L  GY Q +    + + F     S  +++VL+K
Sbjct: 10  ILEALGEDPSREGLADTPARAAKAMRHLCRGYAQNLDEIVNGALF----TSDTREIVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I  +S CEHH+LP  GK H+AY+P   V+GLSK+ RI+E+Y+RRLQIQE L+ Q+A A+
Sbjct: 66  NIELYSLCEHHMLPFIGKAHVAYLPAGKVLGLSKVARIVEMYARRLQIQENLSRQVAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +  T + GVAV+IE QHMCM MRG+++   + VT+   GEF  +      FL +
Sbjct: 126 QKVTGAAGVAVVIEAQHMCMMMRGVEKQNSSMVTSVMLGEFHDNPSTRAEFLSL 179


>gi|255323213|ref|ZP_05364348.1| GTP cyclohydrolase I [Campylobacter showae RM3277]
 gi|255299736|gb|EET79018.1| GTP cyclohydrolase I [Campylobacter showae RM3277]
          Length = 200

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 125/190 (65%), Gaps = 6/190 (3%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDT 68
           N+K +    E+ +  +  +L  +G+DP REGL  TP+RV K+Y+ L +GY Q P    + 
Sbjct: 4   NLKNEILKKEKFESCVEQMLNLVGEDPHREGLAKTPERVFKAYEFLTSGYWQDPKVVLND 63

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
           + F     S   +MVL++DI F+S CEHH+LP +G++H+AYIP   V+GLSK+ R++ ++
Sbjct: 64  ALFD----SSNNEMVLVRDIEFYSLCEHHLLPFFGRVHVAYIPNHKVVGLSKIPRMVNIF 119

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           +RRLQIQE+LT QIA A++     KGV V+IE +HMC+ MRG+ +   TT T+A  G F 
Sbjct: 120 ARRLQIQEQLTEQIAEAVQEVIKPKGVGVVIEARHMCVEMRGVGKINSTTTTSALRGCFL 179

Query: 189 R-DKGKTDFF 197
           +  + + +FF
Sbjct: 180 KSSETRREFF 189


>gi|212716402|ref|ZP_03324530.1| hypothetical protein BIFCAT_01325 [Bifidobacterium catenulatum DSM
           16992]
 gi|225350933|ref|ZP_03741956.1| hypothetical protein BIFPSEUDO_02508 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|212660655|gb|EEB21230.1| hypothetical protein BIFCAT_01325 [Bifidobacterium catenulatum DSM
           16992]
 gi|225158389|gb|EEG71631.1| hypothetical protein BIFPSEUDO_02508 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 212

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 112/168 (66%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  ++A+R+ L+ IG+DPDREGL DTPDR+ ++ KELFAG    P     ++F       
Sbjct: 29  EGVRQAVRLFLKSIGEDPDREGLLDTPDRIGRACKELFAGLGHGPEEVLKTKFKV----D 84

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
             +MVL++DI  FS CEHH+LP  G  H+ YIP    V GLSKL R++E+Y+RR Q+QER
Sbjct: 85  TDEMVLVRDIELFSVCEHHLLPFHGVAHVGYIPSNGQVAGLSKLARLVELYARRPQVQER 144

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT Q+A A+    +++GV V+ E  HMCM+MRG+K+    TVT+A  G
Sbjct: 145 LTQQVADALMEGIEARGVIVVTECDHMCMAMRGVKKAQSRTVTSAVRG 192


>gi|282853316|ref|ZP_06262653.1| GTP cyclohydrolase I [Propionibacterium acnes J139]
 gi|289424452|ref|ZP_06426235.1| GTP cyclohydrolase I [Propionibacterium acnes SK187]
 gi|282582769|gb|EFB88149.1| GTP cyclohydrolase I [Propionibacterium acnes J139]
 gi|289155149|gb|EFD03831.1| GTP cyclohydrolase I [Propionibacterium acnes SK187]
          Length = 194

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 111/169 (65%), Gaps = 6/169 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A  AIR  L  +G+DPDREGL+DTP RV ++ +ELF G  Q P     + F       
Sbjct: 11  ERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTFDI----S 66

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           + +MVL++DI   S CEHH+LP  G  H+ YIP +   V GLSK+ R++EVY+RR Q+QE
Sbjct: 67  HDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQVQE 126

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           RLT Q+A A+    D++GV V++E +HMCM+ RG+++ G  TVT+A  G
Sbjct: 127 RLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRG 175


>gi|313826481|gb|EFS64195.1| GTP cyclohydrolase I [Propionibacterium acnes HL063PA1]
          Length = 191

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 111/169 (65%), Gaps = 6/169 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A  AIR  L  +G+DPDREGL+DTP RV ++ +ELF G  Q P     + F       
Sbjct: 8   ERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPEELLATTFDI----S 63

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           + +MVL++DI   S CEHH+LP  G  H+ YIP +   V GLSK+ R++EVY+RR Q+QE
Sbjct: 64  HDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQVQE 123

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           RLT Q+A A+    D++GV V++E +HMCM+ RG+++ G  TVT+A  G
Sbjct: 124 RLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRG 172


>gi|257789898|ref|YP_003180504.1| GTP cyclohydrolase I [Eggerthella lenta DSM 2243]
 gi|317489356|ref|ZP_07947869.1| GTP cyclohydrolase I [Eggerthella sp. 1_3_56FAA]
 gi|325832622|ref|ZP_08165420.1| GTP cyclohydrolase I [Eggerthella sp. HGA1]
 gi|257473795|gb|ACV54115.1| GTP cyclohydrolase I [Eggerthella lenta DSM 2243]
 gi|316911527|gb|EFV33123.1| GTP cyclohydrolase I [Eggerthella sp. 1_3_56FAA]
 gi|325485943|gb|EGC88403.1| GTP cyclohydrolase I [Eggerthella sp. HGA1]
          Length = 189

 Score =  167 bits (424), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 114/173 (65%), Gaps = 6/173 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E +R+IL  +G+DP REGL  TP+RV K Y+E+FAG  + P     + F       +++
Sbjct: 7   EEGVRLILEGVGEDPGREGLVKTPERVAKMYEEVFAGLTEDPAQHFETTFD----EHHEE 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERLT 139
           MVL++DI F+S CEHH+ P +G  H+AYIP     + GLSKL R+++ +++R Q+QERLT
Sbjct: 63  MVLVRDIPFYSMCEHHLAPFFGVAHVAYIPASDGRICGLSKLARLVDAFAKRPQVQERLT 122

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
            QIA  +      +GV V++E +HMCMSMRG+K+ G TT T+A  G F + + 
Sbjct: 123 SQIADTLIEQLHPQGVIVVLEAEHMCMSMRGVKKPGTTTTTSAVRGAFEKSQA 175


>gi|320106301|ref|YP_004181891.1| GTP cyclohydrolase I [Terriglobus saanensis SP1PR4]
 gi|319924822|gb|ADV81897.1| GTP cyclohydrolase I [Terriglobus saanensis SP1PR4]
          Length = 193

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 122/188 (64%), Gaps = 6/188 (3%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           L++ T EE    +   LR +G+DP+R+GL  TP+RV KS   L  GY Q PT  +  R  
Sbjct: 5   LEQATTEELYSEV---LRRLGEDPERDGLLKTPERVAKSMAFLTQGYAQNPT--ELLRGA 59

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
             +   Y +MV+++DI F+S CEHH+LP +GK H+AYIP+  VIGLSK+ R++++++RRL
Sbjct: 60  LFDVD-YDEMVIVRDIEFYSLCEHHMLPFFGKAHVAYIPQGKVIGLSKVARLVDLFARRL 118

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           Q+QER+T QIA AI  +   +GV V++E QH+CM MRG+++    T T+A  G F     
Sbjct: 119 QVQERMTRQIADAIVEAIAPQGVGVVVEAQHLCMMMRGVEKQHSMTTTSAMLGAFRNAAQ 178

Query: 193 KTDFFLKM 200
             + FL +
Sbjct: 179 TRNEFLSL 186


>gi|260578432|ref|ZP_05846346.1| GTP cyclohydrolase I [Corynebacterium jeikeium ATCC 43734]
 gi|258603454|gb|EEW16717.1| GTP cyclohydrolase I [Corynebacterium jeikeium ATCC 43734]
          Length = 198

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 119/174 (68%), Gaps = 6/174 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ AIR +L  IG+DPDREGL++TP RV ++Y+E  AG  + PT      F    +  
Sbjct: 16  ERAEAAIRELLFAIGEDPDREGLQETPARVARAYRETCAGLYEDPTEVLNKTF----SED 71

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++VL++DI+F+S CEHH++P +GK H+ YIP +   V GLSKL R+++  ++R Q+QE
Sbjct: 72  HRELVLVRDITFYSMCEHHLVPFFGKAHIGYIPGESGKVTGLSKLARLIDGLAKRPQVQE 131

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLT Q+A A+    D   V V++E +H+CM+MRGI++ G  TVT+A  G F ++
Sbjct: 132 RLTSQVADALVEKLDPSAVIVVLEAEHLCMAMRGIRKPGANTVTSAVRGGFQKN 185


>gi|229816396|ref|ZP_04446701.1| hypothetical protein COLINT_03450 [Collinsella intestinalis DSM
           13280]
 gi|229808045|gb|EEP43842.1| hypothetical protein COLINT_03450 [Collinsella intestinalis DSM
           13280]
          Length = 185

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 116/182 (63%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           ++ +EA+R++L  IG+DP REGL +TPDRV + Y EL  G  +  +   +  F    A  
Sbjct: 5   DKVREAVRLLLEGIGEDPTREGLVETPDRVARMYSELCDGMDRSASEHLSKTF----AVS 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             D+V+ +DI+F+S CEHH+LP +GK  + YIP   V GLSKL R +EV++RRLQ+QE+L
Sbjct: 61  GDDLVIERDITFYSLCEHHMLPFYGKAAIGYIPNGRVAGLSKLARTVEVFARRLQLQEQL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T Q+A A+ +  D KG  V +E +HMCM+MRG+++ G  T T A  G F  +      F 
Sbjct: 121 TAQVADALMAELDCKGAIVYMEAEHMCMTMRGVQKPGTKTATLARRGAFVENPEFEARFF 180

Query: 199 KM 200
           +M
Sbjct: 181 RM 182


>gi|227494495|ref|ZP_03924811.1| GTP cyclohydrolase I [Actinomyces coleocanis DSM 15436]
 gi|226832229|gb|EEH64612.1| GTP cyclohydrolase I [Actinomyces coleocanis DSM 15436]
          Length = 189

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 78/178 (43%), Positives = 117/178 (65%), Gaps = 5/178 (2%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DP+REGL +TP RV +++KEL +G  + P       F      +  
Sbjct: 8   AEAAVRDLLIAVGEDPEREGLLETPARVARAWKELLSGLDEDPAKHLEKHF----TVETD 63

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH-VIGLSKLVRILEVYSRRLQIQERLT 139
           +MVL++DI F S CEHH+LP  G+ H+AYIP+ + V GLSKL R++E Y+RR Q+QERLT
Sbjct: 64  EMVLVRDIEFHSVCEHHLLPFHGRAHVAYIPRDNKVTGLSKLARVVEGYARRPQVQERLT 123

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
            QIA A+    + +GV V++E +H+CM+MRGI++ G TTVT+   G  +    + +  
Sbjct: 124 TQIAQALVEKLNPQGVCVIMEAEHLCMTMRGIRKTGATTVTSKLCGVMNNSATRQEMM 181


>gi|50841751|ref|YP_054978.1| GTP cyclohydrolase I [Propionibacterium acnes KPA171202]
 gi|289428854|ref|ZP_06430534.1| GTP cyclohydrolase I [Propionibacterium acnes J165]
 gi|295129830|ref|YP_003580493.1| GTP cyclohydrolase I [Propionibacterium acnes SK137]
 gi|50839353|gb|AAT82020.1| GTP cyclohydrolase I [Propionibacterium acnes KPA171202]
 gi|289157855|gb|EFD06078.1| GTP cyclohydrolase I [Propionibacterium acnes J165]
 gi|291375368|gb|ADD99222.1| GTP cyclohydrolase I [Propionibacterium acnes SK137]
 gi|313765280|gb|EFS36644.1| GTP cyclohydrolase I [Propionibacterium acnes HL013PA1]
 gi|313772805|gb|EFS38771.1| GTP cyclohydrolase I [Propionibacterium acnes HL074PA1]
 gi|313793174|gb|EFS41241.1| GTP cyclohydrolase I [Propionibacterium acnes HL110PA1]
 gi|313802738|gb|EFS43956.1| GTP cyclohydrolase I [Propionibacterium acnes HL110PA2]
 gi|313806395|gb|EFS44902.1| GTP cyclohydrolase I [Propionibacterium acnes HL087PA2]
 gi|313810945|gb|EFS48659.1| GTP cyclohydrolase I [Propionibacterium acnes HL083PA1]
 gi|313814557|gb|EFS52271.1| GTP cyclohydrolase I [Propionibacterium acnes HL025PA1]
 gi|313815351|gb|EFS53065.1| GTP cyclohydrolase I [Propionibacterium acnes HL059PA1]
 gi|313817474|gb|EFS55188.1| GTP cyclohydrolase I [Propionibacterium acnes HL046PA2]
 gi|313821990|gb|EFS59704.1| GTP cyclohydrolase I [Propionibacterium acnes HL036PA1]
 gi|313824114|gb|EFS61828.1| GTP cyclohydrolase I [Propionibacterium acnes HL036PA2]
 gi|313828790|gb|EFS66504.1| GTP cyclohydrolase I [Propionibacterium acnes HL063PA2]
 gi|313831710|gb|EFS69424.1| GTP cyclohydrolase I [Propionibacterium acnes HL007PA1]
 gi|313834408|gb|EFS72122.1| GTP cyclohydrolase I [Propionibacterium acnes HL056PA1]
 gi|313840401|gb|EFS78115.1| GTP cyclohydrolase I [Propionibacterium acnes HL086PA1]
 gi|314916067|gb|EFS79898.1| GTP cyclohydrolase I [Propionibacterium acnes HL005PA4]
 gi|314917218|gb|EFS81049.1| GTP cyclohydrolase I [Propionibacterium acnes HL050PA1]
 gi|314921718|gb|EFS85549.1| GTP cyclohydrolase I [Propionibacterium acnes HL050PA3]
 gi|314922408|gb|EFS86239.1| GTP cyclohydrolase I [Propionibacterium acnes HL001PA1]
 gi|314926565|gb|EFS90396.1| GTP cyclohydrolase I [Propionibacterium acnes HL036PA3]
 gi|314931075|gb|EFS94906.1| GTP cyclohydrolase I [Propionibacterium acnes HL067PA1]
 gi|314955056|gb|EFS99462.1| GTP cyclohydrolase I [Propionibacterium acnes HL027PA1]
 gi|314959095|gb|EFT03197.1| GTP cyclohydrolase I [Propionibacterium acnes HL002PA1]
 gi|314964586|gb|EFT08686.1| GTP cyclohydrolase I [Propionibacterium acnes HL082PA1]
 gi|314965444|gb|EFT09543.1| GTP cyclohydrolase I [Propionibacterium acnes HL082PA2]
 gi|314969685|gb|EFT13783.1| GTP cyclohydrolase I [Propionibacterium acnes HL037PA1]
 gi|314974750|gb|EFT18845.1| GTP cyclohydrolase I [Propionibacterium acnes HL053PA1]
 gi|314977053|gb|EFT21148.1| GTP cyclohydrolase I [Propionibacterium acnes HL045PA1]
 gi|314980288|gb|EFT24382.1| GTP cyclohydrolase I [Propionibacterium acnes HL072PA2]
 gi|314985462|gb|EFT29554.1| GTP cyclohydrolase I [Propionibacterium acnes HL005PA1]
 gi|314987372|gb|EFT31463.1| GTP cyclohydrolase I [Propionibacterium acnes HL005PA2]
 gi|314989087|gb|EFT33178.1| GTP cyclohydrolase I [Propionibacterium acnes HL005PA3]
 gi|315078397|gb|EFT50428.1| GTP cyclohydrolase I [Propionibacterium acnes HL053PA2]
 gi|315082134|gb|EFT54110.1| GTP cyclohydrolase I [Propionibacterium acnes HL078PA1]
 gi|315082722|gb|EFT54698.1| GTP cyclohydrolase I [Propionibacterium acnes HL027PA2]
 gi|315086080|gb|EFT58056.1| GTP cyclohydrolase I [Propionibacterium acnes HL002PA3]
 gi|315087666|gb|EFT59642.1| GTP cyclohydrolase I [Propionibacterium acnes HL072PA1]
 gi|315094260|gb|EFT66236.1| GTP cyclohydrolase I [Propionibacterium acnes HL060PA1]
 gi|315097297|gb|EFT69273.1| GTP cyclohydrolase I [Propionibacterium acnes HL038PA1]
 gi|315099485|gb|EFT71461.1| GTP cyclohydrolase I [Propionibacterium acnes HL059PA2]
 gi|315102009|gb|EFT73985.1| GTP cyclohydrolase I [Propionibacterium acnes HL046PA1]
 gi|315104915|gb|EFT76891.1| GTP cyclohydrolase I [Propionibacterium acnes HL050PA2]
 gi|315106291|gb|EFT78267.1| GTP cyclohydrolase I [Propionibacterium acnes HL030PA1]
 gi|315110069|gb|EFT82045.1| GTP cyclohydrolase I [Propionibacterium acnes HL030PA2]
 gi|327329238|gb|EGE70998.1| GTP cyclohydrolase I [Propionibacterium acnes HL103PA1]
 gi|327331333|gb|EGE73072.1| GTP cyclohydrolase I [Propionibacterium acnes HL096PA2]
 gi|327333319|gb|EGE75039.1| GTP cyclohydrolase I [Propionibacterium acnes HL096PA3]
 gi|327334839|gb|EGE76550.1| GTP cyclohydrolase I [Propionibacterium acnes HL097PA1]
 gi|327445203|gb|EGE91857.1| GTP cyclohydrolase I [Propionibacterium acnes HL013PA2]
 gi|327447286|gb|EGE93940.1| GTP cyclohydrolase I [Propionibacterium acnes HL043PA1]
 gi|327450267|gb|EGE96921.1| GTP cyclohydrolase I [Propionibacterium acnes HL043PA2]
 gi|327454533|gb|EGF01188.1| GTP cyclohydrolase I [Propionibacterium acnes HL087PA3]
 gi|327456603|gb|EGF03258.1| GTP cyclohydrolase I [Propionibacterium acnes HL083PA2]
 gi|327457121|gb|EGF03776.1| GTP cyclohydrolase I [Propionibacterium acnes HL092PA1]
 gi|328755587|gb|EGF69203.1| GTP cyclohydrolase I [Propionibacterium acnes HL087PA1]
 gi|328756914|gb|EGF70530.1| GTP cyclohydrolase I [Propionibacterium acnes HL025PA2]
 gi|328758403|gb|EGF72019.1| GTP cyclohydrolase I [Propionibacterium acnes HL020PA1]
 gi|328761146|gb|EGF74690.1| GTP cyclohydrolase I [Propionibacterium acnes HL099PA1]
 gi|332674669|gb|AEE71485.1| GTP cyclohydrolase 1 [Propionibacterium acnes 266]
          Length = 191

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 111/169 (65%), Gaps = 6/169 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A  AIR  L  +G+DPDREGL+DTP RV ++ +ELF G  Q P     + F       
Sbjct: 8   ERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTFDI----S 63

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           + +MVL++DI   S CEHH+LP  G  H+ YIP +   V GLSK+ R++EVY+RR Q+QE
Sbjct: 64  HDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQVQE 123

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           RLT Q+A A+    D++GV V++E +HMCM+ RG+++ G  TVT+A  G
Sbjct: 124 RLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRG 172


>gi|312867927|ref|ZP_07728131.1| GTP cyclohydrolase I [Streptococcus parasanguinis F0405]
 gi|311096331|gb|EFQ54571.1| GTP cyclohydrolase I [Streptococcus parasanguinis F0405]
          Length = 184

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 120/182 (65%), Gaps = 5/182 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+++I+  +G+D +REGL++TP R+ K Y+E+FAG  +      +  F   +     +
Sbjct: 7   EEAVKMIIEAVGEDENREGLQETPIRIAKMYQEIFAGLGRTAEEHLSKSFEIID----NN 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+ KDI F S CEHH LP +GK+H+AYIP   V GLSKL R +EVY+++ QIQERLT++
Sbjct: 63  MVVEKDIFFHSMCEHHFLPFYGKVHIAYIPNGRVAGLSKLARTVEVYAKKPQIQERLTVE 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFFLKM 200
           IA A+     ++G  V +E +HMCM+MRG+++ G  TVTTA  G  + DK  K + +  M
Sbjct: 123 IADALMEYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGLLATDKDLKNEAYKLM 182

Query: 201 TH 202
            H
Sbjct: 183 GH 184


>gi|68535344|ref|YP_250049.1| GTP cyclohydrolase I [Corynebacterium jeikeium K411]
 gi|68262943|emb|CAI36431.1| folE [Corynebacterium jeikeium K411]
          Length = 198

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 119/174 (68%), Gaps = 6/174 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ AIR +L  IG+DPDREGL++TP RV ++Y+E  AG  + PT      F    +  
Sbjct: 16  ERAEAAIRELLFAIGEDPDREGLQETPARVARAYRETCAGLYEDPTEVLNKTF----SED 71

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++VL++DI+F+S CEHH++P +GK H+ YIP +   V GLSKL R+++  ++R Q+QE
Sbjct: 72  HRELVLVRDITFYSMCEHHLVPFFGKAHIGYIPGESGKVTGLSKLARLIDGLAKRPQVQE 131

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLT Q+A A+    D   V V++E +H+CM+MRGI++ G  TVT+A  G F ++
Sbjct: 132 RLTSQVADALVDKLDPSAVIVVLEAEHLCMAMRGIRKPGANTVTSAVRGGFQKN 185


>gi|212551009|ref|YP_002309326.1| GTP cyclohydrolase I [Candidatus Azobacteroides pseudotrichonymphae
           genomovar. CFP2]
 gi|212549247|dbj|BAG83915.1| GTP cyclohydrolase I [Candidatus Azobacteroides pseudotrichonymphae
           genomovar. CFP2]
          Length = 192

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 118/176 (67%), Gaps = 4/176 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL+ +G+DP R+GL +TP RV++S   L  GY Q    +  S   F E   Y+ MV++++
Sbjct: 21  ILKLLGEDPKRQGLLNTPKRVVESIMYLTKGYAQ-SAEEILSSAIFVE--DYRQMVIVRN 77

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I FFS CEHH+LP +GK H+AYIP   V GLSK+ R+++VY+RRLQIQER+T QI   I+
Sbjct: 78  IDFFSLCEHHLLPFFGKAHVAYIPNNVVSGLSKIPRVVDVYARRLQIQERMTTQIKSCIQ 137

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHN 203
              +  GV V+IE QHMC+ MRG+++    T T+ FTG F++ K + + F+K+  N
Sbjct: 138 EILNPLGVMVVIEAQHMCIQMRGVEKQNSITTTSDFTGVFNQAKTREE-FIKLIKN 192


>gi|320592711|gb|EFX05132.1| GTP cyclohydrolase 1 [Grosmannia clavigera kw1407]
          Length = 312

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 120/182 (65%), Gaps = 6/182 (3%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEA 76
           +E  K A+R +L  +G+DPDREGL  TP R  K+  E   GY K +    + + F  G  
Sbjct: 127 LERMKGAVRTLLECVGEDPDREGLLATPLRYAKAMLEFTEGYQKNVRDIVNGAIFQEG-- 184

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             + +MV++KDI  +S CEHH++P  GK+H+ YIP   VIG+SKL RI E+++RRLQIQE
Sbjct: 185 --HNEMVIVKDIDVYSICEHHLVPFTGKMHIGYIPNNAVIGISKLPRIAELFARRLQIQE 242

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS-RDKGKTD 195
           RLT ++A+A+      +GVAV++E  H+CM MRG+++ G TT+T+   G F  R+K + +
Sbjct: 243 RLTREVANAVFEVLKPQGVAVVMESSHLCMVMRGVQKAGSTTITSCVLGCFEKREKTRNE 302

Query: 196 FF 197
           FF
Sbjct: 303 FF 304


>gi|237797642|ref|ZP_04586103.1| GTP cyclohydrolase I [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331020492|gb|EGI00549.1| GTP cyclohydrolase I [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 181

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 109/173 (63%), Gaps = 3/173 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+D  REGL DTP R  K+ + L  GY Q             EAS   +MV++KD
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTNGALFSSEAS---EMVMVKD 66

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP  GK H+AYIP+  V+GLSK+ RI+++Y+RRLQIQE L+ QIA AI+
Sbjct: 67  IELYSLCEHHLLPFIGKAHVAYIPQGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAIQ 126

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
             T + GVAV+IE +HMCM MRG+++     +T+   GEF  +      FL +
Sbjct: 127 QVTGALGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSL 179


>gi|66805951|ref|XP_636697.1| GTP cyclohydrolase I [Dictyostelium discoideum AX4]
 gi|166203659|sp|Q94465|GCH1_DICDI RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|60465088|gb|EAL63189.1| GTP cyclohydrolase I [Dictyostelium discoideum AX4]
          Length = 232

 Score =  167 bits (423), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 124/187 (66%), Gaps = 10/187 (5%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA---SK 78
           + +++ +L  +G+DPDREGL  TP R+ K+      GY+Q  +  +      GEA     
Sbjct: 52  QSSVKTLLSSLGEDPDREGLLKTPLRMSKALLFFTQGYEQ--SVDEV----IGEAIFNEN 105

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           + +MV+++DI  FS CEHH++P  GK H+ YIP + V+GLSKL R+ E+++RRLQ+QERL
Sbjct: 106 HHEMVVVRDIDIFSLCEHHMVPFHGKCHIGYIPDQKVLGLSKLARVAEIFARRLQVQERL 165

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           T QIA AI++  +  GVAV+IE  HMCM MRG+++ G +TVT++  G F +D + + +FF
Sbjct: 166 TRQIAQAIQAHLNPMGVAVVIEASHMCMVMRGVQKPGASTVTSSVCGIFEKDSRTRAEFF 225

Query: 198 LKMTHNQ 204
             +  N+
Sbjct: 226 SLIKSNK 232


>gi|171741152|ref|ZP_02916959.1| hypothetical protein BIFDEN_00219 [Bifidobacterium dentium ATCC
           27678]
 gi|283455479|ref|YP_003360043.1| GTP cyclohydrolase I [Bifidobacterium dentium Bd1]
 gi|171276766|gb|EDT44427.1| hypothetical protein BIFDEN_00219 [Bifidobacterium dentium ATCC
           27678]
 gi|283102113|gb|ADB09219.1| GTP cyclohydrolase I [Bifidobacterium dentium Bd1]
          Length = 212

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 80/168 (47%), Positives = 113/168 (67%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  ++A+R+ LR IG+DPDREGL DTP+R+ ++ +ELFAG    P     ++F       
Sbjct: 29  EGVRQAVRLFLRSIGEDPDREGLLDTPNRIGRACRELFAGLGHGPEEVLKTKFKV----D 84

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
             +MVL++DI  FS CEHH+LP  G  H+ YIP    V GLSKL R++E+Y+RR Q+QER
Sbjct: 85  TDEMVLVRDIELFSVCEHHLLPFHGVAHVGYIPSNGQVAGLSKLARLVELYARRPQVQER 144

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           LT Q+A A+ +  +++GV V+ E  HMCM+MRG+K+    TVT+A  G
Sbjct: 145 LTQQVADALMTGIEARGVIVVTECDHMCMAMRGVKKPQSRTVTSAVRG 192


>gi|314982604|gb|EFT26696.1| GTP cyclohydrolase I [Propionibacterium acnes HL110PA3]
          Length = 192

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 111/169 (65%), Gaps = 6/169 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A  AIR  L  +G+DPDREGL+DTP RV ++ +ELF G  Q P     + F       
Sbjct: 9   ERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTFDI----S 64

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           + +MVL++DI   S CEHH+LP  G  H+ YIP +   V GLSK+ R++EVY+RR Q+QE
Sbjct: 65  HDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQVQE 124

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           RLT Q+A A+    D++GV V++E +HMCM+ RG+++ G  TVT+A  G
Sbjct: 125 RLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRG 173


>gi|120406319|ref|YP_956148.1| GTP cyclohydrolase I [Mycobacterium vanbaalenii PYR-1]
 gi|166220278|sp|A1TG42|GCH1_MYCVP RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|119959137|gb|ABM16142.1| GTP cyclohydrolase I [Mycobacterium vanbaalenii PYR-1]
          Length = 202

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 118/174 (67%), Gaps = 6/174 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL+DTP RV ++Y+E+FAG    P   +  +  F E  ++ 
Sbjct: 21  AEAAVRELLIAVGEDPDREGLRDTPARVARAYQEIFAGLYTDP--DEVLKTMFDE--QHD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  +S CEHH++   G  H+ YIP     V GLSKL R++++Y++R Q+QERL
Sbjct: 77  EMVLVKDIPMYSTCEHHLVSFHGVAHVGYIPGVDGRVTGLSKLARVVDLYAKRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           T QIA A+    D +GV V+IE +H+CM+MRGI++ G  T T+A  G+F  DK 
Sbjct: 137 TGQIADALMRRLDPRGVIVVIEAEHLCMAMRGIRKPGAVTTTSAVRGQFKTDKA 190


>gi|169627638|ref|YP_001701287.1| GTP cyclohydrolase I (FolE) [Mycobacterium abscessus ATCC 19977]
 gi|229487977|sp|B1MGU9|GCH1_MYCA9 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|169239605|emb|CAM60633.1| GTP cyclohydrolase I (FolE) [Mycobacterium abscessus]
          Length = 204

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 117/175 (66%), Gaps = 6/175 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDR GL DTP RV ++Y+E+FAG    P T   + F      ++ 
Sbjct: 23  AEAAVRELLYAVGEDPDRHGLADTPARVARAYREIFAGLYTDPDTVLNTTFD----EQHD 78

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           ++VL+K I  +S CEHH++   G  H+ YIP +H  V GLSK+ R++++Y++R Q+QERL
Sbjct: 79  ELVLVKSIPMYSTCEHHLVSFHGVAHVGYIPGQHGRVTGLSKIARLVDLYAKRPQVQERL 138

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           T QIA A+    + +GV V++E +H+CM+MRG+++ G TT T+A  G+F RD   
Sbjct: 139 TAQIADALVRKLEPRGVIVVVEAEHLCMAMRGVRKPGATTTTSAVRGQFKRDAAS 193


>gi|15596871|ref|NP_250365.1| GTP cyclohydrolase I [Pseudomonas aeruginosa PAO1]
 gi|107101105|ref|ZP_01365023.1| hypothetical protein PaerPA_01002137 [Pseudomonas aeruginosa PACS2]
 gi|116049623|ref|YP_791572.1| GTP cyclohydrolase I [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218892371|ref|YP_002441238.1| GTP cyclohydrolase I [Pseudomonas aeruginosa LESB58]
 gi|254234774|ref|ZP_04928097.1| GTP cyclohydrolase I precursor [Pseudomonas aeruginosa C3719]
 gi|254240020|ref|ZP_04933342.1| GTP cyclohydrolase I precursor [Pseudomonas aeruginosa 2192]
 gi|296389945|ref|ZP_06879420.1| GTP cyclohydrolase I [Pseudomonas aeruginosa PAb1]
 gi|313110359|ref|ZP_07796248.1| GTP cyclohydrolase I precursor [Pseudomonas aeruginosa 39016]
 gi|25090439|sp|Q9I351|GCH12_PSEAE RecName: Full=GTP cyclohydrolase 1 2; AltName: Full=GTP
           cyclohydrolase I 2; Short=GTP-CH-I 2
 gi|9947646|gb|AAG05063.1|AE004595_2 GTP cyclohydrolase I precursor [Pseudomonas aeruginosa PAO1]
 gi|115584844|gb|ABJ10859.1| GTP cyclohydrolase I precursor [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126166705|gb|EAZ52216.1| GTP cyclohydrolase I precursor [Pseudomonas aeruginosa C3719]
 gi|126193398|gb|EAZ57461.1| GTP cyclohydrolase I precursor [Pseudomonas aeruginosa 2192]
 gi|218772597|emb|CAW28380.1| GTP cyclohydrolase I precursor [Pseudomonas aeruginosa LESB58]
 gi|310882750|gb|EFQ41344.1| GTP cyclohydrolase I precursor [Pseudomonas aeruginosa 39016]
          Length = 181

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 114/174 (65%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +REGL DTP R  K+ K L  GY+Q +    + + F    +S   +MVL+K
Sbjct: 10  ILTQLGEDVNREGLLDTPKRAAKAMKYLCRGYQQSLEEVVNGALF----SSDNSEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE ++ QIA A+
Sbjct: 66  DIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENMSRQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +  T + GVAV+I+ QHMCM MRG+++   + VT+   GEF  +      FL +
Sbjct: 126 QQVTGALGVAVVIQAQHMCMMMRGVEKQNSSMVTSVMLGEFRDNAATRSEFLSL 179


>gi|330502848|ref|YP_004379717.1| GTP cyclohydrolase I [Pseudomonas mendocina NK-01]
 gi|328917134|gb|AEB57965.1| GTP cyclohydrolase I [Pseudomonas mendocina NK-01]
          Length = 181

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 113/175 (64%), Gaps = 5/175 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D  REGL DTP R  K+ + L  GY+Q +    + + F    +S   +MVL+K
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYQQTLEEVTNGALF----SSDNSEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA A+
Sbjct: 66  NIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           E  T + GVAV+IE QHMCM MRG+++   + VT+   GEF  +      FL + 
Sbjct: 126 EQVTGALGVAVVIEAQHMCMMMRGVEKQNSSMVTSVMLGEFRTNPATRGEFLNLV 180


>gi|255655459|ref|ZP_05400868.1| GTP cyclohydrolase I [Clostridium difficile QCD-23m63]
 gi|296451452|ref|ZP_06893189.1| GTP cyclohydrolase I [Clostridium difficile NAP08]
 gi|296880199|ref|ZP_06904165.1| GTP cyclohydrolase I [Clostridium difficile NAP07]
 gi|296259719|gb|EFH06577.1| GTP cyclohydrolase I [Clostridium difficile NAP08]
 gi|296428788|gb|EFH14669.1| GTP cyclohydrolase I [Clostridium difficile NAP07]
          Length = 190

 Score =  167 bits (423), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 120/173 (69%), Gaps = 4/173 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ + A+R IL  IG+DPDREGL +TP+RV + Y+E+F+G  + P  +D  +  F +  K
Sbjct: 7   EKIQHAVREILEAIGEDPDREGLIETPNRVARMYEEIFSGLNEEP--RDHLKVLFAD-EK 63

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F+S CEHH++P +GK H+AY+PK   + GLSKL R+++  ++R Q+QER
Sbjct: 64  HEELVLVKDIPFYSCCEHHLVPFFGKAHIAYLPKGGRLTGLSKLARVIDTLAKRPQLQER 123

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +T   A  I       GV V++E +HMCM+MRG+K+ G  TVT+A  G F +D
Sbjct: 124 ITKNAADIIMEELQPYGVLVVVEAEHMCMTMRGVKKPGSKTVTSAVRGIFEKD 176


>gi|219846973|ref|YP_002461406.1| GTP cyclohydrolase I [Chloroflexus aggregans DSM 9485]
 gi|219541232|gb|ACL22970.1| GTP cyclohydrolase I [Chloroflexus aggregans DSM 9485]
          Length = 224

 Score =  167 bits (423), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 119/185 (64%), Gaps = 7/185 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+  IL  IG+ P+REGL+ TP RV K Y EL AGY   P         F  A  Y +
Sbjct: 40  EDAVHTILTAIGEIPEREGLQKTPSRVAKMYAELTAGYHIDPQALINGAV-FSVA--YDE 96

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL+ +I ++S CEHH+LP +G++H+AYIP   V+GLSK+ RI+E+++RRLQ+QER+T+Q
Sbjct: 97  MVLVTNIDYYSLCEHHMLPFFGQVHVAYIPNGKVVGLSKIPRIVEMFARRLQVQERMTVQ 156

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFFLKM 200
           IA  I  + +  GVAV+ EG HMC  MRG+K+     VT+A  G F  D K + +F   M
Sbjct: 157 IADFINETLEPAGVAVVAEGIHMCGVMRGVKKANARMVTSAMRGAFREDPKTRAEF---M 213

Query: 201 THNQR 205
            H  R
Sbjct: 214 AHVNR 218


>gi|152984341|ref|YP_001348952.1| GTP cyclohydrolase I [Pseudomonas aeruginosa PA7]
 gi|150959499|gb|ABR81524.1| GTP cyclohydrolase I [Pseudomonas aeruginosa PA7]
          Length = 181

 Score =  167 bits (423), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 114/174 (65%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +REGL DTP R  K+ K L  GY+Q +    + + F    +S   +MVL+K
Sbjct: 10  ILTQLGEDVNREGLLDTPKRAAKAMKYLCRGYEQSLEEVVNGALF----SSDNSEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE ++ QIA A+
Sbjct: 66  DIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENMSRQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +  T + GVAV+I+ QHMCM MRG+++   + VT+   GEF  +      FL +
Sbjct: 126 QQVTGALGVAVVIQAQHMCMMMRGVEKQNSSMVTSVMLGEFRDNAATRSEFLSL 179


>gi|302535217|ref|ZP_07287559.1| GTP cyclohydrolase I [Streptomyces sp. C]
 gi|302444112|gb|EFL15928.1| GTP cyclohydrolase I [Streptomyces sp. C]
          Length = 202

 Score =  167 bits (422), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 114/169 (67%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL +TP RV ++YKE+FAG  Q P    T+ F  G    + 
Sbjct: 22  AEAAVRELLIAVGEDPDREGLLETPARVARAYKEIFAGLYQKPEEVLTTTFDLG----HD 77

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI   S CEHH++P  G  H+ YIP     + GLSKL R+++V++RR Q+QERL
Sbjct: 78  EMVLVKDIEVMSSCEHHLVPFHGVAHVGYIPSTDGKITGLSKLARLVDVFARRPQVQERL 137

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    D +G  V+IE +HMCM+MRG+++ G  T+T+A  G+ 
Sbjct: 138 TTQIADSLMEILDPRGCIVVIECEHMCMTMRGVRKPGAKTITSAVRGQL 186


>gi|322435895|ref|YP_004218107.1| GTP cyclohydrolase I [Acidobacterium sp. MP5ACTX9]
 gi|321163622|gb|ADW69327.1| GTP cyclohydrolase I [Acidobacterium sp. MP5ACTX9]
          Length = 196

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 117/176 (66%), Gaps = 5/176 (2%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPT-TQDTSRFHFGEASKYQDMVL 84
           R ++R +G+DPDR+GL  TP+R+ KS   L  GYKQ  T     + F       Y +MV+
Sbjct: 18  REMIRRMGEDPDRDGLLRTPERMEKSTAFLTQGYKQTVTEVLHNALFDV----DYDEMVI 73

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +KDI F+S CEHH+LP +GK H+AY+P   VIGLSK+ R+++V++RRLQ+QERLT QIA 
Sbjct: 74  VKDIEFYSQCEHHLLPFFGKAHVAYVPNGKVIGLSKIARLVDVFARRLQVQERLTRQIAE 133

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +IE +   +GV +++E QH+CM MRG+++    TVT+A  G F       + FL +
Sbjct: 134 SIEEAIAPQGVGIILEAQHLCMMMRGVEKQHSHTVTSAMLGVFKTQLQTRNEFLSL 189


>gi|239980351|ref|ZP_04702875.1| GTP cyclohydrolase I [Streptomyces albus J1074]
 gi|291452214|ref|ZP_06591604.1| GTP cyclohydrolase I [Streptomyces albus J1074]
 gi|291355163|gb|EFE82065.1| GTP cyclohydrolase I [Streptomyces albus J1074]
          Length = 201

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 116/169 (68%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDREGL++TP RV ++Y+E+FAG  Q P    T+ F  G    + 
Sbjct: 21  AEHAVRELLLAVGEDPDREGLRETPARVARAYREIFAGLWQKPEDVLTTTFDLG----HD 76

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI   S CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QERL
Sbjct: 77  EMVLVKDIEVQSSCEHHLVPFVGVAHVGYIPSADGKITGLSKLARLVDVYARRPQVQERL 136

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T QIA ++    + +GV V++E +HMCM+MRG+++ G  T+T+A  G+ 
Sbjct: 137 TTQIADSLMEILEPRGVIVVVECEHMCMTMRGVRKPGAKTITSAVRGQL 185


>gi|310799984|gb|EFQ34877.1| GTP cyclohydrolase I [Glomerella graminicola M1.001]
          Length = 314

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 121/184 (65%), Gaps = 5/184 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEA 76
           +E+ + A+R IL  +G+DPDR G+ DTP R  K+   L  GY+Q +    + + F  G  
Sbjct: 130 LEKLQGAVRTILECVGEDPDRPGVLDTPRRYAKAMLFLTRGYQQNVKDIVNNAIFQEG-- 187

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             + +MV++KDI  +S CEHH++P  GK+H+AYIPK  VIGLSKL RI E++SRR QIQE
Sbjct: 188 --HNEMVVVKDIEIYSMCEHHLVPFTGKMHIAYIPKNQVIGLSKLPRIAEMFSRRFQIQE 245

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT ++A+AI      +GVAV++E  H+CM MRG+++   +T+T+   G F + +   + 
Sbjct: 246 RLTKEVAYAIMEILKPQGVAVVMESSHLCMVMRGVQKTTASTITSCVLGAFEKKEKTRNE 305

Query: 197 FLKM 200
           FL +
Sbjct: 306 FLSL 309


>gi|295837281|ref|ZP_06824214.1| GTP cyclohydrolase [Streptomyces sp. SPB74]
 gi|197699950|gb|EDY46883.1| GTP cyclohydrolase [Streptomyces sp. SPB74]
          Length = 201

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 120/183 (65%), Gaps = 13/183 (7%)

Query: 7   GVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQ 66
           GVF+ K        A+ A+R +L  +G+DPDREGL++TP RV ++YKE+FAG    P   
Sbjct: 14  GVFDEK-------RAENAVRELLLAVGEDPDREGLRETPGRVARAYKEIFAGLWLQPEDV 66

Query: 67  DTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRI 124
            T+ F  G    + +MVL+KDI   S CEHH++P  G  H+ YIP     + GLSKL R+
Sbjct: 67  LTTTFDLG----HDEMVLVKDIEVQSTCEHHLVPFAGVAHVGYIPAADGKITGLSKLARL 122

Query: 125 LEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFT 184
           ++VY+RR Q+QERLT Q+A A+    + +GV V++E +H+CMSMRG+++ G  T+T+A  
Sbjct: 123 VDVYARRPQVQERLTTQVAEALMRILEPRGVIVVVECEHLCMSMRGVRKPGAKTLTSAVR 182

Query: 185 GEF 187
           G+ 
Sbjct: 183 GQL 185


>gi|108801732|ref|YP_641929.1| GTP cyclohydrolase I [Mycobacterium sp. MCS]
 gi|119870883|ref|YP_940835.1| GTP cyclohydrolase I [Mycobacterium sp. KMS]
 gi|108772151|gb|ABG10873.1| GTP cyclohydrolase I [Mycobacterium sp. MCS]
 gi|119696972|gb|ABL94045.1| GTP cyclohydrolase I [Mycobacterium sp. KMS]
          Length = 201

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 116/174 (66%), Gaps = 6/174 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  IG+DPDR GL DTP RV ++Y+E+FAG    P   D     F E  ++ 
Sbjct: 20  AEAAVRELLIAIGEDPDRHGLVDTPARVARAYREMFAGLYTDP--DDVLNTTFDE--QHD 75

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  +S CEHH++   G  H+ YIP     V GLSKL R++++Y++R Q+QERL
Sbjct: 76  EMVLVKDIPMYSTCEHHLVAFHGVAHVGYIPGVDGRVTGLSKLARVVDLYAKRPQVQERL 135

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           T Q+A A+    D +GV V++E +H+CM+MRGI++ G TT T+A  G+F  DK 
Sbjct: 136 TAQVADALMRKLDPRGVIVVMEAEHLCMAMRGIRKPGATTTTSAVRGQFKTDKA 189


>gi|221096003|ref|XP_002154354.1| PREDICTED: similar to GTP cyclohydrolase 1 [Hydra magnipapillata]
          Length = 239

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/189 (42%), Positives = 119/189 (62%), Gaps = 5/189 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH-FGE 75
            V    E++  ++R +G+DP+REGL  TP+R  K+      GY +    QD      F E
Sbjct: 55  NVSNIAESVLKVIRGVGEDPNREGLLKTPERFAKAMLFFTKGYTE--NLQDVVNGAVFNE 112

Query: 76  ASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
              + ++V++KDI FFS CEHH++  +GK+H+ Y+P K VIG+SK+ RI+E++SRRLQ+Q
Sbjct: 113 --DHDELVIVKDIDFFSMCEHHLVTFYGKVHVGYLPNKKVIGISKIARIVEIFSRRLQVQ 170

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           ERLT QIA A+  +    GV V+IE  HMCM MRG+++ G +TVT+   G F  D    +
Sbjct: 171 ERLTKQIALALFEAVSPSGVGVVIEACHMCMVMRGVQKVGASTVTSCMLGAFRDDPKSRN 230

Query: 196 FFLKMTHNQ 204
            FL +  N+
Sbjct: 231 EFLTLIRNK 239


>gi|220911095|ref|YP_002486404.1| GTP cyclohydrolase I [Arthrobacter chlorophenolicus A6]
 gi|219857973|gb|ACL38315.1| GTP cyclohydrolase I [Arthrobacter chlorophenolicus A6]
          Length = 214

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 116/178 (65%), Gaps = 9/178 (5%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRF 71
           K+ +P +E A   +R IL  IG+DPDR GL DTP RV K+Y E+FAG  Q P    ++ F
Sbjct: 28  KVDRPRIEAA---VREILLAIGEDPDRGGLIDTPKRVAKAYAEVFAGLHQDPADVLSTTF 84

Query: 72  HFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYS 129
                  ++++VL+KDI F+S CEHH++P  G  H+ YIP     V GLSKL R++++Y+
Sbjct: 85  EL----DHEELVLVKDIPFYSTCEHHLVPFHGVAHVGYIPSHDGRVTGLSKLARLVDIYA 140

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           RR Q+QERLT +I  A+      +G  V++E +HMCMSMRGI++ G  TVT+A  G+ 
Sbjct: 141 RRPQVQERLTTEIVEALVRHLKPRGAIVVVECEHMCMSMRGIRKPGAKTVTSAVRGQL 198


>gi|126437719|ref|YP_001073410.1| GTP cyclohydrolase I [Mycobacterium sp. JLS]
 gi|126237519|gb|ABO00920.1| GTP cyclohydrolase I [Mycobacterium sp. JLS]
          Length = 201

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 116/174 (66%), Gaps = 6/174 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  IG+DPDR GL DTP RV ++Y+E+FAG    P   D     F E  ++ 
Sbjct: 20  AEAAVRELLIAIGEDPDRHGLVDTPARVARAYREMFAGLYTDP--DDVLNTTFDE--QHD 75

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILEVYSRRLQIQERL 138
           +MVL+KDI  +S CEHH++   G  H+ YIP     V GLSKL R++++Y++R Q+QERL
Sbjct: 76  EMVLVKDIPMYSTCEHHLVAFHGVAHVGYIPGVDGRVTGLSKLARVVDLYAKRPQVQERL 135

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           T Q+A A+    D +GV V++E +H+CM+MRGI++ G TT T+A  G+F  DK 
Sbjct: 136 TAQVADALMRKLDPRGVIVVMEAEHLCMAMRGIRKPGATTTTSAVRGQFKTDKA 189


>gi|126699053|ref|YP_001087950.1| GTP cyclohydrolase I [Clostridium difficile 630]
 gi|254975003|ref|ZP_05271475.1| GTP cyclohydrolase I [Clostridium difficile QCD-66c26]
 gi|255092391|ref|ZP_05321869.1| GTP cyclohydrolase I [Clostridium difficile CIP 107932]
 gi|255100475|ref|ZP_05329452.1| GTP cyclohydrolase I [Clostridium difficile QCD-63q42]
 gi|255306415|ref|ZP_05350586.1| GTP cyclohydrolase I [Clostridium difficile ATCC 43255]
 gi|255314131|ref|ZP_05355714.1| GTP cyclohydrolase I [Clostridium difficile QCD-76w55]
 gi|255516809|ref|ZP_05384485.1| GTP cyclohydrolase I [Clostridium difficile QCD-97b34]
 gi|255649910|ref|ZP_05396812.1| GTP cyclohydrolase I [Clostridium difficile QCD-37x79]
 gi|260683065|ref|YP_003214350.1| GTP cyclohydrolase I [Clostridium difficile CD196]
 gi|260686663|ref|YP_003217796.1| GTP cyclohydrolase I [Clostridium difficile R20291]
 gi|306519997|ref|ZP_07406344.1| GTP cyclohydrolase I [Clostridium difficile QCD-32g58]
 gi|123067117|sp|Q18BW7|GCH1_CLOD6 RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|115250490|emb|CAJ68314.1| GTP cyclohydrolase 1 (GTP cyclohydrolase I) (GTP-CH-I) [Clostridium
           difficile]
 gi|260209228|emb|CBA62510.1| putative GTP cyclohydrolase I [Clostridium difficile CD196]
 gi|260212679|emb|CBE03748.1| putative GTP cyclohydrolase I [Clostridium difficile R20291]
          Length = 190

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 120/173 (69%), Gaps = 4/173 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ + A+R IL  IG+DPDREGL +TP+RV + Y+E+F+G  + P  +D  +  F +  K
Sbjct: 7   EKIQHAVREILEAIGEDPDREGLIETPNRVARMYEEIFSGLSEEP--RDHLKVLFAD-EK 63

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI F+S CEHH++P +GK H+AY+PK   + GLSKL R+++  ++R Q+QER
Sbjct: 64  HEELVLVKDIPFYSCCEHHLVPFFGKAHIAYLPKGGRLTGLSKLARVIDTLAKRPQLQER 123

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +T   A  I       GV V++E +HMCM+MRG+K+ G  TVT+A  G F +D
Sbjct: 124 ITKNAADIIMEELQPYGVLVVVEAEHMCMTMRGVKKPGSKTVTSAVRGIFEKD 176


>gi|28869239|ref|NP_791858.1| GTP cyclohydrolase I [Pseudomonas syringae pv. tomato str. DC3000]
 gi|301386449|ref|ZP_07234867.1| GTP cyclohydrolase I [Pseudomonas syringae pv. tomato Max13]
 gi|302058658|ref|ZP_07250199.1| GTP cyclohydrolase I [Pseudomonas syringae pv. tomato K40]
 gi|302131205|ref|ZP_07257195.1| GTP cyclohydrolase I [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|41017179|sp|Q884Q3|GCH12_PSESM RecName: Full=GTP cyclohydrolase 1 2; AltName: Full=GTP
           cyclohydrolase I 2; Short=GTP-CH-I 2
 gi|28852480|gb|AAO55553.1| GTP cyclohydrolase I [Pseudomonas syringae pv. tomato str. DC3000]
 gi|330876105|gb|EGH10254.1| GTP cyclohydrolase I [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 181

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 109/173 (63%), Gaps = 3/173 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+D  REGL DTP R  K+ + L  GY Q             +AS   +MV++KD
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTNGALFSSDAS---EMVMVKD 66

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA AI+
Sbjct: 67  IELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAIQ 126

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
             T ++GVAV+IE +HMCM MRG+++     +T+   GEF  +      FL +
Sbjct: 127 QVTGAQGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSL 179


>gi|111021380|ref|YP_704352.1| GTP cyclohydrolase I [Rhodococcus jostii RHA1]
 gi|110820910|gb|ABG96194.1| GTP cyclohydrolase I [Rhodococcus jostii RHA1]
          Length = 205

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 114/167 (68%), Gaps = 6/167 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  IG+DPDR GL+DTP RV +SY+E+FAG    P T   + F  G    +Q
Sbjct: 24  AEAAVRELLIAIGEDPDRPGLRDTPSRVARSYREVFAGLYTDPDTVLNTTFDEG----HQ 79

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           ++VL++DI  +S CEHH++   G  H+ YIP K   V GLSKL R++++Y++R Q+QERL
Sbjct: 80  ELVLVRDIPLYSTCEHHLVSFHGVAHVGYIPGKTGKVTGLSKLARVVDLYAKRPQVQERL 139

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           T QIA A+    D +G  V+IE +H+CM+MRGI++ G +T T+A  G
Sbjct: 140 TSQIADAVMRKLDPRGAIVVIEAEHLCMAMRGIRKPGASTTTSAVRG 186


>gi|302910112|ref|XP_003050219.1| hypothetical protein NECHADRAFT_85123 [Nectria haematococca mpVI
           77-13-4]
 gi|256731156|gb|EEU44506.1| hypothetical protein NECHADRAFT_85123 [Nectria haematococca mpVI
           77-13-4]
          Length = 312

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/177 (45%), Positives = 115/177 (64%), Gaps = 3/177 (1%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R +L  +G+DPDREGL DTP R  K+   L  GY Q+      +   F E   + +MV
Sbjct: 134 AVRTLLECVGEDPDREGLLDTPSRYAKALLFLTQGY-QVNAEDIVNNALFREG--HSEMV 190

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           ++KDI  FS CEHH++P  GK+H+ YIP + VIGLSKL RI E+++RRLQIQERLT ++A
Sbjct: 191 VVKDIEVFSLCEHHLVPFTGKMHIGYIPNETVIGLSKLPRIAEMFARRLQIQERLTKEVA 250

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +AI      +GVAV++E  H+CM MRG+++   +T+T+   G F R     + FL +
Sbjct: 251 NAIMEILKPQGVAVVMESSHLCMVMRGVEKTTTSTITSCVLGCFERKSKTRNEFLNL 307


>gi|227497062|ref|ZP_03927312.1| GTP cyclohydrolase I [Actinomyces urogenitalis DSM 15434]
 gi|226833459|gb|EEH65842.1| GTP cyclohydrolase I [Actinomyces urogenitalis DSM 15434]
          Length = 207

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 119/172 (69%), Gaps = 6/172 (3%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
            E  + A+R +L  IG+DPDR+GL++TPDR+ ++Y+E+FAG ++ P       F  G   
Sbjct: 23  AEGVRRAVRDLLIAIGEDPDRDGLRETPDRMARAYEEMFAGLREDPGAHVEKVFDVG--- 79

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQ 135
            + +MVL++DI  +S CEHH+LP  G  H+AYIP +  HV GLSKL R++E Y+RR Q+Q
Sbjct: 80  -HDEMVLVRDIPMYSVCEHHLLPFHGVAHIAYIPSEDGHVTGLSKLARLVEGYARRPQVQ 138

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           ERLT Q+A A+      +GV V++E +H+CMSMRG+++ G +TVT+A  G+ 
Sbjct: 139 ERLTAQVADAMVERLGVRGVLVVVEAEHLCMSMRGVRKPGASTVTSAVRGQL 190


>gi|145596816|ref|YP_001161113.1| GTP cyclohydrolase I [Salinispora tropica CNB-440]
 gi|145306153|gb|ABP56735.1| GTP cyclohydrolase [Salinispora tropica CNB-440]
          Length = 219

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 114/171 (66%), Gaps = 6/171 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R IL  +G+DPDR+GL+ TP RV ++Y EL AG +  P    T+ F  G    + +
Sbjct: 39  EKAVREILIAVGEDPDRDGLQQTPARVARAYAELLAGLRVDPAQVLTTTFEAG----HDE 94

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERLT 139
           +VL++DI   S CEHH+LP  G  H+ YIP  +  + GLSKL R++EV++RR Q+QERLT
Sbjct: 95  LVLVRDIDVMSLCEHHLLPFRGSAHIGYIPGANGRITGLSKLARLVEVFARRPQVQERLT 154

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +Q+A  + +    +GV V++E +HMCM+MRGI++ G  T+T+A  G    D
Sbjct: 155 VQVADLLMAQLQPRGVIVVLECEHMCMAMRGIQKSGACTITSAVRGSLQED 205


>gi|83766637|dbj|BAE56777.1| unnamed protein product [Aspergillus oryzae]
          Length = 237

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 118/187 (63%), Gaps = 14/187 (7%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS----KY 79
           +IR IL  IG+DP+R+GL  TP+R  K+      GY++       S +  G+ +     +
Sbjct: 58  SIRSILEDIGEDPNRDGLLKTPERYAKALLFFTKGYEE-------SAYDIGKDAIFNINH 110

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            ++VL++DI  FS CEHH++P  GK+H+AYIP   V+GLSKL RI E+Y+RRLQ+QERLT
Sbjct: 111 NEIVLVRDIEVFSMCEHHLIPFVGKVHIAYIPNGRVLGLSKLARIAEIYARRLQVQERLT 170

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD---F 196
            QI+ AIE     +GVAV++E  HMCM MRG+++    T T+  TG F  DK   +   F
Sbjct: 171 KQISQAIEELLQPQGVAVVMESAHMCMVMRGVQKSSAMTTTSCRTGVFKTDKEAEEELHF 230

Query: 197 FLKMTHN 203
            LK+  +
Sbjct: 231 LLKLNQD 237


>gi|330996633|ref|ZP_08320511.1| GTP cyclohydrolase I [Paraprevotella xylaniphila YIT 11841]
 gi|329572705|gb|EGG54338.1| GTP cyclohydrolase I [Paraprevotella xylaniphila YIT 11841]
          Length = 195

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/203 (39%), Positives = 131/203 (64%), Gaps = 13/203 (6%)

Query: 1   MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYK 60
           M+C    V+N  +++    E +   + +L  +G+D +REGL+ TP RV K+ + L  GY 
Sbjct: 1   MEC---QVYNETVQR----ELETHYKAVLALLGEDTEREGLQKTPYRVAKAMQTLTRGYA 53

Query: 61  QIP-TTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLS 119
           + P    ++++F       Y+ MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLS
Sbjct: 54  EDPKEILNSAKF----KEDYRHMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLS 109

Query: 120 KLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTV 179
           K+ R+++ +S RLQ+QER+T+QI   I+ + +  GV V++E +HMCM MRG+++    T 
Sbjct: 110 KIARVVDSFSHRLQVQERMTLQIRDCIQEALNPLGVMVVVEARHMCMQMRGVEKQNSVTT 169

Query: 180 TTAFTGEFSRDKGKTDFFLKMTH 202
           T+ FTG F++ K + + FL + H
Sbjct: 170 TSDFTGAFNQAKTREE-FLNLIH 191


>gi|331016930|gb|EGH96986.1| GTP cyclohydrolase I [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 181

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 109/173 (63%), Gaps = 3/173 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+D  REGL DTP R  K+ + L  GY Q             +AS   +MV++KD
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTNGALFSSDAS---EMVMVKD 66

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA AI+
Sbjct: 67  IELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAIQ 126

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
             T ++GVAV+IE +HMCM MRG+++     +T+   GEF  +      FL +
Sbjct: 127 QVTGAQGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSL 179


>gi|314961369|gb|EFT05470.1| GTP cyclohydrolase I [Propionibacterium acnes HL002PA2]
          Length = 191

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 111/169 (65%), Gaps = 6/169 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A  AIR  L  +G+DPDREGL+DTP RV ++ +ELF G  Q P     + F       
Sbjct: 8   ERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTFDI----S 63

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           + +MVL++DI   S CEHH+LP  G  H+ YIP +   V GLSK+ R++E+Y+RR Q+QE
Sbjct: 64  HDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEIYARRPQVQE 123

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           RLT Q+A A+    D++GV V++E +HMCM+ RG+++ G  TVT+A  G
Sbjct: 124 RLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRG 172


>gi|294674531|ref|YP_003575147.1| GTP cyclohydrolase I [Prevotella ruminicola 23]
 gi|294472454|gb|ADE81843.1| GTP cyclohydrolase I [Prevotella ruminicola 23]
          Length = 201

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 120/190 (63%), Gaps = 8/190 (4%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +EE  +    IL  +G+DP REGL+ TP RV K+ + L  GY     T D  +       
Sbjct: 17  IEELADHYEKILGLLGEDPTREGLEKTPMRVAKAMQVLTKGY-----TMDAHKILTDALF 71

Query: 78  K--YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQ 135
           K  Y  MV++KDI FFS CEHH+LP +GK H+AYIP  ++ GLSK+ R++++++ RLQ+Q
Sbjct: 72  KEDYNQMVIVKDIDFFSLCEHHMLPFYGKAHVAYIPNGYITGLSKIARVVDIFAHRLQVQ 131

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           ER+T QI   IE +    GV V+IE +HMCM MRG+++    T T+ F+G F++ K + +
Sbjct: 132 ERMTQQIKDCIEQTLHPLGVMVVIEAKHMCMQMRGVEKQNSITTTSDFSGAFNQAKTRQE 191

Query: 196 FFLKMTHNQR 205
            F+ + HN +
Sbjct: 192 -FMNLIHNNQ 200


>gi|23005668|ref|ZP_00048370.1| COG0302: GTP cyclohydrolase I [Magnetospirillum magnetotacticum
           MS-1]
          Length = 233

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 115/171 (67%), Gaps = 6/171 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           + A+ A+R +L  +G+DPDREGL++TP RV ++Y+E+FAG +Q      T+ F  G    
Sbjct: 35  DRAEAAVRELLLAVGEDPDREGLRETPARVARAYREIFAGLRQEAADVLTTTFDLG---- 90

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPK--KHVIGLSKLVRILEVYSRRLQIQE 136
           +++MVL+KDI  +S CEHH++P  G  H+ YIP     + GLSKL R++EVY+RR Q+QE
Sbjct: 91  HEEMVLVKDIEVYSTCEHHLVPFHGVAHVGYIPNVDGRITGLSKLARLVEVYARRPQVQE 150

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           RLT Q+A A+      +G  V++E +H+CMSMRG+++ G   V +A  G+ 
Sbjct: 151 RLTSQVADALVEHLKPRGAIVVVECEHLCMSMRGVRKPGARNVPSAVRGQM 201


>gi|152989913|ref|YP_001355635.1| GTP cyclohydrolase I [Nitratiruptor sp. SB155-2]
 gi|151421774|dbj|BAF69278.1| GTP cyclohydrolase I [Nitratiruptor sp. SB155-2]
          Length = 192

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 121/182 (66%), Gaps = 10/182 (5%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA--- 76
           E +  ++ IL+ +G+DP REGL  TP RV K++  L  GY + P          GEA   
Sbjct: 6   EFENHVKAILQLLGEDPQREGLIKTPQRVYKAFLHLTEGYHKDPKEV------LGEALFE 59

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
           S   +MVL++DI F+S CEHH+LPI G+ H+AYIP   V+GLSK+ R++ V++RRLQIQE
Sbjct: 60  SSNDEMVLVRDIEFYSLCEHHLLPIIGRAHVAYIPNGKVVGLSKIPRMVNVFARRLQIQE 119

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTD 195
           ++T QIA A+  + + KGV V+++ +HMCM MRG+++   TTV++A  G F +  K + +
Sbjct: 120 QMTEQIADALMQTIEPKGVGVVLQARHMCMEMRGVEKICSTTVSSALRGIFKTNQKTREE 179

Query: 196 FF 197
           FF
Sbjct: 180 FF 181


>gi|315125184|ref|YP_004067187.1| GTP cyclohydrolase I [Pseudoalteromonas sp. SM9913]
 gi|315013697|gb|ADT67035.1| GTP cyclohydrolase I [Pseudoalteromonas sp. SM9913]
          Length = 184

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 117/181 (64%), Gaps = 3/181 (1%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKY 79
           E KE+ + I+  +G+D +REGL DTP R  K+ + L  GY+Q    + T+   F   S  
Sbjct: 4   ELKESYQKIITAVGEDAEREGLLDTPKRAAKAMEYLTQGYRQ-TLNEITNNAVF--TSDA 60

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            DMVLI+DI  +S CEHH+LP  G+ H+AYIP   V+GLSK  RI++++SRR QIQE+LT
Sbjct: 61  DDMVLIQDIELYSMCEHHLLPFIGRCHIAYIPDGKVLGLSKFARIVDMFSRRFQIQEQLT 120

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA A+E  T +KGV V++E +HMCM MRG+++   +  T+   G F  D    + FL+
Sbjct: 121 HQIAKAVEEVTGAKGVGVIVEAKHMCMMMRGVEKQNSSMRTSVMLGNFRADPKTRNEFLQ 180

Query: 200 M 200
           +
Sbjct: 181 L 181


>gi|300934620|ref|ZP_07149876.1| GTP cyclohydrolase I [Corynebacterium resistens DSM 45100]
          Length = 207

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 119/177 (67%), Gaps = 8/177 (4%)

Query: 15  KPTV--EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           KPT   E A+ A+R +L  +G++PDREGLKDTP RV ++Y+E+FAG    PT      F+
Sbjct: 17  KPTFDRERAEAAVRELLFAVGENPDREGLKDTPARVARAYEEIFAGLYTDPTEVLDKTFN 76

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIP--KKHVIGLSKLVRILEVYSR 130
                 ++++VL++DI F+S CEHH++P +G  H+ YIP     V GLSKL R+++  ++
Sbjct: 77  ----EDHRELVLVRDIPFYSTCEHHLVPFFGHAHIGYIPGTSGKVTGLSKLARLIDGLAK 132

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           R Q+QERLT Q+A A+    ++  V V+IE +H+CM+MRGI++ G  TVT+A  G F
Sbjct: 133 RPQVQERLTSQVADALVERLEASAVIVVIEAEHLCMAMRGIRKPGANTVTSAVRGGF 189


>gi|297563886|ref|YP_003682859.1| GTP cyclohydrolase I [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
 gi|296848335|gb|ADH70353.1| GTP cyclohydrolase I [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 199

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 125/186 (67%), Gaps = 10/186 (5%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFH 72
           + +P +E A   +R IL  IG+DPDR+GL  TP+RV ++Y+E FAG  Q P    T+ F 
Sbjct: 12  VDRPRIERA---VREILLAIGEDPDRDGLVKTPERVARAYEEQFAGLGQKPGDVLTTVFE 68

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSR 130
               + +++MVL+KDI  +S CEHH++P +G  H+ YIP     + GLSKL R+++VY+R
Sbjct: 69  ----ADHEEMVLVKDIELYSTCEHHLVPFYGVAHVGYIPGADGRITGLSKLARLVDVYAR 124

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SR 189
           R Q+QERLT Q++ AI      +GV V++E +H+CM+MRG+++ G  TVT+A  G F S 
Sbjct: 125 RPQVQERLTGQVSDAIMEFLQPRGVIVVVEAEHLCMTMRGVRKPGAKTVTSAVRGIFRSS 184

Query: 190 DKGKTD 195
           D+ +++
Sbjct: 185 DRTRSE 190


>gi|213967487|ref|ZP_03395635.1| GTP cyclohydrolase I [Pseudomonas syringae pv. tomato T1]
 gi|213927788|gb|EEB61335.1| GTP cyclohydrolase I [Pseudomonas syringae pv. tomato T1]
          Length = 202

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 117/192 (60%), Gaps = 7/192 (3%)

Query: 13  LKKPTVEEA----KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT 68
           L KPT + +    ++    IL  +G+D  REGL DTP R  K+ + L  GY Q       
Sbjct: 12  LSKPTRKHSPVTLEQNYTAILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTN 71

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
                 +AS   +MV++KDI  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y
Sbjct: 72  GALFSSDAS---EMVMVKDIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMY 128

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           +RRLQIQE L+ QIA AI+  T ++GVAV+IE +HMCM MRG+++     +T+   GEF 
Sbjct: 129 ARRLQIQENLSRQIAEAIQQVTGAQGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFR 188

Query: 189 RDKGKTDFFLKM 200
            +      FL +
Sbjct: 189 ENAATRSEFLSL 200


>gi|258647254|ref|ZP_05734723.1| GTP cyclohydrolase I [Prevotella tannerae ATCC 51259]
 gi|260852901|gb|EEX72770.1| GTP cyclohydrolase I [Prevotella tannerae ATCC 51259]
          Length = 190

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 120/178 (67%), Gaps = 11/178 (6%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK--Y 79
           KEA+ V+    G+D +REGL  TP+RV K+  +L  GY     T D ++       K  Y
Sbjct: 15  KEALTVL----GEDTEREGLLKTPERVAKAMLDLTRGY-----TMDAAKVLTSAKFKEDY 65

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
           + MV++KDI+F+S CEHH+LP +GK H+AYIP  ++ GLSKL R+++++S RLQ+QER+T
Sbjct: 66  RHMVIVKDINFYSLCEHHLLPFYGKAHIAYIPNGYITGLSKLARVVDIFSHRLQVQERMT 125

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           +QI   IE + +  GV V++E +HMCM MRGI+++   T T+ F+G F++ K + +F 
Sbjct: 126 LQIKECIEQALNPLGVMVVLEAKHMCMQMRGIEKENSITTTSDFSGAFTQAKTREEFL 183


>gi|319954973|ref|YP_004166240.1| gtp cyclohydrolase 1 [Cellulophaga algicola DSM 14237]
 gi|319423633|gb|ADV50742.1| GTP cyclohydrolase 1 [Cellulophaga algicola DSM 14237]
          Length = 199

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 113/179 (63%), Gaps = 3/179 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           ++ +   + I+  +G+D  REGL  TP+R  K+   L  GY+Q P         F E   
Sbjct: 16  DDVRSNYKTIIEGVGEDITREGLVKTPERAAKAMLYLTQGYQQDPVAILKGAM-FKE--D 72

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y DMV+IKDI  +S CEHH+LP +GK H+AYIP  H++GLSK+ R+++V+SRRLQ+QERL
Sbjct: 73  YDDMVIIKDIELYSLCEHHMLPFFGKAHIAYIPNGHIVGLSKIPRVVDVFSRRLQVQERL 132

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           T  I   +  +   KGVAV+IE  HMCM MRG+++    T T+ F G+F + + + +F 
Sbjct: 133 THDILECLNDTLKPKGVAVVIEASHMCMMMRGVQKQNSVTTTSGFRGQFEKQETRNEFL 191


>gi|238497938|ref|XP_002380204.1| GTP cyclohydrolase I, putative [Aspergillus flavus NRRL3357]
 gi|220693478|gb|EED49823.1| GTP cyclohydrolase I, putative [Aspergillus flavus NRRL3357]
          Length = 224

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 118/187 (63%), Gaps = 14/187 (7%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS----KY 79
           +IR IL  IG+DP+R+GL  TP+R  K+      GY++       S +  G+ +     +
Sbjct: 45  SIRSILEDIGEDPNRDGLLKTPERYAKALLFFTKGYEE-------SAYDIGKDAIFNINH 97

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            ++VL++DI  FS CEHH++P  GK+H+AYIP   V+GLSKL RI E+Y+RRLQ+QERLT
Sbjct: 98  NEIVLVRDIEVFSMCEHHLIPFVGKVHIAYIPNGRVLGLSKLARIAEIYARRLQVQERLT 157

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD---F 196
            QI+ AIE     +GVAV++E  HMCM MRG+++    T T+  TG F  DK   +   F
Sbjct: 158 KQISQAIEELLQPQGVAVVMESAHMCMVMRGVQKSSAMTTTSCRTGVFKTDKEAEEELHF 217

Query: 197 FLKMTHN 203
            LK+  +
Sbjct: 218 LLKLNQD 224


>gi|327440782|dbj|BAK17147.1| GTP cyclohydrolase I [Solibacillus silvestris StLB046]
          Length = 189

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/183 (44%), Positives = 121/183 (66%), Gaps = 8/183 (4%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+++IL  +G+D  REGL DTP RV K Y E+F+G ++ P    ++ FH      +++
Sbjct: 10  EEAVKMILEAVGEDVTREGLLDTPKRVSKMYAEMFSGLQEDPRDYFSTVFH----EDHEE 65

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTM 140
           +VL+KDI FFS CEHH++P +G  H+AYIPK   V GLSKL R LE  +RR Q+QER+T 
Sbjct: 66  LVLVKDIPFFSMCEHHLVPFYGTAHIAYIPKDGKVAGLSKLGRCLESVARRPQLQERITS 125

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD---KGKTDFF 197
            +A  I    + KGV V++E +HMCM+MRG+K+ G  TVT    G + +D   + + + F
Sbjct: 126 TVADTIMEMLNPKGVYVVVEAEHMCMTMRGLKKPGAKTVTAVARGIYEQDAVKRNEVNTF 185

Query: 198 LKM 200
           ++M
Sbjct: 186 IQM 188


>gi|332535348|ref|ZP_08411144.1| GTP cyclohydrolase I type 1 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332035221|gb|EGI71729.1| GTP cyclohydrolase I type 1 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 184

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/181 (44%), Positives = 117/181 (64%), Gaps = 3/181 (1%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKY 79
           E KE+   I+  +G+D +REGL DTP R  K+ + L  GY+Q    + T++  F   S  
Sbjct: 4   ELKESYEKIITAVGEDANREGLLDTPKRAAKAMEYLTQGYRQ-TLDEITNKAVF--TSDA 60

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            DMVL++DI  +S CEHH+LP  G+ H+AYIP   V+GLSK  RI++++SRR QIQE+LT
Sbjct: 61  DDMVLVQDIELYSMCEHHLLPFIGRCHIAYIPNGKVLGLSKFARIVDMFSRRFQIQEQLT 120

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA A+E  T +KGV V++E +HMCM MRG+++   +  T+   G F  D    + FL+
Sbjct: 121 HQIAKAVEEVTGAKGVGVIVEAKHMCMMMRGVEKQNSSMRTSVMLGNFRSDPKTRNEFLQ 180

Query: 200 M 200
           +
Sbjct: 181 L 181


>gi|269796483|ref|YP_003315938.1| GTP cyclohydrolase I [Sanguibacter keddieii DSM 10542]
 gi|269098668|gb|ACZ23104.1| GTP cyclohydrolase I [Sanguibacter keddieii DSM 10542]
          Length = 219

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 114/169 (67%), Gaps = 6/169 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A  A+R +L  +G+DPDREGL DTP RV ++Y E FAG +Q P     + F  G    ++
Sbjct: 39  AAAAVRELLIAVGEDPDREGLVDTPARVARAYAETFAGLRQDPADVLNAVFDIG----HE 94

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           +M+L++DI  +S CEHH++P  G  H+ YIP +   V GLSKL R+++VY++R Q+QERL
Sbjct: 95  EMILVRDIELYSTCEHHLVPFHGVAHVGYIPGEDGRVTGLSKLARLVDVYAKRPQVQERL 154

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           T Q+A A+      +GV V+IE +H+CMSMRG+++ G  T+T+A  G+ 
Sbjct: 155 TAQVADALVEHLSPRGVIVVIECEHLCMSMRGVRKPGSRTLTSAVRGQM 203


>gi|304405249|ref|ZP_07386909.1| GTP cyclohydrolase I [Paenibacillus curdlanolyticus YK9]
 gi|304346128|gb|EFM11962.1| GTP cyclohydrolase I [Paenibacillus curdlanolyticus YK9]
          Length = 196

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 119/185 (64%), Gaps = 4/185 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ +  IR ILR IG+D DREGL +TP RV + Y+E+F+GY  +    +     F E   
Sbjct: 16  EQIEAHIRSILRLIGEDADREGLLETPARVARMYEEIFSGY--VADYHEVLGVLFDE--N 71

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           ++++V++KDI +FS CEHH++P  GK+H+ Y+P   V GLSK  R++E  S++LQ+QER+
Sbjct: 72  HEELVIVKDIDYFSQCEHHMVPFMGKVHIGYVPSGKVAGLSKFARLVEAVSKKLQLQERM 131

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T +I+  I      KGV V++ GQH+CM  RG+K+ G  TVT+A  GEF  +    + F+
Sbjct: 132 TTEISGVIMDVLAPKGVMVVVTGQHLCMCGRGVKKSGAVTVTSATRGEFRHNYALRNEFM 191

Query: 199 KMTHN 203
            +  +
Sbjct: 192 ALIQS 196


>gi|281356286|ref|ZP_06242778.1| GTP cyclohydrolase I [Victivallis vadensis ATCC BAA-548]
 gi|281316978|gb|EFB01000.1| GTP cyclohydrolase I [Victivallis vadensis ATCC BAA-548]
          Length = 179

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 120/179 (67%), Gaps = 3/179 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++ IR IL  IG+DP+REGL DTP RV KS K L  GY+Q  T ++       EA    D
Sbjct: 2   QQQIRDILVEIGEDPEREGLLDTPKRVEKSLKFLTRGYRQ--TLEEVVNGALFEAES-DD 58

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+++DI FFS CEHH+LP +GK H+ YIPK  ++G+SK+ RI+++++RRLQIQERLT Q
Sbjct: 59  MVIVRDIEFFSMCEHHMLPFFGKCHVGYIPKGKILGVSKVARIVDMFARRLQIQERLTRQ 118

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           I+ A+     ++GV V++E +H+CM MRG+++      T++  G F R+    + F ++
Sbjct: 119 ISGALMEILGAEGVGVVMEARHLCMQMRGVEKQHSVMTTSSMVGSFRRELATRNEFTRL 177


>gi|295134390|ref|YP_003585066.1| GTP cyclohydrolase I [Zunongwangia profunda SM-A87]
 gi|294982405|gb|ADF52870.1| GTP cyclohydrolase I [Zunongwangia profunda SM-A87]
          Length = 198

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 118/176 (67%), Gaps = 3/176 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           K+  + I+  +G++PDREG+  TP+R  K+ + L  GY ++   +   +  F E   Y +
Sbjct: 18  KDNYKKIITELGENPDREGVLKTPERAAKAMQFLTQGY-ELDAEKILKKAMFKE--DYDE 74

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV++K+I  +S CEHH+LP +GK H+AYIP  H++GLSKL R+++V++RRLQ+QERLT  
Sbjct: 75  MVVVKNIELYSLCEHHMLPFFGKAHIAYIPNGHIVGLSKLPRVVDVFARRLQVQERLTHD 134

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           I   +  +   +GVAV+IE QHMCM MRG+++   TT T+ F G+F + + + +F 
Sbjct: 135 ILECLNKTLQPQGVAVVIEAQHMCMMMRGVQKQNSTTTTSGFRGQFEKIETRNEFL 190


>gi|251794843|ref|YP_003009574.1| GTP cyclohydrolase I [Paenibacillus sp. JDR-2]
 gi|247542469|gb|ACS99487.1| GTP cyclohydrolase I [Paenibacillus sp. JDR-2]
          Length = 196

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 119/173 (68%), Gaps = 4/173 (2%)

Query: 25  IRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVL 84
           I+ IL+ +G+D +REGL +TP RV + Y+E+FAGY+  P  ++     F E  +++++V+
Sbjct: 23  IKEILKLVGEDVEREGLLETPARVTRMYEEIFAGYEVDP--REVLGVTFDE--RHEELVI 78

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +KDI ++S CEHH+ P +GK H+ YIP   + GLSKL R++E  SRRLQ+QER+T QIA 
Sbjct: 79  VKDIVYYSQCEHHMAPFFGKAHIGYIPSGKIAGLSKLARLVEAVSRRLQVQERITTQIAD 138

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
            ++     +GV V++EG+H+CM  RG+K+ G  TVT+A  G FS    +++F 
Sbjct: 139 IMQEVLKPQGVMVVVEGEHLCMCARGVKKPGSKTVTSAVRGVFSDSALRSEFL 191


>gi|302870327|ref|YP_003838964.1| GTP cyclohydrolase I [Micromonospora aurantiaca ATCC 27029]
 gi|315503396|ref|YP_004082283.1| gtp cyclohydrolase i [Micromonospora sp. L5]
 gi|302573186|gb|ADL49388.1| GTP cyclohydrolase I [Micromonospora aurantiaca ATCC 27029]
 gi|315410015|gb|ADU08132.1| GTP cyclohydrolase I [Micromonospora sp. L5]
          Length = 205

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 114/171 (66%), Gaps = 6/171 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+R IL  +G+DPDR+GL+ TP RV ++Y ELFAG +  P     + F     + +++
Sbjct: 25  EKAVREILIAVGEDPDRDGLQQTPARVARAYAELFAGLRVDPAQVLRTTFE----ANHEE 80

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERLT 139
           +VL++DI   S CEHH+LP  G  H+ YIP     + GLSKL R++EV++RR Q+QERLT
Sbjct: 81  LVLVRDIDVMSLCEHHLLPFRGSAHIGYIPGPDGRITGLSKLARLVEVFARRPQVQERLT 140

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            QIA  + SS   +GV V++E +HMCM+MRGI++ G  T+T+A  G    D
Sbjct: 141 SQIADLLMSSLAPRGVIVVLECEHMCMAMRGIQKSGAKTITSAVRGGLQND 191


>gi|307544763|ref|YP_003897242.1| GTP cyclohydrolase I [Halomonas elongata DSM 2581]
 gi|307216787|emb|CBV42057.1| GTP cyclohydrolase I [Halomonas elongata DSM 2581]
          Length = 185

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 118/185 (63%), Gaps = 5/185 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEAS 77
           E+  +  R I++ IG+DPDREGL+DTP R  K+ + L  GY Q +    + + F     S
Sbjct: 3   EQLADHYRQIIQEIGEDPDREGLRDTPKRAAKAMQFLNRGYFQSLEEIVNGAVFE----S 58

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
              +MVLIKDI  +S CEHH+LP  GK H+AY+P   V+GLSK  RI+++Y+RR+QIQE 
Sbjct: 59  DTDEMVLIKDIELYSICEHHLLPFTGKCHIAYMPSGKVLGLSKFARIVDMYARRMQIQEN 118

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QIA A++  T+++GVAV+IE +H+CM MRG+++   +  ++   G F   +     F
Sbjct: 119 LTRQIAEAVQQVTNARGVAVVIEARHLCMMMRGVEKQNSSMTSSVMLGAFRESQSTRQEF 178

Query: 198 LKMTH 202
           L +  
Sbjct: 179 LTLVQ 183


>gi|317141671|ref|XP_001818779.2| GTP cyclohydrolase 1 [Aspergillus oryzae RIB40]
          Length = 191

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 118/187 (63%), Gaps = 14/187 (7%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS----KY 79
           +IR IL  IG+DP+R+GL  TP+R  K+      GY++       S +  G+ +     +
Sbjct: 12  SIRSILEDIGEDPNRDGLLKTPERYAKALLFFTKGYEE-------SAYDIGKDAIFNINH 64

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            ++VL++DI  FS CEHH++P  GK+H+AYIP   V+GLSKL RI E+Y+RRLQ+QERLT
Sbjct: 65  NEIVLVRDIEVFSMCEHHLIPFVGKVHIAYIPNGRVLGLSKLARIAEIYARRLQVQERLT 124

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD---F 196
            QI+ AIE     +GVAV++E  HMCM MRG+++    T T+  TG F  DK   +   F
Sbjct: 125 KQISQAIEELLQPQGVAVVMESAHMCMVMRGVQKSSAMTTTSCRTGVFKTDKEAEEELHF 184

Query: 197 FLKMTHN 203
            LK+  +
Sbjct: 185 LLKLNQD 191


>gi|262369499|ref|ZP_06062827.1| GTP cyclohydrolase I [Acinetobacter johnsonii SH046]
 gi|262315567|gb|EEY96606.1| GTP cyclohydrolase I [Acinetobacter johnsonii SH046]
          Length = 184

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 115/173 (66%), Gaps = 5/173 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D  R GL DTP R  K++  L +GY K +    + + F     S  ++MVL+K
Sbjct: 10  ILTAVGEDLTRPGLLDTPMRAAKAFSYLTSGYSKSLEEVTNNAVF----PSDNREMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I F+S CEHH+LP +G++H+AY+P+ +V+GLSK  RI E+++RRLQIQE LT QIA A+
Sbjct: 66  NIEFYSLCEHHLLPFYGRVHIAYLPEGNVLGLSKFARITEMFARRLQIQENLTQQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
              T ++GVAV+I+  HMCM MRG+ +   TT T +F G+F  +K +   FL 
Sbjct: 126 AEVTGARGVAVMIDSAHMCMMMRGVGKQESTTRTVSFIGDFKTNKEERREFLS 178


>gi|223040080|ref|ZP_03610361.1| GTP cyclohydrolase I [Campylobacter rectus RM3267]
 gi|222878666|gb|EEF13766.1| GTP cyclohydrolase I [Campylobacter rectus RM3267]
          Length = 200

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 125/190 (65%), Gaps = 6/190 (3%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDT 68
           N+K +    E+ +  +  +L  +G+DP REGL  TP+RV K+++ L +GY Q P    + 
Sbjct: 4   NLKNEDLKKEKFESCVEQMLSLVGEDPRREGLAKTPERVFKAFEFLTSGYWQDPKVVLND 63

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
           + F     S   +MVL++DI F+S CEHH+LP +G++H+AYIP   V+GLSK+ R++ ++
Sbjct: 64  ALFD----SSNNEMVLVRDIEFYSLCEHHLLPFFGRVHVAYIPNHKVVGLSKIPRMVNIF 119

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           +RRLQIQE+LT QIA A++     KGV V+IE +HMC+ MRG+ +   TT T+A  G F 
Sbjct: 120 ARRLQIQEQLTEQIAEAVQDVIKPKGVGVVIEARHMCVEMRGVGKINSTTTTSALRGCFL 179

Query: 189 R-DKGKTDFF 197
           +  + + +FF
Sbjct: 180 KSSETRREFF 189


>gi|34557591|ref|NP_907406.1| GTP cyclohydrolase I [Wolinella succinogenes DSM 1740]
 gi|41017094|sp|Q7M933|GCH1_WOLSU RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|34483308|emb|CAE10306.1| GTP CYCLOHYDROLASE I [Wolinella succinogenes]
          Length = 187

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/177 (45%), Positives = 115/177 (64%), Gaps = 3/177 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E IR I  +IGDD  REGL DTP RV+KS+ +L++GY Q P     + F  G      +
Sbjct: 9   EETIRSIFDFIGDDRHREGLLDTPKRVVKSWDKLYSGYTQDPREILGTVFEDGACD---E 65

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV++K+I F+S CEHH+LP +GK+ + YIP + V+G+SKL R++EV++RRLQIQE++T Q
Sbjct: 66  MVVLKNIEFYSMCEHHMLPFFGKVSIGYIPDQKVVGISKLARLVEVFARRLQIQEKMTGQ 125

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           IA  +      KG  V+ E  HMCM MRG+++     VT+A  G F RD    + F+
Sbjct: 126 IADTLMEVLQPKGAMVVAEATHMCMVMRGVEKQQSVMVTSAVRGLFKRDARTREEFM 182


>gi|257460307|ref|ZP_05625410.1| GTP cyclohydrolase I [Campylobacter gracilis RM3268]
 gi|257442372|gb|EEV17512.1| GTP cyclohydrolase I [Campylobacter gracilis RM3268]
          Length = 194

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 117/172 (68%), Gaps = 6/172 (3%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIP-TTQDTSRFHFGEASKYQDMVLIK 86
           +L  +G+DP R+GL  TP RV K+Y+ L +GY+  P    + + F     S   +MVLIK
Sbjct: 16  MLEILGEDPKRDGLAKTPGRVAKAYEFLTSGYELDPKEILNDALFE----SSNNEMVLIK 71

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI F+S CEHH+LPI G+ H+AYIP K V+GLSK+ R++ +++RRLQIQE+LT QIA AI
Sbjct: 72  DIEFYSLCEHHLLPIIGRAHVAYIPNKKVVGLSKIPRMVNIFARRLQIQEQLTEQIASAI 131

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTDFF 197
           +      GV V+++ +HMCM MRG+++   TT T+A  G F SR+  + +FF
Sbjct: 132 QEVIHPLGVGVVLQARHMCMEMRGVQKINSTTTTSALRGLFISRNDTRKEFF 183


>gi|156044843|ref|XP_001588977.1| GTP cyclohydrolase [Sclerotinia sclerotiorum 1980]
 gi|154694005|gb|EDN93743.1| GTP cyclohydrolase [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 303

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/184 (44%), Positives = 122/184 (66%), Gaps = 6/184 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDM 82
           A+R IL  IG+DPDREGL  TP+R  K+   L  GY++ +    + + FH      + ++
Sbjct: 124 AVRTILECIGEDPDREGLLATPERYAKAMLYLTKGYQENVRDIVNDAIFH----EDHNEL 179

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           V++KDI  FS CEHH++P  GK+H+ YIP ++VIG+SKL RI +++SRRLQIQERLT  +
Sbjct: 180 VIVKDIEVFSMCEHHMVPFTGKMHIGYIPDRNVIGISKLPRIADMFSRRLQIQERLTKDV 239

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS-RDKGKTDFFLKMT 201
           AHA+      +GVAV++E  H+CM MRG+++   TT+T+   G    R+K + +FF  + 
Sbjct: 240 AHAVMEILKPQGVAVVMESSHLCMVMRGVEKTSATTITSCVLGCIEKREKTRNEFFSLVG 299

Query: 202 HNQR 205
            N+R
Sbjct: 300 LNRR 303


>gi|87199252|ref|YP_496509.1| GTP cyclohydrolase [Novosphingobium aromaticivorans DSM 12444]
 gi|87134933|gb|ABD25675.1| GTP cyclohydrolase I [Novosphingobium aromaticivorans DSM 12444]
          Length = 211

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 113/171 (66%), Gaps = 2/171 (1%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKY 79
           + +EAIR ++RW GD P+REGL DTP RV ++++E  +GY Q P    +  F   E   Y
Sbjct: 29  DVEEAIRTLIRWSGDQPEREGLLDTPKRVARAWREYCSGYAQDPGLHLSRTFE--EVGGY 86

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            ++VL++DI F S+CEHH+ PI G   +AY+P+  V+G+SKL R+L  +++RLQ+QERLT
Sbjct: 87  DEVVLLRDIPFQSHCEHHMAPITGTASIAYLPRDRVVGISKLARVLHGFAQRLQVQERLT 146

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            ++A  I  +    GVAV+IE QH CM+ RG++  G+  VT+   G F  D
Sbjct: 147 AEVAQCIWDNLKPHGVAVVIEAQHGCMTGRGVRTHGVGMVTSRMLGCFLDD 197


>gi|312194200|ref|YP_004014261.1| GTP cyclohydrolase I [Frankia sp. EuI1c]
 gi|311225536|gb|ADP78391.1| GTP cyclohydrolase I [Frankia sp. EuI1c]
          Length = 234

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/166 (46%), Positives = 114/166 (68%), Gaps = 6/166 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R +L  IG+DPDREGL+ TPDRV ++Y E   G  + P    T+ F  G    + +MV
Sbjct: 54  AVRELLIGIGEDPDREGLRKTPDRVARAYAEAVEGLGRDPADVLTTVFDEG----HDEMV 109

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERLTMQ 141
           L++DI F S CEHH++   GK H+AYIP ++  + GLSKL R++++Y+RR Q+QERLT Q
Sbjct: 110 LVRDIDFSSLCEHHLVVFSGKAHVAYIPNENGQITGLSKLARLVDLYARRPQVQERLTSQ 169

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           +A A+      +GV V++E +H+CMSMRG+++ G  TVT+A  G+F
Sbjct: 170 VADALVDVLQPRGVMVVVEAEHLCMSMRGVRKPGACTVTSAVRGQF 215


>gi|224283826|ref|ZP_03647148.1| GTP cyclohydrolase I [Bifidobacterium bifidum NCIMB 41171]
 gi|310287908|ref|YP_003939166.1| GTP cyclohydrolase I [Bifidobacterium bifidum S17]
 gi|311064789|ref|YP_003971514.1| GTP cyclohydrolase I [Bifidobacterium bifidum PRL2010]
 gi|309251844|gb|ADO53592.1| GTP cyclohydrolase I [Bifidobacterium bifidum S17]
 gi|310867108|gb|ADP36477.1| FolE GTP cyclohydrolase I [Bifidobacterium bifidum PRL2010]
          Length = 188

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 114/168 (67%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  ++A+R+ L  IG++PDREGL +TPDR+ ++ +E+F+G  + P    + RF      +
Sbjct: 6   EGVRKAVRLFLTSIGENPDREGLLETPDRIARACEEIFSGLGRSPQEVLSKRFPV----E 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
             +MVL++DI  FS CEHH+LP  G  H+ YIP    V+GLSKL R++E+Y+RR Q+QER
Sbjct: 62  TDEMVLVRDIELFSVCEHHLLPFHGVAHVGYIPSNGQVVGLSKLARLVELYARRPQVQER 121

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           +T Q+A A+    D+KGV V+ E +HMCM+MRG+ +    T+T+A  G
Sbjct: 122 ITQQVADALMEYADAKGVIVVTECEHMCMAMRGVNKPASRTITSAVRG 169


>gi|325067916|ref|ZP_08126589.1| GTP cyclohydrolase I [Actinomyces oris K20]
          Length = 190

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 114/169 (67%), Gaps = 6/169 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  + A+R +L  IG+DP+R+GL+DTP+R+ ++Y E+FAG  Q P       F  G    
Sbjct: 6   EGVRRAVRDLLVAIGEDPERDGLRDTPERMARAYAEMFAGLDQDPAEHVERVFDVG---- 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +++MVL++DI  +S CEHH+LP  G  H+ YIP +   V GLSK+ R+++ Y+RR Q+QE
Sbjct: 62  HKEMVLVRDIPMYSVCEHHLLPFHGLAHVGYIPSEDGRVTGLSKVARLVDGYARRPQVQE 121

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           RLT QIA A+      +GV V++E +H+CMSMRG+++ G  TVT+A  G
Sbjct: 122 RLTRQIADALVERLQCRGVLVVVEAEHLCMSMRGVRKPGSNTVTSAVRG 170


>gi|296128489|ref|YP_003635739.1| GTP cyclohydrolase I [Cellulomonas flavigena DSM 20109]
 gi|296020304|gb|ADG73540.1| GTP cyclohydrolase I [Cellulomonas flavigena DSM 20109]
          Length = 216

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 115/171 (67%), Gaps = 6/171 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A  A+R +L  +G+DPDREGL++TP RV ++Y+E+FAG         T+ F  G    
Sbjct: 34  ERAARAVRELLLAVGEDPDREGLQETPARVARAYREIFAGLTMDARDVLTTTFDLG---- 89

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +++MV+++DI  +S CEHH++P  G  H+ YIP     + GLSKL R+++VY+RR Q+QE
Sbjct: 90  HEEMVIVRDIEVYSTCEHHLVPFHGVAHVGYIPGADGRITGLSKLARLVDVYARRPQVQE 149

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           RLT Q+A A+    D  GV V++E +H+CMSMRG+++ G  TVT+A  G+ 
Sbjct: 150 RLTSQVADALVEVLDPTGVLVVVECEHLCMSMRGVRKPGSRTVTSAVRGQM 200


>gi|58039971|ref|YP_191935.1| GTP cyclohydrolase I [Gluconobacter oxydans 621H]
 gi|58002385|gb|AAW61279.1| GTP cyclohydrolase I [Gluconobacter oxydans 621H]
          Length = 224

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 114/170 (67%), Gaps = 4/170 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R IL+ +G++P+REGL DTP RV K Y E+F+G  Q P     ++F    A ++   V
Sbjct: 47  AVREILKALGENPEREGLLDTPQRVAKMYLEVFSGLHQDPRDHLKTQF---SADRHHGAV 103

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           ++KDI F S CEHH+LP++GK H+AY+P    + GLSK+ R++E ++RR Q+QERLT QI
Sbjct: 104 IVKDIRFHSMCEHHLLPVYGKAHVAYLPAGGRLTGLSKIARLVEGFARRPQLQERLTDQI 163

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           A  +E     + V V+IE +HMCMSMRG++  G TTVT+   G + RD  
Sbjct: 164 AQGMEDVLAPEAVLVVIEAEHMCMSMRGVRSPGSTTVTSIARGTWLRDSA 213


>gi|292491481|ref|YP_003526920.1| GTP cyclohydrolase I [Nitrosococcus halophilus Nc4]
 gi|291580076|gb|ADE14533.1| GTP cyclohydrolase I [Nitrosococcus halophilus Nc4]
          Length = 213

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/181 (41%), Positives = 122/181 (67%), Gaps = 3/181 (1%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKY 79
           E + +++ IL  +G+DPDREGLK TP RV K+   L +GY    T ++  R    E  + 
Sbjct: 29  EFEASVKKILTRLGEDPDREGLKRTPQRVAKALDFLTSGYNM--TVEEVVRDALFE-DEC 85

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
           ++MV++KD+ F+S CEHH+LP +G+ H+ Y+P+  ++GLSK+ R+++V++RRLQ+QERLT
Sbjct: 86  EEMVIVKDVEFYSLCEHHVLPFFGRAHVGYLPRGRIVGLSKIARVIDVFARRLQVQERLT 145

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA  + S  +++GV V++E  H CM MRG+++    TVT+A  G F +D      F++
Sbjct: 146 TQIATGLMSVLNARGVGVVLEACHFCMVMRGVQKQNSQTVTSAMLGTFRQDPRTRAEFME 205

Query: 200 M 200
           +
Sbjct: 206 L 206


>gi|256827573|ref|YP_003151532.1| GTP cyclohydrolase I [Cryptobacterium curtum DSM 15641]
 gi|256583716|gb|ACU94850.1| GTP cyclohydrolase I [Cryptobacterium curtum DSM 15641]
          Length = 198

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 117/177 (66%), Gaps = 6/177 (3%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +++  + +R+IL  +G+DP+REGL+ TP+RV K Y E FAG    P +   + F      
Sbjct: 14  LDKVAQGVRLILEGVGEDPNREGLRKTPERVAKMYAECFAGLYADPASYFETTFD----E 69

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQ 135
            +++MVL++DI F+S CEHH+ P +G+ H+AY+P +   + G+SKL R+++ ++RR Q+Q
Sbjct: 70  NHEEMVLVRDIPFYSMCEHHLAPFFGRAHVAYVPAEDGRICGISKLARLVDAFARRPQVQ 129

Query: 136 ERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           ERLT QIA  +      +GV V++E +H+CMSMRG+K+ G  T T+A  G F R+  
Sbjct: 130 ERLTSQIADTLVEQLHPQGVIVVMEAEHLCMSMRGVKKPGSKTTTSAVRGLFRRNPA 186


>gi|313140980|ref|ZP_07803173.1| GTP cyclohydrolase I [Bifidobacterium bifidum NCIMB 41171]
 gi|313133490|gb|EFR51107.1| GTP cyclohydrolase I [Bifidobacterium bifidum NCIMB 41171]
          Length = 196

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 114/168 (67%), Gaps = 5/168 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  ++A+R+ L  IG++PDREGL +TPDR+ ++ +E+F+G  + P    + RF      +
Sbjct: 14  EGVRKAVRLFLTSIGENPDREGLLETPDRIARACEEIFSGLGRSPQEVLSKRFPV----E 69

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
             +MVL++DI  FS CEHH+LP  G  H+ YIP    V+GLSKL R++E+Y+RR Q+QER
Sbjct: 70  TDEMVLVRDIELFSVCEHHLLPFHGVAHVGYIPSNGQVVGLSKLARLVELYARRPQVQER 129

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           +T Q+A A+    D+KGV V+ E +HMCM+MRG+ +    T+T+A  G
Sbjct: 130 ITQQVADALMEYADAKGVIVVTECEHMCMAMRGVNKPASRTITSAVRG 177


>gi|300088064|ref|YP_003758586.1| GTP cyclohydrolase I [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299527797|gb|ADJ26265.1| GTP cyclohydrolase I [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 186

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 114/179 (63%), Gaps = 6/179 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+  +L  IGDDP+REGL+DTP+RV + Y E+F+G  + P       +  G    +++MV
Sbjct: 10  AVETMLEAIGDDPNREGLRDTPERVARMYAEIFSGIDKNPADDLKVGYELG----HREMV 65

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           ++KDI F+S CEHH+LP  G +H+ Y+P +   V+G+SKL R++E  +RR QIQER+  +
Sbjct: 66  ILKDIPFYSMCEHHLLPFSGVVHIGYVPGQDGRVVGISKLARVVETVARRPQIQERMATE 125

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           IA AI       GV V+I  +HMCM+MRGIK+ G   +T+A  G F++       F+ +
Sbjct: 126 IADAIVDGLSPDGVGVVITAEHMCMTMRGIKKPGSKVLTSALRGGFAKRPATRAEFMSL 184


>gi|302038842|ref|YP_003799164.1| GTP cyclohydrolase I [Candidatus Nitrospira defluvii]
 gi|300606906|emb|CBK43239.1| GTP cyclohydrolase I [Candidatus Nitrospira defluvii]
          Length = 211

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 124/187 (66%), Gaps = 6/187 (3%)

Query: 16  PTVEEAKEAIRV-ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHF 73
           PT ++  E +   +L  +G+DPDR GL +TP RV K+ + +  GY+Q I    + + F  
Sbjct: 19  PTDQDPIEGLMTNLLLELGEDPDRNGLLNTPKRVAKAMRFMTQGYRQDIDHLLNGALFPI 78

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
               +Y +MV++KDI FFS CEHH+LP +GK H+ Y+P K V+GLSK+ R+++ +SRRLQ
Sbjct: 79  ----EYDEMVIVKDIDFFSMCEHHLLPFFGKCHVGYLPNKKVVGLSKIPRVVDAFSRRLQ 134

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           +QERLT+QIA  ++   ++ GVAV++E +H+CM MRG+++     V+++  G F   +  
Sbjct: 135 VQERLTLQIAETLKKKLNAHGVAVVMEARHLCMMMRGVEKQNTVAVSSSMLGVFRTQQQT 194

Query: 194 TDFFLKM 200
            + FLK+
Sbjct: 195 REEFLKL 201


>gi|145602544|ref|XP_364613.2| GTP cyclohydrolase I, putative [Magnaporthe oryzae 70-15]
 gi|145010951|gb|EDJ95607.1| GTP cyclohydrolase I, putative [Magnaporthe oryzae 70-15]
          Length = 310

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 120/182 (65%), Gaps = 6/182 (3%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEA 76
           +E  + A+R +L  +G+DPDR+GL  TPDR  K+   L  GY++ I    + + FH G  
Sbjct: 125 LERMRGAVRTLLECVGEDPDRQGLLATPDRYAKALLFLTKGYQENIKDIVNNAIFHEG-- 182

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             + +MV++KDI  FS CEHH++P  GK+H+ YIP   VIGLSKL RI E+++RRLQIQE
Sbjct: 183 --HNEMVIVKDIEIFSMCEHHLVPFTGKMHIGYIPANSVIGLSKLPRIAELFARRLQIQE 240

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTD 195
           RLT ++A+AI      +GVAV++E  H+CM  RG+++   TT+T+   G F  R++ + +
Sbjct: 241 RLTKEVANAIFEVLKPQGVAVVMESSHLCMVTRGVQKTTATTITSCVLGCFEGRERTRNE 300

Query: 196 FF 197
           F 
Sbjct: 301 FL 302


>gi|257784428|ref|YP_003179645.1| GTP cyclohydrolase I [Atopobium parvulum DSM 20469]
 gi|257472935|gb|ACV51054.1| GTP cyclohydrolase I [Atopobium parvulum DSM 20469]
          Length = 195

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 110/174 (63%), Gaps = 4/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  K A+   L  IG+DP+REGL DTPDRV ++  ELF G ++ P      +FH      
Sbjct: 13  ERVKAAVTEFLLAIGEDPEREGLLDTPDRVARACVELFGGMQEDPAVHLRKQFH---EEG 69

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
            ++MV+++DI F S CEHHILP  GK H+ YIP+   + GLSK+ R +  YSRRLQ+QER
Sbjct: 70  NKEMVIVRDIPFSSTCEHHILPFVGKAHVCYIPQNGRITGLSKIARCVSGYSRRLQVQER 129

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LT QIA A+    D  GV V++E +H CMSMRGI+  G  T T+A  G F  ++
Sbjct: 130 LTGQIADAMVEELDPLGVLVVMEAEHTCMSMRGIRASGALTTTSAVRGIFKTNE 183


>gi|302185083|ref|ZP_07261756.1| GTP cyclohydrolase I [Pseudomonas syringae pv. syringae 642]
          Length = 181

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 109/173 (63%), Gaps = 3/173 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+D  REGL DTP R  K+ + L  GY Q             +AS   +MV++KD
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTNGALFSSDAS---EMVMVKD 66

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP  GK H+AYIP+  V+GLSK+ RI+++Y+RRLQIQE L+ QIA AI+
Sbjct: 67  IELYSLCEHHLLPFIGKAHVAYIPQGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAIQ 126

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
             T + GVAV+IE +HMCM MRG+++     +T+   GEF  +      FL +
Sbjct: 127 QVTGALGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSL 179


>gi|325273572|ref|ZP_08139798.1| GTP cyclohydrolase I [Pseudomonas sp. TJI-51]
 gi|324101289|gb|EGB98909.1| GTP cyclohydrolase I [Pseudomonas sp. TJI-51]
          Length = 181

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 113/174 (64%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D  REGL DTP R  K+ K L  GY+Q +    + + F    +S   +MVL++
Sbjct: 10  ILSQLGEDVSREGLLDTPKRAAKAMKYLCRGYEQTLEEVTNNALF----SSDNSEMVLVR 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  GK H+AY+PK  V+GLSK+ RI+++++RRLQIQE L+ Q+A AI
Sbjct: 66  DIELYSMCEHHMLPFIGKAHVAYLPKGKVLGLSKVARIVDMFARRLQIQENLSRQVAEAI 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
              T + GVAV+IE +HMCM MRG+++   T +T+   GEF  +      FL +
Sbjct: 126 LQVTGAAGVAVVIEAKHMCMMMRGVEKQNSTMITSVMLGEFRDNAATRSEFLSL 179


>gi|184201573|ref|YP_001855780.1| GTP cyclohydrolase I [Kocuria rhizophila DC2201]
 gi|183581803|dbj|BAG30274.1| GTP cyclohydrolase I [Kocuria rhizophila DC2201]
          Length = 232

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 119/189 (62%), Gaps = 10/189 (5%)

Query: 6   TGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTT 65
           TG  +  + +P +     A+R IL  +G+DPDR GL+DTP RV ++Y E+FAG  + P  
Sbjct: 37  TGEVSAAVDQPRI---AAAVREILLAVGEDPDRNGLRDTPARVARAYAEVFAGLHEDPAE 93

Query: 66  QDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVR 123
              + F  G    + +MVL++D+ F+S CEHH++P  G  H+ YIP     V GLSKL R
Sbjct: 94  LLATSFDIG----HSEMVLVRDVPFYSTCEHHLVPFHGVAHVGYIPGPEGKVTGLSKLAR 149

Query: 124 ILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAF 183
           ++++Y++R Q+QERLT Q+  A+ +     G  V++E +H+CMSMRG+++ G  TVT+A 
Sbjct: 150 LVDLYAKRPQVQERLTTQVVEALVAHLHPAGAIVVVECEHLCMSMRGVRKPGARTVTSAV 209

Query: 184 TGEFSRDKG 192
            G+  RD  
Sbjct: 210 RGQL-RDPA 217


>gi|167630605|ref|YP_001681104.1| GTP cyclohydrolase i [Heliobacterium modesticaldum Ice1]
 gi|167593345|gb|ABZ85093.1| GTP cyclohydrolase i [Heliobacterium modesticaldum Ice1]
          Length = 190

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 120/176 (68%), Gaps = 6/176 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+ +IL  IG+DP REGL DTP RV + Y+E+  G ++ P       F      ++++
Sbjct: 7   EQAVYMILEAIGEDPRREGLVDTPRRVARMYQEILGGLEEDPKRHLEVIF----TEEHEE 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVI-GLSKLVRILEVYSRRLQIQERLTM 140
           MVL+KDI  +S CEHH+LP +G  H+AYIP+  +I GLSKL R++E +++R Q+QERLT 
Sbjct: 63  MVLVKDIPLYSVCEHHLLPFYGVAHVAYIPRSGMITGLSKLARLVEGFAKRPQLQERLTA 122

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTD 195
           QIA AI    + +GV V+IE +HMCM+MRG+K+ G  TVT+A  G F SR   +++
Sbjct: 123 QIADAIVEKLNPQGVLVVIEAEHMCMTMRGVKKPGSRTVTSAVRGIFRSRPATRSE 178


>gi|164688292|ref|ZP_02212320.1| hypothetical protein CLOBAR_01937 [Clostridium bartlettii DSM
           16795]
 gi|164602705|gb|EDQ96170.1| hypothetical protein CLOBAR_01937 [Clostridium bartlettii DSM
           16795]
          Length = 188

 Score =  166 bits (419), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 120/177 (67%), Gaps = 6/177 (3%)

Query: 17  TVEEAK--EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
            V++AK  +A+R IL  IG+DPDREGL  TPDRV + Y+E+F G  Q P  ++  +  F 
Sbjct: 2   AVDQAKIRKAVRDILEAIGEDPDREGLVGTPDRVARMYEEIFCGLHQDP--REHLKVLFA 59

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQ 133
           +  K+++MV++KDI F+S CEHH++P +GK H+ YIPK   + GLSKL R++E  ++R Q
Sbjct: 60  D-EKHEEMVVVKDIPFYSSCEHHLVPFFGKAHVVYIPKDGRLTGLSKLARVIETIAKRPQ 118

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +QER+T   A+ I       GV V++E +HMCM+MRG+K+ G  TVT+A  G F  D
Sbjct: 119 LQERITKDTANIIMEELRPYGVMVVVEAEHMCMTMRGVKKPGSKTVTSAVRGVFESD 175


>gi|213965109|ref|ZP_03393307.1| GTP cyclohydrolase I [Corynebacterium amycolatum SK46]
 gi|213952223|gb|EEB63607.1| GTP cyclohydrolase I [Corynebacterium amycolatum SK46]
          Length = 191

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 116/174 (66%), Gaps = 6/174 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  +G+DPDREGLK+TP RV ++Y+E+FAG  +  +      F+      
Sbjct: 8   ERAEAAVRELLIAVGEDPDREGLKETPARVARAYREVFAGLFEDSSEVLAKTFN----ED 63

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +Q++VL+KDI  +S CEHH++P +G  H+ YIP K   V GLSKL R+++ Y++R Q+QE
Sbjct: 64  HQELVLVKDIPIYSTCEHHLVPFFGVAHIGYIPGKDGRVTGLSKLARLVDGYAKRPQVQE 123

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLT Q+A A+    D     V+IE +H+CM+MRGI++ G  TVT+A  G F  D
Sbjct: 124 RLTSQVADALVERLDPASAIVVIEAEHLCMAMRGIRKPGARTVTSAVRGGFKTD 177


>gi|192361819|ref|YP_001982422.1| GTP cyclohydrolase I [Cellvibrio japonicus Ueda107]
 gi|190687984|gb|ACE85662.1| GTP cyclohydrolase I [Cellvibrio japonicus Ueda107]
          Length = 179

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 118/179 (65%), Gaps = 3/179 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E    I+  IG+D +R GL DTPDR  K+++ L  GY Q   T D    +    S  Q+
Sbjct: 2   REHFANIIASIGEDLNRPGLLDTPDRAAKAFQFLTRGYTQ---TLDDVVNNALFPSDSQE 58

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           M+++KDI  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++++RRLQIQE+LT+Q
Sbjct: 59  MIMVKDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKVARIVDMFARRLQIQEQLTLQ 118

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           IA +I+S T + GV V+IE +HMCM MRG+++   +  T+A  G F  ++   + FL +
Sbjct: 119 IAESIQSITGASGVGVIIEAKHMCMMMRGVEKQNSSMKTSAMLGSFRTNQATRNEFLSL 177


>gi|104780699|ref|YP_607197.1| GTP cyclohydrolase I [Pseudomonas entomophila L48]
 gi|95109686|emb|CAK14387.1| GTP cyclohydrolase I [Pseudomonas entomophila L48]
          Length = 181

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 114/174 (65%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D  REGL DTP R  K+ K L  GY+Q +    + + F    +S   +MVL++
Sbjct: 10  ILSQLGEDVSREGLLDTPKRAAKAMKYLCRGYEQTLEEVTNGALF----SSDNSEMVLVR 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  GK H+AY+P+  V+GLSK+ RI+++++RRLQIQE L+ QIA A+
Sbjct: 66  DIELYSMCEHHMLPFIGKAHVAYLPQGKVLGLSKVARIVDMFARRLQIQENLSRQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +  T + GVAV+IE +HMCM MRG+++   T +T+   GEF  +      FL +
Sbjct: 126 QQVTGAAGVAVVIEAKHMCMMMRGVEKQNSTMLTSVMLGEFRENASTRSEFLSL 179


>gi|257484479|ref|ZP_05638520.1| GTP cyclohydrolase I [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|298486370|ref|ZP_07004432.1| GTP cyclohydrolase I type 1 [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298159098|gb|EFI00157.1| GTP cyclohydrolase I type 1 [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320323465|gb|EFW79550.1| GTP cyclohydrolase I [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329492|gb|EFW85484.1| GTP cyclohydrolase I [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330879868|gb|EGH14017.1| GTP cyclohydrolase I [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330986199|gb|EGH84302.1| GTP cyclohydrolase I [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 181

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 108/173 (62%), Gaps = 3/173 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+D  REGL DTP R  K+ + L  GY Q             +AS   +MV++KD
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTNGALFSSDAS---EMVMVKD 66

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA AI+
Sbjct: 67  IELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAIQ 126

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
             T + GVAV+IE +HMCM MRG+++     +T+   GEF  +      FL +
Sbjct: 127 QVTGALGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSL 179


>gi|66045089|ref|YP_234930.1| GTP cyclohydrolase I [Pseudomonas syringae pv. syringae B728a]
 gi|289679643|ref|ZP_06500533.1| GTP cyclohydrolase I [Pseudomonas syringae pv. syringae FF5]
 gi|63255796|gb|AAY36892.1| GTP cyclohydrolase I [Pseudomonas syringae pv. syringae B728a]
 gi|330940021|gb|EGH43214.1| GTP cyclohydrolase I [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 181

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 109/173 (63%), Gaps = 3/173 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+D  REGL DTP R  K+ + L  GY Q             +AS   +MV++KD
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYTQTLEEVTNGALFSSDAS---EMVMVKD 66

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP  GK H+AYIP+  V+GLSK+ RI+++Y+RRLQIQE L+ QIA AI+
Sbjct: 67  IELYSLCEHHLLPFIGKAHVAYIPQGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAIQ 126

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
             T + GVAV+IE +HMCM MRG+++     +T+   GEF  +      FL +
Sbjct: 127 QVTGALGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSL 179


>gi|146307766|ref|YP_001188231.1| GTP cyclohydrolase I [Pseudomonas mendocina ymp]
 gi|145575967|gb|ABP85499.1| GTP cyclohydrolase I [Pseudomonas mendocina ymp]
          Length = 181

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/175 (45%), Positives = 112/175 (64%), Gaps = 5/175 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D  REGL DTP R  K+ + L  GY+Q +    + + F    +S   +MVL+K
Sbjct: 10  ILGQLGEDATREGLLDTPKRAAKAMQYLCRGYQQTLEEVTNGALF----SSDNSEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA A+
Sbjct: 66  NIELYSLCEHHMLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
              T + GVAV+IE QHMCM MRG+++   + VT+   GEF  +      FL + 
Sbjct: 126 AQVTGALGVAVVIEAQHMCMMMRGVEKQNSSMVTSVMLGEFRTNPATRGEFLNLV 180


>gi|300853829|ref|YP_003778813.1| GTP cyclohydrolase I [Clostridium ljungdahlii DSM 13528]
 gi|300433944|gb|ADK13711.1| GTP cyclohydrolase I [Clostridium ljungdahlii DSM 13528]
          Length = 185

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 84/183 (45%), Positives = 120/183 (65%), Gaps = 4/183 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA++++L  IG+DP+REGL +TPDR+ + YKE+F G  + P       F         D
Sbjct: 7   REAVKMMLEAIGEDPEREGLVETPDRIARMYKEIFEGLDESPEKHLRKVFTVDS----DD 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +VL KDI+F+S CEHH+LP +GK H+AYIP   V+GLSKL R +EV+++RLQ+QER++ Q
Sbjct: 63  IVLEKDITFYSMCEHHLLPFYGKAHIAYIPDGKVVGLSKLARTVEVFAKRLQLQERMSAQ 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA A+      KGV V++E +HMCM+MRGIK+ G  TVT    G F  +    D   +M 
Sbjct: 123 IADAMMKYVKVKGVMVVVEAEHMCMTMRGIKKPGSKTVTAVARGLFKSEPRLRDEVYRMI 182

Query: 202 HNQ 204
           + +
Sbjct: 183 NME 185


>gi|296121015|ref|YP_003628793.1| GTP cyclohydrolase I [Planctomyces limnophilus DSM 3776]
 gi|296013355|gb|ADG66594.1| GTP cyclohydrolase I [Planctomyces limnophilus DSM 3776]
          Length = 227

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 119/191 (62%), Gaps = 4/191 (2%)

Query: 15  KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG 74
           +P +   + A+R IL  IG++PDREGL++TP RV + + EL AG +  P       F   
Sbjct: 39  EPDLPRIQRAVREILSAIGENPDREGLQETPARVARMFAELTAGLRCDPARHLERVF--- 95

Query: 75  EASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQI 134
              +Y ++VL+KDISF S CEHH+LP  G  H+ Y+P+  V+GLSKL RI++  S + Q+
Sbjct: 96  -PEQYDELVLVKDISFNSMCEHHLLPFMGVAHIGYLPRGKVVGLSKLARIVDEISHQPQV 154

Query: 135 QERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           QER+T QIA  ++S  D KGV V++E  H CM++RGI++ G  T+T+A  G F  ++   
Sbjct: 155 QERMTQQIADLMQSVLDPKGVIVVLEATHTCMTIRGIRKPGSLTITSAVRGLFKTNQASR 214

Query: 195 DFFLKMTHNQR 205
              + +   +R
Sbjct: 215 AEVMSLMQQRR 225


>gi|115625773|ref|XP_788725.2| PREDICTED: similar to GTP cyclohydrolase I precursor (GTP-CH-I)
           [Strongylocentrotus purpuratus]
 gi|115960023|ref|XP_001184004.1| PREDICTED: similar to GTP cyclohydrolase I precursor (GTP-CH-I)
           [Strongylocentrotus purpuratus]
          Length = 273

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 115/178 (64%), Gaps = 5/178 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDM 82
           A R I+R +G+DP+R+GLK TPDR  K+      GY++ I    + + F       + +M
Sbjct: 97  AYRSIIRGVGEDPNRQGLKKTPDRAAKAMMFFTKGYEEKIEDVLNDAIFD----EDHDEM 152

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           V++KDI  FS CEHH++P  GK+ + Y+P K V+GLSK+ R++E+YSRRLQ+QERLT QI
Sbjct: 153 VVVKDIEMFSLCEHHLVPFIGKVSVGYLPNKRVLGLSKVARLVEIYSRRLQVQERLTKQI 212

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           A A+  +    GV V+IE  HMCM MRG+++    T+T+   G+F  D    D FL++
Sbjct: 213 ALAVTEAIAPAGVGVVIEAVHMCMVMRGVQKLNSKTITSCMLGDFREDPKTRDEFLQL 270


>gi|320104626|ref|YP_004180217.1| GTP cyclohydrolase I [Isosphaera pallida ATCC 43644]
 gi|319751908|gb|ADV63668.1| GTP cyclohydrolase I [Isosphaera pallida ATCC 43644]
          Length = 200

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 117/183 (63%), Gaps = 4/183 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77
           +E    A+R IL  +G++PDREG++DTP RV + Y E+F G  Q P  +D  +  F E  
Sbjct: 18  LERIARAVREILIAVGENPDREGIRDTPQRVARMYAEVFQGLHQNP--RDHLKTAFTET- 74

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
            Y+D +LI+DI+F S+CEHH+LP  GK H+AY P+  V+GLSK+ R+++V SRR Q+QER
Sbjct: 75  -YEDTILIRDIAFISFCEHHLLPFVGKTHVAYRPRGRVVGLSKVPRVVDVLSRRPQLQER 133

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT  +A  +    D++GVAV++E  H CM++RG+ + G +  T A  G +  D       
Sbjct: 134 LTTDLADLLHCELDAQGVAVMVEATHSCMTIRGVSKPGSSCWTFAMRGVYETDPALRAEV 193

Query: 198 LKM 200
           L M
Sbjct: 194 LAM 196


>gi|125974688|ref|YP_001038598.1| GTP cyclohydrolase I [Clostridium thermocellum ATCC 27405]
 gi|256005656|ref|ZP_05430614.1| GTP cyclohydrolase I [Clostridium thermocellum DSM 2360]
 gi|281418843|ref|ZP_06249862.1| GTP cyclohydrolase I [Clostridium thermocellum JW20]
 gi|166220270|sp|A3DHH6|GCH1_CLOTH RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|125714913|gb|ABN53405.1| GTP cyclohydrolase I [Clostridium thermocellum ATCC 27405]
 gi|255990414|gb|EEU00538.1| GTP cyclohydrolase I [Clostridium thermocellum DSM 2360]
 gi|281407927|gb|EFB38186.1| GTP cyclohydrolase I [Clostridium thermocellum JW20]
 gi|316941822|gb|ADU75856.1| GTP cyclohydrolase I [Clostridium thermocellum DSM 1313]
          Length = 187

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 116/173 (67%), Gaps = 5/173 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  K A+R +L  IG+DPDREGL +TPDRV +  +E+FAG  Q P     S     +   
Sbjct: 5   ERIKAAVRELLIGIGEDPDREGLLETPDRVARMCEEIFAGLHQDPK----SVVKVFQEEN 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +++MV++KDI  +S CEHH+LP  G  H+ YIP+K  ++GLSKL RI+++ +R+ Q+QER
Sbjct: 61  HEEMVMVKDIPIYSICEHHLLPFIGVAHVVYIPRKGKIMGLSKLARIVDIIARKPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           L  ++A+ I  S +  GVAV++E +H+CM+MRGIK+ G  TVT+A  G    D
Sbjct: 121 LGSEVANVIMESINPLGVAVVVEAEHLCMTMRGIKKAGSKTVTSALRGIIKTD 173


>gi|159040234|ref|YP_001539487.1| GTP cyclohydrolase I [Salinispora arenicola CNS-205]
 gi|157919069|gb|ABW00497.1| GTP cyclohydrolase I [Salinispora arenicola CNS-205]
          Length = 219

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 112/171 (65%), Gaps = 6/171 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           + A+R IL  +G+DPDR+GL+ TP RV ++Y ELFAG +  P     + F     + + +
Sbjct: 39  ENAVREILIAVGEDPDRDGLQQTPARVARAYAELFAGLRVDPAQVLVTTFE----ANHDE 94

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERLT 139
           +VL++DI   S CEHH+LP  G  H+ YIP  +  + GLSKL R++EV++RR Q+QERLT
Sbjct: 95  LVLVRDIDVMSLCEHHLLPFRGSAHIGYIPGSNGRITGLSKLARLVEVFARRPQVQERLT 154

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
            QIA  +      +GV V++E +HMCM+MRGI++ G  T+T+A  G   +D
Sbjct: 155 AQIADLLMEQLQPRGVIVVLECEHMCMAMRGIQKSGAQTITSAVRGSLQQD 205


>gi|77457118|ref|YP_346623.1| GTP cyclohydrolase I [Pseudomonas fluorescens Pf0-1]
 gi|77381121|gb|ABA72634.1| GTP cyclohydrolase I [Pseudomonas fluorescens Pf0-1]
          Length = 186

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 114/179 (63%), Gaps = 5/179 (2%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQD 81
           E  R IL  +G+DPDREGL DTP R  K+ + L  GY+Q +    + + F    AS   +
Sbjct: 7   ENYREILIGLGEDPDREGLLDTPVRAAKAMQYLCHGYEQSVDEIVNGALF----ASDSDE 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           M+++ DI  +S CEHH+LP  GK H+AYIP   V+GLSK+ R++++++RRLQIQE LT Q
Sbjct: 63  MIIVADIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKIARLVDMFARRLQIQENLTRQ 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           IA A+   TD+ GVAV+IE +HMCM MRG+++   T  T+   G F         FL++
Sbjct: 123 IAEAVRQVTDAAGVAVVIEARHMCMMMRGVEKQNSTMNTSVMLGAFRESSNTRQEFLQL 181


>gi|226363734|ref|YP_002781516.1| GTP cyclohydrolase I [Rhodococcus opacus B4]
 gi|226242223|dbj|BAH52571.1| GTP cyclohydrolase I [Rhodococcus opacus B4]
          Length = 203

 Score =  165 bits (418), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 114/167 (68%), Gaps = 6/167 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  IG+DPDR GL+DTP RV +SY+E+FAG    P T   + F  G    +Q
Sbjct: 22  AEAAVRELLIAIGEDPDRPGLRDTPARVARSYREVFAGLYTDPDTVLNTTFDEG----HQ 77

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERL 138
           ++VL++DI  +S CEHH++   G  H+ YIP +   V GLSKL R++++Y++R Q+QERL
Sbjct: 78  ELVLVRDIPLYSTCEHHLVSFHGVAHVGYIPGRTGKVTGLSKLARVVDLYAKRPQVQERL 137

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           T QIA A+    D +G  V+IE +H+CM+MRGI++ G +T T+A  G
Sbjct: 138 TSQIADAVMRKLDPRGAIVVIEAEHLCMAMRGIRKPGASTTTSAVRG 184


>gi|260909402|ref|ZP_05916110.1| GTP cyclohydrolase I [Prevotella sp. oral taxon 472 str. F0295]
 gi|260636494|gb|EEX54476.1| GTP cyclohydrolase I [Prevotella sp. oral taxon 472 str. F0295]
          Length = 193

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 115/172 (66%), Gaps = 9/172 (5%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA---SKYQDMVL 84
           +L  +G+DP REGL+ TP RV K+ + L  GY     TQD  +    +A    KY  MV+
Sbjct: 21  VLSLLGEDPSREGLEKTPMRVAKAMQVLTRGY-----TQDARKV-LTDALFEEKYNQMVI 74

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +KDI FFS CEHH+LP +GK+H+AYIP  ++ GLSK+ R+++++S RLQ+QER+T QI  
Sbjct: 75  VKDIDFFSMCEHHMLPFFGKVHVAYIPNGYITGLSKIARVVDIFSHRLQVQERMTQQIKD 134

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
            I+ +    GV V++E +H+CM MRG+++    T T+ F+G F++ K + +F
Sbjct: 135 CIQDTLKPLGVMVVVEAKHLCMQMRGVEKQNSITTTSDFSGAFNQAKTREEF 186


>gi|322387132|ref|ZP_08060742.1| GTP cyclohydrolase I [Streptococcus infantis ATCC 700779]
 gi|321141661|gb|EFX37156.1| GTP cyclohydrolase I [Streptococcus infantis ATCC 700779]
          Length = 184

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 114/174 (65%), Gaps = 4/174 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +EA+++I+  +G+D +REGL++TP RV + Y+E+F+G  Q      +  F   +     +
Sbjct: 7   EEAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID----DN 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+ KDI F + CEHH LP +GK H+AYIP   V GLSKL R +EVY+++ QIQERL ++
Sbjct: 63  MVVEKDIFFHTMCEHHFLPFYGKAHIAYIPDGRVAGLSKLARTVEVYAKKPQIQERLNIE 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
           +A A+     +KG  V+IE +HMCMSMRG+++ G  T+TT   G F  DK   D
Sbjct: 123 VADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGVFETDKDLRD 176


>gi|213407326|ref|XP_002174434.1| GTP cyclohydrolase I [Schizosaccharomyces japonicus yFS275]
 gi|212002481|gb|EEB08141.1| GTP cyclohydrolase I [Schizosaccharomyces japonicus yFS275]
          Length = 233

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 124/188 (65%), Gaps = 6/188 (3%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEA 76
           V+    A+  IL+ +G+DP R+GL  TP+R  K+      GY++ +    + + F     
Sbjct: 50  VKTISNAVSTILKCLGEDPTRQGLLGTPERYAKAMLYFTKGYEENLREVINNAVFE---- 105

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             + +MV+++DI  FS CEHH++P  GKIH+ YIP+K V+GLSKL RI  +++RRLQ+QE
Sbjct: 106 ENHDEMVIVRDIEVFSLCEHHLVPFIGKIHIGYIPRKRVLGLSKLARIANMFARRLQVQE 165

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTD 195
           RLT Q+A +I+   + +GVAV++E  HMCM MRG+++ G +TVT++ TG F +  K + +
Sbjct: 166 RLTKQVAQSIQKVLNPQGVAVVMEATHMCMVMRGVEKPGSSTVTSSLTGIFQQSHKTREE 225

Query: 196 FFLKMTHN 203
           FF  + H+
Sbjct: 226 FFRLIRHH 233


>gi|294925587|ref|XP_002778958.1| GTP cyclohydrolase I, putative [Perkinsus marinus ATCC 50983]
 gi|239887804|gb|EER10753.1| GTP cyclohydrolase I, putative [Perkinsus marinus ATCC 50983]
          Length = 259

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 119/184 (64%), Gaps = 4/184 (2%)

Query: 24  AIRVILRWI-GDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQD 81
           A R IL  I G+D DR+GL+ TP R  K+ + L  GY + +    + + F   E S   +
Sbjct: 77  AARRILESIDGEDADRQGLQKTPMRYAKALEFLTKGYSESLEEIVNDAVFDV-EPSDNDE 135

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+++DI  FS CEHH+LP +G + + YIP+  V+GLSKL RI E++SRRLQ+QER+T Q
Sbjct: 136 MVMVRDIDMFSLCEHHLLPFYGTVDIGYIPRGKVLGLSKLARITEMFSRRLQVQERMTQQ 195

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTDFFLKM 200
           IA A+E + +  GVAV+I   HMCMSMRGI++   +T T+   G F S  K + +FF  +
Sbjct: 196 IARAVEEAINPMGVAVVIRASHMCMSMRGIQKTSASTTTSCVLGAFRSNPKTRAEFFSLI 255

Query: 201 THNQ 204
           +H Q
Sbjct: 256 SHKQ 259


>gi|77359050|ref|YP_338625.1| GTP cyclohydrolase I [Pseudoalteromonas haloplanktis TAC125]
 gi|123587646|sp|Q3IF89|GCH1_PSEHT RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|76873961|emb|CAI85182.1| GTP cyclohydrolase I [Pseudoalteromonas haloplanktis TAC125]
          Length = 184

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 115/182 (63%), Gaps = 5/182 (2%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASK 78
           E K+    I+  +G+DP+REGL DTP R  K+ + L  GY+Q +    + + F     S 
Sbjct: 4   ELKQGYENIITAVGEDPNREGLLDTPKRAAKAMEYLTQGYRQTLEEITNNAVF----TSD 59

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             DMVL++DI  +S CEHH+LP  G+ H+AYIP   V+GLSK  RI+++++RR QIQE+L
Sbjct: 60  ADDMVLVQDIELYSMCEHHLLPFTGRCHIAYIPNGKVLGLSKFARIVDMFARRFQIQEQL 119

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA A+E  T + GV V++E +HMCM MRG+++   +  T+   G F  D    + FL
Sbjct: 120 THQIAKAVEEVTGATGVGVIVEAKHMCMMMRGVEKQNSSMRTSVMLGNFRADPKTRNEFL 179

Query: 199 KM 200
           ++
Sbjct: 180 QL 181


>gi|313887608|ref|ZP_07821290.1| GTP cyclohydrolase I [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312846217|gb|EFR33596.1| GTP cyclohydrolase I [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 184

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/177 (44%), Positives = 117/177 (66%), Gaps = 5/177 (2%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           ++A+ +I+  IG+D +REGL +TP RV + Y+E+FAG  +      +  F   E     +
Sbjct: 7   EQAVEMIIEAIGEDKNREGLLETPARVARMYEEIFAGLGKTAEEHLSKTFEITE----DN 62

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           +V++KDI F+S CEHH LP +GK H+AYIP + V GLSKL R +E Y+++ Q+QERL+++
Sbjct: 63  IVVVKDIDFYSMCEHHFLPFYGKAHIAYIPNEKVAGLSKLARTVETYAKKPQLQERLSIE 122

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTDFF 197
           IA A+    + KGV V+IE +HMCM+MRG+K+ G  TVT+   G    D K K + F
Sbjct: 123 IADAMMKYLEPKGVLVVIEAEHMCMNMRGVKKPGSKTVTSVARGVLETDEKQKQEAF 179


>gi|328862329|gb|EGG11430.1| hypothetical protein MELLADRAFT_46804 [Melampsora larici-populina
           98AG31]
          Length = 326

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 120/176 (68%), Gaps = 6/176 (3%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYK-QIPTTQDTSRFHFGEASKYQDM 82
           A+R IL  IG+DP+REGL  TP+R  K+   +  GY+ ++P    ++ F+      +++M
Sbjct: 150 AVREILDCIGEDPEREGLLKTPERYAKALLWMTKGYEDKLPDVIGSAVFN----EDHEEM 205

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           V++KDI  FS CEHH++P  GK+ + YIP + V+GLSKL RI E +SRRLQ+QERLT QI
Sbjct: 206 VIVKDIEVFSLCEHHLVPFTGKVSIGYIPNQKVLGLSKLARIAETFSRRLQVQERLTKQI 265

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTDFF 197
           A  ++ +    GVAV++E  HMCM+MRG+++ G  TVT++  G F ++D+ + +F 
Sbjct: 266 AVTVQEAIQPLGVAVVMECTHMCMTMRGVQKPGALTVTSSMLGCFRTKDRTRAEFL 321


>gi|77457942|ref|YP_347447.1| GTP cyclohydrolase I [Pseudomonas fluorescens Pf0-1]
 gi|77381945|gb|ABA73458.1| GTP cyclohydrolase I [Pseudomonas fluorescens Pf0-1]
          Length = 181

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 113/174 (64%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D  REGL DTP R  K+ + L  GY+Q +    + + F    +S   +MVL+K
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYQQTLEEVTNGALF----SSDNSEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA A+
Sbjct: 66  DIELYSLCEHHLLPFIGKAHVAYIPSGKVLGLSKVARIVDMYARRLQIQENLSRQIADAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +  T + GVAV+IE +HMCM MRG+++   + +T+   GEF  +      FL +
Sbjct: 126 QQVTGALGVAVVIEAKHMCMMMRGVEKQNSSMITSVMLGEFRENAATRSEFLSL 179


>gi|294925583|ref|XP_002778957.1| GTP cyclohydrolase I, putative [Perkinsus marinus ATCC 50983]
 gi|239887803|gb|EER10752.1| GTP cyclohydrolase I, putative [Perkinsus marinus ATCC 50983]
          Length = 258

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 119/184 (64%), Gaps = 4/184 (2%)

Query: 24  AIRVILRWI-GDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQD 81
           A R IL  I G+D DR+GL+ TP R  K+ + L  GY + +    + + F   E S   +
Sbjct: 76  AARRILESIDGEDADRQGLQKTPMRYAKALEFLTKGYSESLEEIVNDAVFDV-EPSDNDE 134

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+++DI  FS CEHH+LP +G + + YIP+  V+GLSKL RI E++SRRLQ+QER+T Q
Sbjct: 135 MVMVRDIDMFSLCEHHLLPFYGTVDIGYIPRGKVLGLSKLARITEMFSRRLQVQERMTQQ 194

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTDFFLKM 200
           IA A+E + +  GVAV+I   HMCMSMRGI++   +T T+   G F S  K + +FF  +
Sbjct: 195 IARAVEEAINPMGVAVVIRASHMCMSMRGIQKTSASTTTSCVLGAFRSNPKTRAEFFSLI 254

Query: 201 THNQ 204
           +H Q
Sbjct: 255 SHKQ 258


>gi|288929662|ref|ZP_06423506.1| GTP cyclohydrolase I [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329167|gb|EFC67754.1| GTP cyclohydrolase I [Prevotella sp. oral taxon 317 str. F0108]
          Length = 193

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 115/172 (66%), Gaps = 9/172 (5%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA---SKYQDMVL 84
           +L  +G+DP REGL+ TP RV K+ + L  GY     TQD  +    +A    KY  MV+
Sbjct: 21  VLALLGEDPSREGLEKTPMRVAKAMQVLTRGY-----TQDARKV-LTDALFEEKYNQMVI 74

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +KDI FFS CEHH+LP +GK+H+AYIP  ++ GLSK+ R+++++S RLQ+QER+T QI  
Sbjct: 75  VKDIDFFSMCEHHMLPFFGKVHVAYIPNGYITGLSKIARVVDIFSHRLQVQERMTQQIKD 134

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
            I+ +    GV V++E +H+CM MRG+++    T T+ F+G F++ K + +F
Sbjct: 135 CIQDTLKPLGVMVVVEAKHLCMQMRGVEKQNSITTTSDFSGAFNQAKTREEF 186


>gi|38234565|ref|NP_940332.1| GTP cyclohydrolase I [Corynebacterium diphtheriae NCTC 13129]
 gi|38200828|emb|CAE50532.1| GTP cyclohydrolase I [Corynebacterium diphtheriae]
          Length = 190

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 117/171 (68%), Gaps = 6/171 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           + A+ A+R +L  +G+DPDREGL++TP RV K+Y E+FAG    PT      F    +  
Sbjct: 8   QRAEAAVRELLIAVGEDPDREGLQETPARVAKAYAEMFAGLHTDPTEVLAKTF----SED 63

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++VL++DI  +S CEHH++P +GK H+ YIP +   V GLSKL R++++Y++R Q+QE
Sbjct: 64  HREVVLVRDIPIYSTCEHHLVPFFGKAHIGYIPGESGKVTGLSKLARLVDLYAKRPQVQE 123

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           RLT Q+A A+     ++ V V+IE +H+CM+MRGI++ G  T T+A  G F
Sbjct: 124 RLTTQVADALVDKLQAQAVIVVIECEHLCMAMRGIRKPGAVTTTSAVRGGF 174


>gi|330811125|ref|YP_004355587.1| GTP cyclohydrolase I [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379233|gb|AEA70583.1| GTP cyclohydrolase I [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 181

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 113/174 (64%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D  REGL DTP R  K+ + L  GY+Q +    + + F    +S   +MVL+K
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYEQTLEEVTNGALF----SSDNSEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA A+
Sbjct: 66  DIELYSLCEHHLLPFIGKAHVAYIPSGKVLGLSKVARIVDMYARRLQIQENLSRQIADAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +  T + GVAV+IE +HMCM MRG+++   + +T+   GEF  +      FL +
Sbjct: 126 QQVTGALGVAVVIEAKHMCMMMRGVEKQNSSMITSVMLGEFRENAATRSEFLSL 179


>gi|154308902|ref|XP_001553786.1| hypothetical protein BC1G_07979 [Botryotinia fuckeliana B05.10]
 gi|150852605|gb|EDN27797.1| hypothetical protein BC1G_07979 [Botryotinia fuckeliana B05.10]
          Length = 303

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 83/186 (44%), Positives = 120/186 (64%), Gaps = 10/186 (5%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA---SKYQ 80
           A+R IL  IG+DPDREGL  TP+R  K+   L  GY      Q+  R    +A     + 
Sbjct: 124 AVRTILECIGEDPDREGLLATPERYAKALLYLTKGY------QENVRDIVNDAIFNEDHN 177

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTM 140
           ++V++KDI  FS CEHH++P  GK+H+ YIP ++VIG+SKL RI +++SRRLQIQERLT 
Sbjct: 178 ELVIVKDIEVFSMCEHHMVPFTGKMHIGYIPDRNVIGISKLPRIADMFSRRLQIQERLTK 237

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS-RDKGKTDFFLK 199
            +AHA+      +GVAV++E  H+CM MRG+++   TT+T+   G    R+K + +FF  
Sbjct: 238 DVAHAVMEILKPQGVAVVMESSHLCMVMRGVEKTSATTITSCVLGCIEKREKTRNEFFSL 297

Query: 200 MTHNQR 205
           +  N+R
Sbjct: 298 VGLNRR 303


>gi|171676384|ref|XP_001903145.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936258|emb|CAP60917.1| unnamed protein product [Podospora anserina S mat+]
          Length = 446

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 120/184 (65%), Gaps = 5/184 (2%)

Query: 18  VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEA 76
           +E+ K A+R +L  IG+DPDREGL  TP+R  K+      GY++ +    + + F  G  
Sbjct: 261 MEKMKGAVRTLLECIGEDPDREGLLATPERYAKAMLFFTKGYQENVRDIVNGAIFQEG-- 318

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             + +MV++KDI  FS CEHH++P  GK+H+ YIP   VIG+SKL RI E+++RRLQIQE
Sbjct: 319 --HNEMVIVKDIEVFSMCEHHLVPFNGKMHIGYIPSNAVIGISKLPRIAELFARRLQIQE 376

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT ++AHAI      +GVAV++E  H+CM MRG+++   +T+T+   G F R +   + 
Sbjct: 377 RLTKEVAHAIMEVLKPQGVAVVMESSHLCMVMRGVEKTTTSTITSCVLGCFERKEKTRNE 436

Query: 197 FLKM 200
           FL +
Sbjct: 437 FLSL 440


>gi|146282677|ref|YP_001172830.1| GTP cyclohydrolase I [Pseudomonas stutzeri A1501]
 gi|145570882|gb|ABP79988.1| GTP cyclohydrolase I precursor [Pseudomonas stutzeri A1501]
 gi|327480933|gb|AEA84243.1| GTP cyclohydrolase I [Pseudomonas stutzeri DSM 4166]
          Length = 181

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 113/168 (67%), Gaps = 6/168 (3%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D +REGL DTP R  K+ + L  GY+Q +    + + F    +S   +MVL+K
Sbjct: 10  ILGQLGEDVNREGLLDTPKRAAKAMQYLCKGYQQTLEEVTNGALF----SSDNSEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I  +S CEHH+LP  GK H+AY+P   V+GLSK+ RI+++Y+RRLQIQE LT +IA A+
Sbjct: 66  NIELYSLCEHHMLPFIGKAHVAYLPNGKVLGLSKVARIVDMYARRLQIQENLTREIAEAM 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           +  T + GVAV+IE QHMCM MRG+++   + VT+   G+F RD   T
Sbjct: 126 QQVTGASGVAVVIEAQHMCMMMRGVEKQNSSMVTSVMLGQF-RDNAAT 172


>gi|225707432|gb|ACO09562.1| GTP cyclohydrolase I [Osmerus mordax]
          Length = 241

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 115/179 (64%), Gaps = 5/179 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDM 82
           A   ILR +G++ DR+GL  TP R  K+ + L  GY + I    + + F       + +M
Sbjct: 64  AYTTILRGLGENTDRQGLLRTPLRAAKAMQFLTKGYHETIYDILNDAIFD----EDHDEM 119

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           V++K+I  FS CEHH++P +GK+H+ Y+P K V+GLSKL RI+E+YSRRLQ+QERLT QI
Sbjct: 120 VIVKEIDVFSLCEHHLVPFFGKVHIGYLPNKKVVGLSKLARIVEIYSRRLQVQERLTKQI 179

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           A AI  +    GVAV+IE  HMCM MRG+++    TVT+A  G F  D    + FL +T
Sbjct: 180 AMAISEALQPAGVAVVIEAAHMCMVMRGVQKMNSRTVTSAMLGVFREDPKTREEFLALT 238


>gi|256425905|ref|YP_003126558.1| GTP cyclohydrolase I [Chitinophaga pinensis DSM 2588]
 gi|256040813|gb|ACU64357.1| GTP cyclohydrolase I [Chitinophaga pinensis DSM 2588]
          Length = 195

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 115/173 (66%), Gaps = 3/173 (1%)

Query: 29  LRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDI 88
           +  +G+D +REGL+ TP+RV K+ + L  GY Q+          F E   Y +MV++KDI
Sbjct: 25  IALLGEDVEREGLQKTPERVAKAMQFLTEGY-QMDAKAILEGAKFTET--YSEMVIVKDI 81

Query: 89  SFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIES 148
             +S CEHH+LP +GK H+AYIP  ++ GLSKL R+++V++RRLQ+QERLT QI  AI+ 
Sbjct: 82  ELYSLCEHHMLPFFGKAHIAYIPNGYITGLSKLARVVDVFARRLQVQERLTHQILDAIQE 141

Query: 149 STDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           +    GV V+IE QH+CM MRG+++    T T+AF+G+F   + + +F   +T
Sbjct: 142 TLQPLGVGVVIEAQHLCMMMRGVQKQNSVTTTSAFSGQFEDGRTRNEFMRLIT 194


>gi|86142212|ref|ZP_01060722.1| putative GTP cyclohydrolase I [Leeuwenhoekiella blandensis MED217]
 gi|85830964|gb|EAQ49421.1| putative GTP cyclohydrolase I [Leeuwenhoekiella blandensis MED217]
          Length = 199

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 122/191 (63%), Gaps = 11/191 (5%)

Query: 9   FNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT 68
           +N+ +K    E+ K+  + I+  +G+D  REG+  TP+R  K+   L +GY       D 
Sbjct: 10  YNIDVK----EDVKDRYKAIITDLGEDVTREGIVKTPERAAKAMMYLTSGYDM-----DA 60

Query: 69  SRFHFGEASK--YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILE 126
           S    G   K  Y++MV++K+I  +S CEHH+LP +GK H+AYIP  H++GLSKL R+++
Sbjct: 61  SEILKGAMFKEDYREMVIVKNIELYSLCEHHLLPFFGKAHIAYIPDGHIVGLSKLPRVVD 120

Query: 127 VYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGE 186
           V+SRRLQ+QERLT  I   I ++   +GVAV+IE  HMCM MRG+++   TT T+ F G+
Sbjct: 121 VFSRRLQVQERLTHDILECINNTLKPQGVAVVIEASHMCMMMRGVQKQNSTTTTSGFRGQ 180

Query: 187 FSRDKGKTDFF 197
           F  ++ + +F 
Sbjct: 181 FEHNETRNEFL 191


>gi|302189090|ref|ZP_07265763.1| GTP cyclohydrolase I [Pseudomonas syringae pv. syringae 642]
          Length = 187

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 117/182 (64%), Gaps = 7/182 (3%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVL 84
           R IL  +G+DPDREGL DTP R  K+ + L  GY Q +    + + F    AS   +MV+
Sbjct: 10  RDILLGLGEDPDREGLLDTPKRASKAMQYLCHGYTQSVEEIVNGALF----ASDNDEMVI 65

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +++I  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++++RRLQIQE LT QIA 
Sbjct: 66  VQNIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKIARIVDMFARRLQIQENLTKQIAD 125

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF-FLKMTHN 203
           AI+  T + GVAV+IE QHMCM MRG+++   T  T+   G F RD   T   FL++   
Sbjct: 126 AIQKVTGAAGVAVVIEAQHMCMMMRGVEKQNSTMNTSVMLGAF-RDSSTTRMEFLQLIGR 184

Query: 204 QR 205
            R
Sbjct: 185 SR 186


>gi|256826247|ref|YP_003150207.1| GTP cyclohydrolase I [Kytococcus sedentarius DSM 20547]
 gi|256689640|gb|ACV07442.1| GTP cyclohydrolase I [Kytococcus sedentarius DSM 20547]
          Length = 195

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 115/169 (68%), Gaps = 5/169 (2%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DPDR+GL DTP RV +SY EL +G  Q P+    + F    A  + 
Sbjct: 16  AEAAVRELLLAVGEDPDRDGLVDTPARVARSYAELTSGLDQDPSEILGTTF----AIDHD 71

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQERLT 139
           +MV+++DI   S CEHH+LP  G  H+ Y P+   V+GLSKL R++E+Y+RR Q+QERLT
Sbjct: 72  EMVMVRDIEMHSLCEHHLLPFHGVAHVGYTPQDGRVVGLSKLARLVEMYARRPQVQERLT 131

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
            Q+A+A+       GV V++E +H+CM+MRG+++ G  TVT+A  G+F+
Sbjct: 132 TQVANALVDHLRPGGVIVVVEAEHLCMTMRGVRKPGARTVTSAVRGQFT 180


>gi|139437338|ref|ZP_01771498.1| Hypothetical protein COLAER_00477 [Collinsella aerofaciens ATCC
           25986]
 gi|133776985|gb|EBA40805.1| Hypothetical protein COLAER_00477 [Collinsella aerofaciens ATCC
           25986]
          Length = 185

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 113/182 (62%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ + AI+++L  IG+DP REGL +TP RV + Y E+  G  Q      +  F    A  
Sbjct: 5   EKVETAIKLLLEGIGEDPTREGLLETPARVARMYGEIAGGMDQSAEEHLSKTF----AVA 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
             D+V+ +DI+F+S CEHH+LP +GK  + YIP   V GLSKL R +EVY+RRLQ+QE+L
Sbjct: 61  SNDLVIERDITFYSLCEHHLLPFYGKAAIGYIPNGRVAGLSKLARTVEVYARRLQLQEQL 120

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
             Q+A A+      +G  VL+E +HMCM+MRG+++ G  TVT A  G F  D    + F 
Sbjct: 121 CTQVADALMEYLAPQGAIVLMEAEHMCMTMRGVQKPGTKTVTLARRGVFETDPSLEERFF 180

Query: 199 KM 200
           +M
Sbjct: 181 RM 182


>gi|315655899|ref|ZP_07908797.1| GTP cyclohydrolase I [Mobiluncus curtisii ATCC 51333]
 gi|315489963|gb|EFU79590.1| GTP cyclohydrolase I [Mobiluncus curtisii ATCC 51333]
          Length = 191

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 113/164 (68%), Gaps = 5/164 (3%)

Query: 23  EAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDM 82
           +A+R +L  +G+DPDREGL+DTP+R+ +S+ E+  GY++ P       F      ++ D+
Sbjct: 12  QAVRDLLVAVGEDPDREGLRDTPERMARSFAEMLQGYQEDPKKHLERMFPV----EHNDL 67

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPK-KHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           VL+KDI F S CEHH+LP  G+ H+ YIP+ K V GLSKL R+++ Y+ RLQ+QERLT Q
Sbjct: 68  VLVKDIPFNSMCEHHLLPFVGRAHVGYIPQGKRVTGLSKLARLVDGYAHRLQVQERLTQQ 127

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           IA A+      +GV V+++ +HMCM++RG+K+ G  T T+A  G
Sbjct: 128 IADALWDVLQPQGVIVVLQAEHMCMAIRGVKKPGARTTTSAVRG 171


>gi|322383291|ref|ZP_08057091.1| GTP cyclohydrolase I-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321152411|gb|EFX45210.1| GTP cyclohydrolase I-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 196

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 118/182 (64%), Gaps = 4/182 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ +  IR ILR IG+D DREGL DTP RV + Y+E+F GY+     ++     F E   
Sbjct: 16  EQIEYHIREILRLIGEDVDREGLLDTPARVTRMYEEIFGGYE--ADYEEVLGVTFDE--N 71

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           ++++V++KDI ++S CEHH+ P +GK+H+ YIP   + GLSK  R++E  +R+LQ+QER+
Sbjct: 72  HEELVIVKDIVYYSQCEHHMAPFFGKVHIGYIPSGKIAGLSKFARLVEAVTRKLQVQERI 131

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T QIA  IE     +G+ V+++G+H+CM  RG+K+ G  TVT+A  G F  D      FL
Sbjct: 132 TSQIADIIEEVLKPQGIMVMVDGEHLCMCSRGVKKPGSKTVTSAVRGIFRTDAALRAEFL 191

Query: 199 KM 200
            +
Sbjct: 192 SL 193


>gi|24216954|ref|NP_714435.1| GTP cyclohydrolase I [Leptospira interrogans serovar Lai str.
           56601]
 gi|45659222|ref|YP_003308.1| GTP cyclohydrolase I [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|41017199|sp|Q8EYG1|GCH1_LEPIN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|59797796|sp|Q72LY8|GCH1_LEPIC RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|24198347|gb|AAN51453.1|AE011578_8 GTP cyclohydrolase I [Leptospira interrogans serovar Lai str.
           56601]
 gi|45602468|gb|AAS71945.1| GTP cyclohydrolase I [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
          Length = 183

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/179 (44%), Positives = 121/179 (67%), Gaps = 3/179 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E +  IL+ IG+DP REGL +TP RV K+Y+ L +GY+    T+  +   F E +  + 
Sbjct: 2   EEDVINILKSIGEDPTREGLLNTPKRVKKAYEFLTSGYRA-DITKIVNGAIFEEPT--EG 58

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MVL++DI  +S CEHH+LP +GK H+AY+P K +IG+SK+ RI++V++RRLQ+QERLT Q
Sbjct: 59  MVLVRDIEMYSLCEHHLLPFYGKAHVAYLPNKKIIGISKIPRIVDVFARRLQVQERLTEQ 118

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           IA+AI+   D +GVAV+I+ +H+CM MRG+++      T+   G F  +      FL +
Sbjct: 119 IAYAIQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCMLGAFKENMVTRSEFLDL 177


>gi|209363905|ref|YP_001424247.2| GTP cyclohydrolase I [Coxiella burnetii Dugway 5J108-111]
 gi|212212745|ref|YP_002303681.1| GTP cyclohydrolase I [Coxiella burnetii CbuG_Q212]
 gi|212218280|ref|YP_002305067.1| GTP cyclohydrolase I [Coxiella burnetii CbuK_Q154]
 gi|215919047|ref|NP_819815.2| GTP cyclohydrolase I [Coxiella burnetii RSA 493]
 gi|206583932|gb|AAO90329.2| GTP cyclohydrolase I [Coxiella burnetii RSA 493]
 gi|207081838|gb|ABS76861.2| GTP cyclohydrolase I [Coxiella burnetii Dugway 5J108-111]
 gi|212011155|gb|ACJ18536.1| GTP cyclohydrolase I [Coxiella burnetii CbuG_Q212]
 gi|212012542|gb|ACJ19922.1| GTP cyclohydrolase I [Coxiella burnetii CbuK_Q154]
          Length = 188

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 118/177 (66%), Gaps = 5/177 (2%)

Query: 25  IRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMV 83
           ++ IL  +G+DP+REGL+DTP R  K+ + L  GY +++P+    + F  G      +MV
Sbjct: 13  VKAILIALGEDPNREGLRDTPKRYEKALEHLTKGYHEKLPSVVKKAVFQSG----MDEMV 68

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           ++KDI  +S CEHH+LP  G+ H+AY+P   +IG+SKL RI++++++RLQ+QE LT QIA
Sbjct: 69  ILKDIELYSLCEHHLLPFIGRCHVAYLPSGKIIGISKLARIVDMFAKRLQVQENLTKQIA 128

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
            AI ++T++KGV V+IE +H+CM MRG+++      T+   G F +D      FL +
Sbjct: 129 EAILTATEAKGVGVIIEAKHLCMMMRGVEKQNSEMTTSVMLGTFRKDDRTRSEFLSL 185


>gi|189485210|ref|YP_001956151.1| GTP cyclohydrolase I [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287169|dbj|BAG13690.1| GTP cyclohydrolase I [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 190

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 79/184 (42%), Positives = 126/184 (68%), Gaps = 9/184 (4%)

Query: 8   VFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQD 67
           +FN   KK     A+ A++++L   G+D +REG+K TP+RV + YKE+ +G K  P    
Sbjct: 3   IFNFDEKK-----AQRAVKLLLESFGEDLNREGIKRTPERVAEFYKEVLSGNKIDPL--K 55

Query: 68  TSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILE 126
               H+     ++++VL+KDI+F+S CEHH+LP +GK+H+AYIPKK  +IG+SKL++++E
Sbjct: 56  FIPVHYA-TEDHEEIVLVKDITFYSLCEHHLLPFFGKMHIAYIPKKDRIIGVSKLIKLVE 114

Query: 127 VYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGE 186
           +++ RLQ+QERLT Q+A  +       GV V++E +H+CM+MRG+K+ G   +T+A  G 
Sbjct: 115 IFANRLQLQERLTKQLADIVMKFVKPHGVMVVVEAEHLCMTMRGVKKTGSKIITSAMRGI 174

Query: 187 FSRD 190
           F +D
Sbjct: 175 FLKD 178


>gi|66044273|ref|YP_234114.1| GTP cyclohydrolase I [Pseudomonas syringae pv. syringae B728a]
 gi|289678298|ref|ZP_06499188.1| GTP cyclohydrolase I [Pseudomonas syringae pv. syringae FF5]
 gi|63254980|gb|AAY36076.1| GTP cyclohydrolase I [Pseudomonas syringae pv. syringae B728a]
 gi|330942351|gb|EGH44974.1| GTP cyclohydrolase I [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 187

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 117/182 (64%), Gaps = 7/182 (3%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVL 84
           R IL  +G+DPDREGL DTP R  K+ + L  GY Q +    + + F    AS   +MV+
Sbjct: 10  RDILLGLGEDPDREGLLDTPKRASKAMQYLCHGYTQSVEEIVNGALF----ASDNDEMVI 65

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +++I  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++++RRLQIQE LT QIA 
Sbjct: 66  VQNIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKIARIVDMFARRLQIQENLTKQIAD 125

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF-FLKMTHN 203
           AI+  T + GVAV+IE QHMCM MRG+++   T  T+   G F RD   T   FL++   
Sbjct: 126 AIQKVTGAAGVAVVIEAQHMCMMMRGVEKQNSTMNTSVMLGAF-RDSSTTRMEFLQLIGR 184

Query: 204 QR 205
            R
Sbjct: 185 SR 186


>gi|71736767|ref|YP_274038.1| GTP cyclohydrolase I [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71557320|gb|AAZ36531.1| GTP cyclohydrolase I [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 216

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 108/174 (62%), Gaps = 3/174 (1%)

Query: 27  VILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIK 86
            IL  +G+D  REGL DTP R  K+ + L  GY Q             +AS   +MV++K
Sbjct: 44  AILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTNGALFSSDAS---EMVMVK 100

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA AI
Sbjct: 101 DIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAI 160

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +  T + GVAV+IE +HMCM MRG+++     +T+   GEF  +      FL +
Sbjct: 161 QQVTGALGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSL 214


>gi|227547908|ref|ZP_03977957.1| GTP cyclohydrolase I [Corynebacterium lipophiloflavum DSM 44291]
 gi|227080013|gb|EEI17976.1| GTP cyclohydrolase I [Corynebacterium lipophiloflavum DSM 44291]
          Length = 191

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 117/184 (63%), Gaps = 6/184 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           + A+ A+R +L  +G+DPDREGL +TP RV ++Y+E+FAG    PT      F    A  
Sbjct: 9   DRAEAAVRELLIAVGEDPDREGLAETPARVARAYEEVFAGLHSEPTDVLEKTF----AEN 64

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           +Q++VL++DI  +S CEHH++P +G  H+ YIP     V GLSKL R+ ++Y++R Q+QE
Sbjct: 65  HQELVLVRDIPIYSTCEHHLVPFFGTAHIGYIPGPDGKVTGLSKLARLADLYAKRPQVQE 124

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDF 196
           RLT QIA A+     ++ V V+IE +H+CM+MRGI++ G  T T+A  G F  +      
Sbjct: 125 RLTAQIADALVDKLGAQAVIVVIECEHLCMAMRGIRKPGAVTTTSAVRGGFQHNAASRSE 184

Query: 197 FLKM 200
            L +
Sbjct: 185 VLSL 188


>gi|70731705|ref|YP_261447.1| GTP cyclohydrolase I [Pseudomonas fluorescens Pf-5]
 gi|68346004|gb|AAY93610.1| GTP cyclohydrolase I [Pseudomonas fluorescens Pf-5]
          Length = 181

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 112/174 (64%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D  REGL DTP R  K+ + L  GY Q +    + + F    +S   +MVL+K
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTNGALF----SSDNSEMVLVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA A+
Sbjct: 66  DIELYSLCEHHLLPFIGKAHVAYIPSGKVLGLSKVARIVDMYARRLQIQENLSRQIADAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +  T + GVAV+IE +HMCM MRG+++   + +T+   GEF  +      FL +
Sbjct: 126 QQVTGALGVAVVIEAKHMCMMMRGVEKQNSSMITSVMLGEFRENAATRSEFLSL 179


>gi|110626157|ref|NP_571742.1| GTP cyclohydrolase 1 [Danio rerio]
 gi|47940335|gb|AAH71298.1| GTP cyclohydrolase 2 [Danio rerio]
          Length = 240

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 116/179 (64%), Gaps = 5/179 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT-SRFHFGEASKYQDM 82
           A   ILR +G++ DR+GL  TP R  K+ + L  GY +  T  D  +   F E   ++++
Sbjct: 62  AYTTILRGLGENTDRQGLLKTPLRAAKAMQFLTKGYHE--TIYDILNDAIFDE--DHEEL 117

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           V++KDI  FS CEHH++P +GK+H+ Y+P K V+GLSKL RI+E+YSRRLQ+QERLT QI
Sbjct: 118 VIVKDIDMFSLCEHHLVPFFGKVHIGYLPSKKVVGLSKLARIVEIYSRRLQVQERLTKQI 177

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           A AI  +    GVAV+IE  HMCM MRG+++    TVT+A  G F  D    + FL + 
Sbjct: 178 AMAISEALQPVGVAVVIEAAHMCMVMRGVQKMNSRTVTSAMLGVFREDPKAREEFLALA 236


>gi|293364709|ref|ZP_06611426.1| GTP cyclohydrolase I [Streptococcus oralis ATCC 35037]
 gi|291316159|gb|EFE56595.1| GTP cyclohydrolase I [Streptococcus oralis ATCC 35037]
          Length = 184

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 113/172 (65%), Gaps = 4/172 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+++I+  +G+D +REGL++TP RV + Y+E+F+G  Q      +  F   +     +MV
Sbjct: 9   AVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID----DNMV 64

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           + KDI F + CEHH LP +GK H+AYIP   V GLSKL R +EVYS++ QIQERL +++A
Sbjct: 65  VEKDIFFHTMCEHHFLPFYGKAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIEVA 124

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
            A+ +   +KG  V+IE +HMCMSMRG+++ G  T+TT   G F  DK   D
Sbjct: 125 DALMNYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRD 176


>gi|242310693|ref|ZP_04809848.1| GTP cyclohydrolase I [Helicobacter pullorum MIT 98-5489]
 gi|239523091|gb|EEQ62957.1| GTP cyclohydrolase I [Helicobacter pullorum MIT 98-5489]
          Length = 180

 Score =  164 bits (416), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 3/177 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E IR    +IG+D DREGL +TP RVIKS++ L++GYK  P       F  G      +
Sbjct: 2   EEKIRAFFDYIGEDRDREGLLETPMRVIKSWEHLYSGYKSDPKEILGKCFSDGACD---E 58

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV++KDI F+S CEHH+LP +GKI + YIP   V+G+SKL R++EV+SRRLQIQE++T Q
Sbjct: 59  MVVLKDIEFYSVCEHHLLPFFGKISIGYIPDSKVVGISKLARLVEVFSRRLQIQEKMTSQ 118

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           IA  I      KG  V+ E +HMCM MRG+++      T+A  G F  D    + F+
Sbjct: 119 IADTIMEVLQPKGAMVVAEAKHMCMVMRGVEKQNSIMTTSAIRGLFKSDHRTREEFM 175


>gi|160893110|ref|ZP_02073898.1| hypothetical protein CLOL250_00656 [Clostridium sp. L2-50]
 gi|156865193|gb|EDO58624.1| hypothetical protein CLOL250_00656 [Clostridium sp. L2-50]
          Length = 193

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 88/190 (46%), Positives = 116/190 (61%), Gaps = 10/190 (5%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFG---- 74
           E  KE IR IL  +GDDPDREGLK+TPDRV + Y+E+F G   +  T D     FG    
Sbjct: 6   EAIKEHIRGILVALGDDPDREGLKETPDRVARMYEEVFEG---MNYTNDEIAEMFGKTFK 62

Query: 75  --EASKYQDMVLIKDISFFSYCEHHILPIWG-KIHLAYIPKKHVIGLSKLVRILEVYSRR 131
             +A+   DMV +KDI  FSYCEHH+  ++  K+ +AYIP   V+GLSK+ RI ++ ++R
Sbjct: 63  EEDAAHTSDMVFVKDIEVFSYCEHHMALMYDMKVSVAYIPHGRVLGLSKIARIADMVAKR 122

Query: 132 LQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LQ+QER+   IA+ +  +  S  VAVLIE  H CM+ RGIK+ G  T TT F G F  D 
Sbjct: 123 LQLQERIGSDIAYVVGKAAGSPDVAVLIEANHSCMTARGIKKPGTKTYTTTFRGAFENDV 182

Query: 192 GKTDFFLKMT 201
              +  L M 
Sbjct: 183 NLQNKVLMMN 192


>gi|305666724|ref|YP_003863011.1| GTP cyclohydrolase I [Maribacter sp. HTCC2170]
 gi|88708948|gb|EAR01182.1| GTP cyclohydrolase I [Maribacter sp. HTCC2170]
          Length = 199

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 110/170 (64%), Gaps = 3/170 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           I+  IG+D  REGL  TP+R  K+   L  GY+Q    +      F E+  Y +MV++KD
Sbjct: 25  IIEEIGEDVSREGLVKTPERAAKAMLFLTQGYQQ-DAAEILKSAMFQES--YNEMVIVKD 81

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP +GK H+AYIP   ++GLSKL RI++V++RRLQ+QERLT QI   I 
Sbjct: 82  IELYSLCEHHMLPFFGKAHIAYIPNGQIVGLSKLPRIVDVFARRLQVQERLTEQILDCIN 141

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
            +   +GVAV+IE  HMCM MRG+++    T T+ F G F +++ + +F 
Sbjct: 142 DTLKPQGVAVVIEAAHMCMMMRGVQKQNSVTTTSGFRGNFEKEETRNEFL 191


>gi|289626418|ref|ZP_06459372.1| GTP cyclohydrolase I [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649572|ref|ZP_06480915.1| GTP cyclohydrolase I [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330866342|gb|EGH01051.1| GTP cyclohydrolase I [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 181

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 108/173 (62%), Gaps = 3/173 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+D  REGL DTP R  K+ + L  GY Q             +AS   +MV++KD
Sbjct: 10  ILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYAQTLEEVTNGALFSSDAS---EMVMVKD 66

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA AI+
Sbjct: 67  IELYSLCEHHLLPFIGKAHVAYIPDGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAIQ 126

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
             T + GVAV+IE +HMCM MRG+++     +T+   GEF  +      FL +
Sbjct: 127 QVTGALGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSL 179


>gi|289614661|emb|CBI58564.1| unnamed protein product [Sordaria macrospora]
          Length = 319

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 125/186 (67%), Gaps = 6/186 (3%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFH 72
           K+  +++ K A+R +L  +G+DPDREGL  TP+R  K+  +   GY++ +    + + F 
Sbjct: 131 KQERLDKMKGAVRTLLECLGEDPDREGLLATPERYAKAMLDFTQGYQENVRDIVNGAIFQ 190

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
            G    + +MV++KDI  FS CEHH++P  GK+H+ YIP   VIG+SKL RI ++++RRL
Sbjct: 191 EG----HNEMVIVKDIEVFSMCEHHLVPFTGKMHIGYIPSNAVIGISKLPRIADLFARRL 246

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDK 191
           QIQERLT ++A+AI      +GVAV++E  H+CM MRG+K+   +T+T+   G F SR+K
Sbjct: 247 QIQERLTKEVANAIMEILKPQGVAVVMESSHLCMVMRGVKKTTSSTITSCVLGCFESREK 306

Query: 192 GKTDFF 197
            +++F 
Sbjct: 307 TRSEFL 312


>gi|331699842|ref|YP_004336081.1| GTP cyclohydrolase 1 [Pseudonocardia dioxanivorans CB1190]
 gi|326954531|gb|AEA28228.1| GTP cyclohydrolase 1 [Pseudonocardia dioxanivorans CB1190]
          Length = 205

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 117/171 (68%), Gaps = 8/171 (4%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAG-YKQIPTTQDTSRFHFGEASKY 79
           A+ A+R +L  IG+DPDREGL+DTP RV ++Y+E+FAG Y       D +   F E  ++
Sbjct: 24  AEAAVRELLIAIGEDPDREGLRDTPARVARAYEEIFAGLYTDADAVLDRT---FDE--QH 78

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPK--KHVIGLSKLVRILEVYSRRLQIQER 137
           Q+++L+KDI  FS CEHH++P  G  H+ YIP     V GLSK+ R++E Y+RR Q+QER
Sbjct: 79  QELILVKDIPMFSTCEHHLVPFHGVAHVGYIPNVTGRVTGLSKIARVVENYARRPQVQER 138

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           LT Q+A A+    + +GV V+I+ +H+CM+MRG+++ G  T T+A  G FS
Sbjct: 139 LTGQVADALVRKLEPRGVIVVIDAEHLCMAMRGVRKPGSRTTTSAVRGLFS 189


>gi|297584428|ref|YP_003700208.1| GTP cyclohydrolase I [Bacillus selenitireducens MLS10]
 gi|297142885|gb|ADH99642.1| GTP cyclohydrolase I [Bacillus selenitireducens MLS10]
          Length = 191

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 120/175 (68%), Gaps = 5/175 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ ++A+ +IL  +G+DP+REGL DTP RV + Y E+F G  Q P  ++  +  FGE   
Sbjct: 8   EKIQQAVTMILEAVGEDPNREGLLDTPKRVARMYAEIFEGLHQDP--KEHFKTVFGE--D 63

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           ++++VL+KDI+F S CEHH++P +GK+H+ YIPK   V GLSK+ R +E  ++R Q+QER
Sbjct: 64  HEELVLVKDITFHSVCEHHLVPFFGKVHIGYIPKGGQVTGLSKMARAVEAVTKRPQLQER 123

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG 192
           +T  +A +I  +    GV V++E +HMCM+MRG+++ G  TVT+A  G F + + 
Sbjct: 124 ITSTLADSIVETLTPLGVIVIVEAEHMCMTMRGVRKPGAKTVTSAVRGAFQKSEA 178


>gi|89890739|ref|ZP_01202248.1| GTP cyclohydrolase I [Flavobacteria bacterium BBFL7]
 gi|89516884|gb|EAS19542.1| GTP cyclohydrolase I [Flavobacteria bacterium BBFL7]
          Length = 198

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 78/183 (42%), Positives = 116/183 (63%), Gaps = 3/183 (1%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K   + +++ IG+D  REGL  TP+R  K+ + L +GY + P            A  
Sbjct: 15  EDIKNQYQGVIKNIGEDVTREGLIKTPERAAKAMQFLTSGYDKDPVEILKGAMF---AED 71

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138
           Y DMV+IKDI  +S CEHH+LP +GK H+AYIP  H++GLSK+ RI++V++RRLQ+QERL
Sbjct: 72  YNDMVIIKDIELYSLCEHHMLPFFGKAHIAYIPNGHIVGLSKIPRIVDVFARRLQVQERL 131

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T  I   + ++    GVAV+IE  HMCM MRG+++    T T+ F G+F + + + +F  
Sbjct: 132 THDILECLHNTLKPLGVAVVIEASHMCMMMRGVQKQNSVTTTSGFRGQFEKVETRNEFLK 191

Query: 199 KMT 201
            +T
Sbjct: 192 LIT 194


>gi|170720617|ref|YP_001748305.1| GTP cyclohydrolase I [Pseudomonas putida W619]
 gi|169758620|gb|ACA71936.1| GTP cyclohydrolase I [Pseudomonas putida W619]
          Length = 181

 Score =  164 bits (416), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 112/168 (66%), Gaps = 6/168 (3%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  IG+D  REGL DTP R  K+ K L  GY+Q +    + + F     S   +MVL++
Sbjct: 10  ILSQIGEDVSREGLLDTPKRAAKAMKYLCRGYEQTLEEVTNGALF----TSDNSEMVLVR 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  GK H+AY+PK  V+GLSK+ RI+++++RRLQIQE L+ QIA A+
Sbjct: 66  DIELYSMCEHHMLPFIGKAHVAYLPKGKVLGLSKVARIVDMFARRLQIQENLSRQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKT 194
           +  T + GVAV+IE +HMCM MRG+++   T +T+   GEF RD   T
Sbjct: 126 QQVTGAAGVAVVIEAKHMCMMMRGVEKQNSTMLTSVMLGEF-RDNPAT 172


>gi|116326960|ref|YP_796680.1| GTP cyclohydrolase I [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116332374|ref|YP_802092.1| GTP cyclohydrolase I [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122279899|sp|Q04P36|GCH1_LEPBJ RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|122285191|sp|Q056J8|GCH1_LEPBL RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|116119704|gb|ABJ77747.1| GTP cyclohydrolase I [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116126063|gb|ABJ77334.1| GTP cyclohydrolase I [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 183

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 121/179 (67%), Gaps = 3/179 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           +E I  IL+ IG+DP REGL +TP RV K+Y  L +GY  +  T+  +   F E++  + 
Sbjct: 2   EENIVNILKSIGEDPTREGLLNTPKRVKKAYDFLTSGY-HVDITKVVNGAIFEEST--EG 58

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           M+L++DI  +S CEHH+LP +G+ H+AY+P K +IG+SK+ RI++V++RRLQ+QERLT Q
Sbjct: 59  MILVRDIEVYSLCEHHLLPFYGRAHVAYLPNKKIIGISKIPRIVDVFARRLQVQERLTEQ 118

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           IA+A++   D +GVAV+I+ +H+CM MRG+++      T+   G F  +      FL +
Sbjct: 119 IAYAVQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCLLGAFKENMVTRSEFLDL 177


>gi|153208500|ref|ZP_01946784.1| GTP cyclohydrolase I [Coxiella burnetii 'MSU Goat Q177']
 gi|161829857|ref|YP_001596903.1| GTP cyclohydrolase I [Coxiella burnetii RSA 331]
 gi|41017169|sp|Q83DE3|GCH1_COXBU RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|189045185|sp|A9KFF3|GCH1_COXBN RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|189045186|sp|A9NDB3|GCH1_COXBR RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|120575956|gb|EAX32580.1| GTP cyclohydrolase I [Coxiella burnetii 'MSU Goat Q177']
 gi|161761724|gb|ABX77366.1| GTP cyclohydrolase I [Coxiella burnetii RSA 331]
          Length = 184

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 118/177 (66%), Gaps = 5/177 (2%)

Query: 25  IRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY-KQIPTTQDTSRFHFGEASKYQDMV 83
           ++ IL  +G+DP+REGL+DTP R  K+ + L  GY +++P+    + F  G      +MV
Sbjct: 9   VKAILIALGEDPNREGLRDTPKRYEKALEHLTKGYHEKLPSVVKKAVFQSG----MDEMV 64

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           ++KDI  +S CEHH+LP  G+ H+AY+P   +IG+SKL RI++++++RLQ+QE LT QIA
Sbjct: 65  ILKDIELYSLCEHHLLPFIGRCHVAYLPSGKIIGISKLARIVDMFAKRLQVQENLTKQIA 124

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
            AI ++T++KGV V+IE +H+CM MRG+++      T+   G F +D      FL +
Sbjct: 125 EAILTATEAKGVGVIIEAKHLCMMMRGVEKQNSEMTTSVMLGTFRKDDRTRSEFLSL 181


>gi|322386303|ref|ZP_08059934.1| GTP cyclohydrolase I [Streptococcus cristatus ATCC 51100]
 gi|321269670|gb|EFX52599.1| GTP cyclohydrolase I [Streptococcus cristatus ATCC 51100]
          Length = 184

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 115/180 (63%), Gaps = 5/180 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+  I+  IG+D  REGL++TP R+ K Y+E+FAG  +      +  F   +     +MV
Sbjct: 9   AVAQIIEAIGEDGSREGLQETPQRIAKMYQEIFAGLGETAEEHLSKSFEIID----NNMV 64

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           + KDI F S CEHH LP +GK+H+AY+P   V GLSKL R +EVY+++ QIQERLT++IA
Sbjct: 65  VEKDIFFHSMCEHHFLPFYGKVHIAYVPNGRVAGLSKLARTVEVYAKKPQIQERLTVEIA 124

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFFLKMTH 202
            A+     ++G  V +E +HMCM+MRG+++ G  TVTTA  G  + DK  K + +  M H
Sbjct: 125 EALMDYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGVLATDKDLKNEAYKLMGH 184


>gi|304315889|ref|YP_003851034.1| GTP cyclohydrolase I [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|302777391|gb|ADL67950.1| GTP cyclohydrolase I [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
          Length = 187

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 120/174 (68%), Gaps = 5/174 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+  IL  IG+DP+REGL +TPDRV + Y+E+F+G      T         +  +
Sbjct: 5   EKIKKAVYDILEAIGEDPNREGLLETPDRVARMYEEIFSGLH----TDVMDVIKTFKEDE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +Q++V++KDI  +S CEHH+LP  G  H+AY+P+K  ++GLSKL RI++V +++ Q+QER
Sbjct: 61  HQEIVIVKDIPMYSMCEHHLLPFMGVAHVAYLPRKGTILGLSKLARIVDVLAKKPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDK 191
           LT +IA  I  + +  GVAV++E +H+CM+MRGIK+ G  TVT+A  G F  D+
Sbjct: 121 LTSEIADTIVKAANPLGVAVVVEAEHLCMTMRGIKKPGAKTVTSALRGLFKTDQ 174


>gi|323705607|ref|ZP_08117181.1| GTP cyclohydrolase I [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535084|gb|EGB24861.1| GTP cyclohydrolase I [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 188

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 128/188 (68%), Gaps = 5/188 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+ K+A+  IL  IG+DP REGL +TPDRV + Y+E+F+G  +     D  +  F E  +
Sbjct: 5   EKIKKAVYDILEAIGEDPKREGLLETPDRVARMYEEIFSGLHE--NVMDVIKT-FKE-DE 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK-HVIGLSKLVRILEVYSRRLQIQER 137
           +Q++V++KDI  +S CEHH+LP  G  H+AY+P+K  ++GLSKL RI+++ +++ Q+QER
Sbjct: 61  HQEIVIVKDIPMYSMCEHHLLPFIGVAHVAYLPRKGTILGLSKLARIVDILAKKPQLQER 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT +IA  I  + +  GVAV++E +H+CM+MRGIK+ G  TVT+A  G F  D+   +  
Sbjct: 121 LTSEIADTIVKAANPLGVAVVVEAEHLCMTMRGIKKPGAKTVTSALRGLFKTDQRSREEV 180

Query: 198 LKMTHNQR 205
           + + + +R
Sbjct: 181 MLLINGKR 188


>gi|229592542|ref|YP_002874661.1| GTP cyclohydrolase I [Pseudomonas fluorescens SBW25]
 gi|229364408|emb|CAY52203.1| GTP cyclohydrolase I [Pseudomonas fluorescens SBW25]
          Length = 186

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 82/176 (46%), Positives = 114/176 (64%), Gaps = 5/176 (2%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVL 84
           R IL+ +G+DP+REGL DTP R  K+ + L  GY+Q +    + + F     S   +MV+
Sbjct: 10  REILKGLGEDPEREGLLDTPKRAAKAMQYLCHGYEQNLEEIVNGALF----TSDNDEMVI 65

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +KDI  +S CEHH+LP  GK H+AYIP   V+GLSKL RI+++++RRLQIQE LT QIA 
Sbjct: 66  LKDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKLARIVDMFARRLQIQENLTRQIAD 125

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           AI+  T + GVAV+IE +HMCM MRG+++   T  T+   G F         FL++
Sbjct: 126 AIQDVTQAAGVAVVIEAKHMCMMMRGVEKQNSTMNTSVMLGAFRESNTTRMEFLQL 181


>gi|146282338|ref|YP_001172491.1| GTP cyclohydrolase I [Pseudomonas stutzeri A1501]
 gi|145570543|gb|ABP79649.1| GTP cyclohydrolase I [Pseudomonas stutzeri A1501]
          Length = 214

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 114/176 (64%), Gaps = 5/176 (2%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVL 84
           R IL  +G+DP+REGL+DTP R  K+ + L  GY++ +    + + F    AS   +MV+
Sbjct: 38  RDILTGLGEDPEREGLRDTPTRAAKAMQYLCGGYQRSLEEIVNGALF----ASDNDEMVI 93

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +KDI  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE LT QIA 
Sbjct: 94  VKDIELYSLCEHHLLPFIGKAHVAYIPTGRVLGLSKVARIVDMYARRLQIQENLTRQIAE 153

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           AI+  T + GVAV+IE +HMCM MRG+++      T+   G F         FL++
Sbjct: 154 AIQEVTGAAGVAVVIEAKHMCMMMRGVEKQNSVMNTSVMLGAFRNSCNTRMEFLQL 209


>gi|325693896|gb|EGD35815.1| GTP cyclohydrolase I [Streptococcus sanguinis SK150]
          Length = 184

 Score =  164 bits (415), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 115/180 (63%), Gaps = 5/180 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+  I+  +G+D +REGL++TP R+ K Y+E+FAG  +         F   +     +MV
Sbjct: 9   AVAQIIEAVGEDGNREGLQETPQRIAKMYQEIFAGLGETAEEHLAKSFEIID----NNMV 64

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           + KDI F S CEHH LP +GK+H+AY+P   V GLSKL R +EVY+++ QIQERLT++IA
Sbjct: 65  VEKDIFFHSMCEHHFLPFYGKVHIAYVPNGRVAGLSKLARTVEVYAKKPQIQERLTVEIA 124

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFFLKMTH 202
            A+     ++G  V +E +HMCM+MRG+++ G  TVTTA  G  + DK  K + +  M H
Sbjct: 125 EALMDYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGVLATDKELKNEAYKLMGH 184


>gi|119714709|ref|YP_921674.1| GTP cyclohydrolase I [Nocardioides sp. JS614]
 gi|119535370|gb|ABL79987.1| GTP cyclohydrolase I [Nocardioides sp. JS614]
          Length = 205

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 120/186 (64%), Gaps = 6/186 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  IG+DP+REGL++TP RV ++Y EL AG +  P    T+ F  G    + 
Sbjct: 24  AEAAVRELLIAIGEDPEREGLQETPARVARAYAELTAGLRMEPEDVLTTTFDIG----HD 79

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           +MVL++DI  +S CEHH++P  G  H+ YIP     + GLSKL R+++VY++R Q+QERL
Sbjct: 80  EMVLVRDIELWSMCEHHLVPFTGVAHVGYIPATSGKITGLSKLARLVDVYAKRPQVQERL 139

Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
           T Q+A A+    +++GV V+IE +H+CM+MRG+K+ G  T+T+A  G    +       +
Sbjct: 140 TTQVADALTRLLEARGVIVVIEAEHLCMTMRGVKKAGARTITSAVRGTMRTNPTTRAEAM 199

Query: 199 KMTHNQ 204
            + H +
Sbjct: 200 ALIHRR 205


>gi|320531217|ref|ZP_08032202.1| GTP cyclohydrolase I [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320136586|gb|EFW28549.1| GTP cyclohydrolase I [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 190

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 114/169 (67%), Gaps = 6/169 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  + A+  +L  IG+DP+R+GL+DTP+R+ ++Y E+FAG  Q P       F  G    
Sbjct: 6   EGVRRAVHDLLVAIGEDPERDGLRDTPERMARAYAEMFAGLGQDPAEHVERVFDVG---- 61

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +++MVL++DI  +S CEHH+LP  G  H+ YIP +   V GLSK+ R+++ Y+RR Q+QE
Sbjct: 62  HEEMVLVRDIPMYSVCEHHLLPFHGLAHVGYIPSEDGRVTGLSKVARLVDGYARRPQVQE 121

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           RLT QIA A+    + +GV V++E +H+CMSMRG+++ G  TVT+A  G
Sbjct: 122 RLTRQIADALVERLECRGVLVVVEAEHLCMSMRGVRKPGSNTVTSAVRG 170


>gi|317419543|emb|CBN81580.1| GTP cyclohydrolase 1 [Dicentrarchus labrax]
          Length = 235

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 122/193 (63%), Gaps = 8/193 (4%)

Query: 12  KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT-SR 70
           K + P +E A  +I   LR +G+D DR+GL  TP R  K+ + L  GY +  T  D  + 
Sbjct: 49  KSRLPALEAAYTSI---LRELGEDADRQGLLRTPLRAAKAMQFLTKGYHE--TVDDILNN 103

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
             F E   + +MV++KDI  FS CEHH++P +GK+H+ YIP K V+GLSKL RI+E++SR
Sbjct: 104 AIFDE--DHDEMVIVKDIDMFSLCEHHLVPFFGKVHIGYIPNKKVVGLSKLARIVEIFSR 161

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQ+QERLT QIA  I  +   KGVAV+IE  HMCM MRG+++    TVT+   G +  D
Sbjct: 162 RLQVQERLTKQIAMGISEALQPKGVAVVIEAAHMCMVMRGVQKMNSRTVTSTMLGVYLED 221

Query: 191 KGKTDFFLKMTHN 203
               + FL ++ +
Sbjct: 222 PKTREEFLTLSQH 234


>gi|327198319|ref|YP_004306893.1| FolE [Streptococcus phage Dp-1]
 gi|314912621|gb|ADT64012.1| FolE [Streptococcus phage Dp-1]
          Length = 253

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 114/174 (65%), Gaps = 4/174 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
           T++  + A++ +   +G+D +R+GL+DTP R +K+  E   GY++ P       F     
Sbjct: 71  TLDNTEAAVQRLFGLLGEDAERDGLQDTPFRFVKALAEHTVGYREDPKLHLEKTFDV--- 127

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             ++D+VL+KDI F S CEHH+ P  GK+H+AYIPK  + GLSK  R++E Y++RLQ+QE
Sbjct: 128 -DHEDLVLVKDIPFNSLCEHHLAPFVGKVHIAYIPKDKITGLSKFGRVVEGYAKRLQVQE 186

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLT QIA AI+   + + VAV++E +H CMS RGIK+ G TTVT+   G F  D
Sbjct: 187 RLTQQIADAIQEVLNPQAVAVIVEAEHTCMSGRGIKKHGATTVTSTMRGLFQDD 240


>gi|164423877|ref|XP_958695.2| GTP cyclohydrolase I [Neurospora crassa OR74A]
 gi|157070269|gb|EAA29459.2| GTP cyclohydrolase I [Neurospora crassa OR74A]
          Length = 182

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 81/178 (45%), Positives = 119/178 (66%), Gaps = 6/178 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQ 80
           K A+R +L  IG+DPDREGL  TP+R  K+   L  GY++ +    + + F  G    + 
Sbjct: 2   KGAVRTLLECIGEDPDREGLLATPERYAKAMLFLTKGYQENVRDIVNGAIFQEG----HN 57

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTM 140
           +MV++KDI  FS CEHH++P  GK+H+ YIP   VIG+SKL RI E+++RRLQIQERLT 
Sbjct: 58  EMVIVKDIEVFSMCEHHLVPFTGKMHIGYIPSNAVIGISKLPRIAELFARRLQIQERLTK 117

Query: 141 QIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTDFF 197
           ++A+AI      +GVAV++E  H+CM MRG+++   +T+T+   G F SR+K + +F 
Sbjct: 118 EVANAIMEILKPQGVAVVMESSHLCMVMRGVQKTTSSTITSCVLGCFESREKTRLEFL 175


>gi|16605516|emb|CAC86189.1| GTP cyclohydrolase I [Danio rerio]
          Length = 240

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 116/179 (64%), Gaps = 5/179 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT-SRFHFGEASKYQDM 82
           A   ILR +G++ DR+GL  TP R  K+ + L  GY +  T  D  +   F E   ++++
Sbjct: 62  AYTTILRGLGENTDRQGLLKTPLRAAKAMQFLTKGYHE--TIYDILNDAIFDE--DHEEL 117

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           V++KDI  FS CEHH++P +GK+H+ Y+P K V+GLSKL RI+E+YSRRLQ+QERLT QI
Sbjct: 118 VIVKDIDMFSLCEHHLVPFFGKVHIGYLPSKKVVGLSKLARIVEIYSRRLQVQERLTKQI 177

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           A AI  +    GVAV+IE  HMCM MRG+++    TVT+A  G F  D    + FL + 
Sbjct: 178 AMAISEALQPVGVAVVIEAAHMCMVMRGVQKMNSHTVTSAMLGVFREDPKAREEFLALA 236


>gi|30316363|sp|P51599|GCH1_NEUCR RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|12718339|emb|CAC28574.1| probable GTP cyclohydrolase I [Neurospora crassa]
          Length = 313

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 124/186 (66%), Gaps = 6/186 (3%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFH 72
           K+  +++ K A+R +L  IG+DPDREGL  TP+R  K+   L  GY++ +    + + F 
Sbjct: 125 KQERLDKMKGAVRTLLECIGEDPDREGLLATPERYAKAMLFLTKGYQENVRDIVNGAIFQ 184

Query: 73  FGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRL 132
            G    + +MV++KDI  FS CEHH++P  GK+H+ YIP   VIG+SKL RI E+++RRL
Sbjct: 185 EG----HNEMVIVKDIEVFSMCEHHLVPFTGKMHIGYIPSNAVIGISKLPRIAELFARRL 240

Query: 133 QIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDK 191
           QIQERLT ++A+AI      +GVAV++E  H+CM MRG+++   +T+T+   G F SR+K
Sbjct: 241 QIQERLTKEVANAIMEILKPQGVAVVMESSHLCMVMRGVQKTTSSTITSCVLGCFESREK 300

Query: 192 GKTDFF 197
            + +F 
Sbjct: 301 TRLEFL 306


>gi|319442403|ref|ZP_07991559.1| GTP cyclohydrolase I [Corynebacterium variabile DSM 44702]
          Length = 205

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 117/174 (67%), Gaps = 6/174 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E A+ A+R +L  +G DPDREGL++TP RV ++Y+E+F G  + P       F+      
Sbjct: 22  ERAEAAVRELLFAVGADPDREGLQETPARVARAYREIFDGLFRDPAEVLNKTFN----ED 77

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQE 136
           ++++VL+KDI  +S CEHH++P +G  H+ YIP     V GLSKL R+++ +++R Q+QE
Sbjct: 78  HRELVLVKDIPIYSTCEHHLVPFYGHAHIGYIPGNDGTVTGLSKLARLVDGFAKRPQVQE 137

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLT Q+A A+ +  ++  V V+IE +H+CM+MRGI++ G TTVT+A  G F  D
Sbjct: 138 RLTSQVADAVATRLNASAVIVVIECEHLCMAMRGIRKPGATTVTSAVRGGFRND 191


>gi|170087064|ref|XP_001874755.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164649955|gb|EDR14196.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 181

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 120/182 (65%), Gaps = 5/182 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDM 82
           A+R IL  IG+DPDREGL+ TP+R  ++   +  GY++ +    + + F    A  + +M
Sbjct: 4   AVRTILECIGEDPDREGLQRTPERYAQAIMWMTRGYEERLADVINDAVF----AEDHDEM 59

Query: 83  VLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQI 142
           VL++DI   S CEHH++P  GKI +AYIP + V+GLSKL RI E +SRRLQ+QERLT QI
Sbjct: 60  VLVRDIDISSLCEHHLVPFTGKIAIAYIPNQLVLGLSKLARIAETFSRRLQVQERLTKQI 119

Query: 143 AHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTH 202
           A A++ +   +GVAV++E  H+CM+MRG+++ G  TVT+   G F   +   + FL +  
Sbjct: 120 AIAVQEAIKPRGVAVVMEATHLCMTMRGVQKPGSITVTSCMLGCFRTQQKTREEFLTLIK 179

Query: 203 NQ 204
           ++
Sbjct: 180 SK 181


>gi|298208295|ref|YP_003716474.1| GTP cyclohydrolase I [Croceibacter atlanticus HTCC2559]
 gi|83848216|gb|EAP86086.1| GTP cyclohydrolase I [Croceibacter atlanticus HTCC2559]
          Length = 199

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 118/189 (62%), Gaps = 7/189 (3%)

Query: 9   FNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDT 68
           FN+++     +E K     I+  +G+D  REG+  TP+R  K+ + L +GY  I   +  
Sbjct: 10  FNIEV----TDEIKSQFSSIITNLGEDVAREGIVKTPERAAKAMQFLTSGY-DIDAAEIL 64

Query: 69  SRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVY 128
               F E   Y DMV++K+I  +S CEHH+LP +GK H+AYIP  H++GLSKL R+++V+
Sbjct: 65  KGAMFKE--DYNDMVVVKNIELYSLCEHHMLPFFGKAHIAYIPNGHIVGLSKLPRVVDVF 122

Query: 129 SRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFS 188
           +RRLQ+QERLT  I   I  +   KGVAV+IE  HMCM MRG+++   TT T+ F G+F 
Sbjct: 123 ARRLQVQERLTHDILECINDTLKPKGVAVVIEASHMCMMMRGVQKQNSTTTTSGFRGQFE 182

Query: 189 RDKGKTDFF 197
             + + +F 
Sbjct: 183 AQETRNEFL 191


>gi|309810901|ref|ZP_07704702.1| GTP cyclohydrolase I [Dermacoccus sp. Ellin185]
 gi|308435207|gb|EFP59038.1| GTP cyclohydrolase I [Dermacoccus sp. Ellin185]
          Length = 197

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 114/168 (67%), Gaps = 6/168 (3%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
           + A+R IL  +G++PDREGL +TP RV ++Y E+FAG +Q P       F       +++
Sbjct: 18  EAAVREILLAVGENPDREGLVETPARVARAYAEIFAGLRQNPEDVLVKTFDV----DHEE 73

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQERLT 139
           ++L++DI  +S CEHH++P  G  H+ YIP     V GLSKL R+++V+++R Q+QERLT
Sbjct: 74  LILVRDIEVYSTCEHHLVPFHGVAHVGYIPSTSGRVTGLSKLARLVDVFAKRPQVQERLT 133

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
            QIA A+    D++GV V+IE +H+CMSMRGI++ G  T+T+A  G+ 
Sbjct: 134 TQIADALVEHLDAQGVIVVIEAEHLCMSMRGIRKPGARTITSAVRGQL 181


>gi|326773866|ref|ZP_08233148.1| GTP cyclohydrolase I [Actinomyces viscosus C505]
 gi|326636005|gb|EGE36909.1| GTP cyclohydrolase I [Actinomyces viscosus C505]
          Length = 202

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 113/169 (66%), Gaps = 6/169 (3%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E  + A+  +L  IG+DP+R+GL+DTP+R+ ++Y E+FAG  Q P       F  G    
Sbjct: 18  EGVRRAVHDLLVAIGEDPERDGLRDTPERMARAYAEMFAGLDQDPAEHVERVFDVG---- 73

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKK--HVIGLSKLVRILEVYSRRLQIQE 136
           +++MVL++DI  +S CEHH+LP  G  H+ YIP +   V GLSK+ R+++ Y+RR Q+QE
Sbjct: 74  HEEMVLVRDIPMYSVCEHHLLPFHGLAHVGYIPSEDGRVTGLSKVARLVDGYARRPQVQE 133

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           RLT QIA A+      +GV V++E +H+CMSMRG+++ G  TVT+A  G
Sbjct: 134 RLTRQIADALVERLQCRGVLVVVEAEHLCMSMRGVRKPGSNTVTSAVRG 182


>gi|331013255|gb|EGH93311.1| GTP cyclohydrolase I [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 181

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 108/173 (62%), Gaps = 3/173 (1%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKD 87
           IL  +G+D  REGL DTP R  K+ + L  GY Q             +AS   +MV++KD
Sbjct: 10  ILGQLGEDVSREGLLDTPKRPAKAMQYLCRGYAQTLEEVTNGALFSSDAS---EMVMVKD 66

Query: 88  ISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIE 147
           I  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE L+ QIA AI+
Sbjct: 67  IELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENLSRQIAEAIQ 126

Query: 148 SSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
             T + GVAV+IE +HMCM MRG+++     +T+   GEF  +      FL +
Sbjct: 127 QVTGALGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSL 179


>gi|254283183|ref|ZP_04958151.1| GTP cyclohydrolase I [gamma proteobacterium NOR51-B]
 gi|219679386|gb|EED35735.1| GTP cyclohydrolase I [gamma proteobacterium NOR51-B]
          Length = 184

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 115/174 (66%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           I+  IG+D  R GL+DTP R  K++K L  GY Q + T  + + F     +   +MVL++
Sbjct: 8   IIEAIGEDVTRPGLEDTPKRAAKAFKFLTRGYDQELDTVVNNALF----PTDSSEMVLVQ 63

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           DI  +S CEHH+LP  G+ H+AYIP   V+GLSK+ RI+++Y+RRLQIQE+LT+QIA+A+
Sbjct: 64  DIEMYSLCEHHMLPFIGRCHVAYIPTGKVLGLSKVARIVDMYARRLQIQEQLTLQIANAV 123

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           +  TD++GV V+IE +HMCM MRG+++    T T+   G F  D      FL +
Sbjct: 124 QQVTDAEGVGVIIEAEHMCMMMRGVEKQNSVTKTSTMLGSFREDARTRREFLSL 177


>gi|183222791|ref|YP_001840787.1| GTP cyclohydrolase I [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189912822|ref|YP_001964377.1| GTP cyclohydrolase I [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|229487973|sp|B0S8X8|GCH1_LEPBA RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|229487974|sp|B0SRX6|GCH1_LEPBP RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|167777498|gb|ABZ95799.1| GTP cyclohydrolase I [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167781213|gb|ABZ99511.1| GTP cyclohydrolase I [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 183

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 116/176 (65%), Gaps = 3/176 (1%)

Query: 25  IRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVL 84
           I  IL+ IG+DP+REGL  TP+RV K+Y  L +GYK     Q  +   F E +    MVL
Sbjct: 5   IEEILKQIGEDPNREGLVKTPNRVKKAYDFLTSGYKA-DINQLVNGAIFEENTT--GMVL 61

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           ++DI  +S CEHH+LP +G+ H+AYIP K +IG+SK+ RI++V++RRLQ+QERLT QIA 
Sbjct: 62  VRDIEMYSLCEHHLLPFYGRAHVAYIPNKKIIGISKIPRIVDVFARRLQVQERLTDQIAQ 121

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           AI+ + D  GV V+I+ +H+CM MRG+++      T++  G F  D      FL +
Sbjct: 122 AIQETLDPLGVGVVIKAKHLCMMMRGVEKQNSELFTSSLLGLFKTDPTTRSEFLDL 177


>gi|322377575|ref|ZP_08052065.1| GTP cyclohydrolase I [Streptococcus sp. M334]
 gi|321281340|gb|EFX58350.1| GTP cyclohydrolase I [Streptococcus sp. M334]
          Length = 184

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 112/172 (65%), Gaps = 4/172 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+++I+  +G+D +REGL++TP RV + Y+E+F+G  Q      +  F   +     +MV
Sbjct: 9   AVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID----DNMV 64

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           + KDI F + CEHH LP +GK H+AYIP   V GLSKL R +EVYS++ QIQERL +++A
Sbjct: 65  VEKDIFFHTMCEHHFLPFYGKAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIEVA 124

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
            A+     +KG  V+IE +HMCMSMRG+++ G  T+TT   G F  DK   D
Sbjct: 125 DALMEYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRD 176


>gi|294891154|ref|XP_002773447.1| GTP cyclohydrolase I, putative [Perkinsus marinus ATCC 50983]
 gi|239878600|gb|EER05263.1| GTP cyclohydrolase I, putative [Perkinsus marinus ATCC 50983]
          Length = 258

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 119/184 (64%), Gaps = 4/184 (2%)

Query: 24  AIRVILRWI-GDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQD 81
           A R IL  I G+D DR+GL+ TP R  ++ + L  GY + +    + + F   E S   +
Sbjct: 76  AARRILESIDGEDADRQGLQKTPMRYARALEFLTKGYSESLEEIVNDAVFDV-EPSDNDE 134

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+++DI  FS CEHH+LP +G + + YIP+  V+GLSKL RI E++SRRLQ+QER+T Q
Sbjct: 135 MVMVRDIDMFSLCEHHLLPFYGTVDIGYIPRGKVLGLSKLARITEMFSRRLQVQERMTQQ 194

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTDFFLKM 200
           IA A+E + +  GVAV+I   HMCMSMRGI++   +T T+   G F S  K + +FF  +
Sbjct: 195 IARAVEEAINPMGVAVVIRASHMCMSMRGIQKTSASTTTSCVLGAFRSNPKTRAEFFSLI 254

Query: 201 THNQ 204
           +H Q
Sbjct: 255 SHKQ 258


>gi|294891152|ref|XP_002773446.1| GTP cyclohydrolase I, putative [Perkinsus marinus ATCC 50983]
 gi|239878599|gb|EER05262.1| GTP cyclohydrolase I, putative [Perkinsus marinus ATCC 50983]
          Length = 259

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 119/184 (64%), Gaps = 4/184 (2%)

Query: 24  AIRVILRWI-GDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQD 81
           A R IL  I G+D DR+GL+ TP R  ++ + L  GY + +    + + F   E S   +
Sbjct: 77  AARRILESIDGEDADRQGLQKTPMRYARALEFLTKGYSESLEEIVNDAVFDV-EPSDNDE 135

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV+++DI  FS CEHH+LP +G + + YIP+  V+GLSKL RI E++SRRLQ+QER+T Q
Sbjct: 136 MVMVRDIDMFSLCEHHLLPFYGTVDIGYIPRGKVLGLSKLARITEMFSRRLQVQERMTQQ 195

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF-SRDKGKTDFFLKM 200
           IA A+E + +  GVAV+I   HMCMSMRGI++   +T T+   G F S  K + +FF  +
Sbjct: 196 IARAVEEAINPMGVAVVIRASHMCMSMRGIQKTSASTTTSCVLGAFRSNPKTRAEFFSLI 255

Query: 201 THNQ 204
           +H Q
Sbjct: 256 SHKQ 259


>gi|327480588|gb|AEA83898.1| GTP cyclohydrolase I [Pseudomonas stutzeri DSM 4166]
          Length = 185

 Score =  164 bits (414), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 110/163 (67%), Gaps = 5/163 (3%)

Query: 26  RVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVL 84
           R IL  +G+DP+REGL+DTP R  K+ + L  GY++ +    + + F    AS   +MV+
Sbjct: 9   RDILTGLGEDPEREGLRDTPTRAAKTMQYLCGGYQRSLEEIVNGALF----ASDNDEMVI 64

Query: 85  IKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAH 144
           +KDI  +S CEHH+LP  GK H+AYIP   V+GLSK+ RI+++Y+RRLQIQE LT QIA 
Sbjct: 65  VKDIELYSLCEHHLLPFIGKAHVAYIPTGRVLGLSKVARIVDMYARRLQIQENLTRQIAE 124

Query: 145 AIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           AI+  T + GVAV+IE +HMCM MRG+++      T+   G F
Sbjct: 125 AIQEVTGAAGVAVVIEAKHMCMMMRGVEKQNSVMNTSVMLGAF 167


>gi|326433888|gb|EGD79458.1| GTP cyclohydrolase I [Salpingoeca sp. ATCC 50818]
          Length = 418

 Score =  164 bits (414), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 117/179 (65%), Gaps = 3/179 (1%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R +L  +G+DP R GL DTP RV K+   +  GY QIP     +   F E   + DMV
Sbjct: 241 AVRELLVCLGEDPSRPGLLDTPRRVAKALDFMTRGYTQIPGRVIRNAI-FPE--DHDDMV 297

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           ++KDI FFS CEHH++P +GK+H+ Y+P+K V+GLSK  R++EV+SRRLQ+QERLT QIA
Sbjct: 298 IVKDIEFFSMCEHHMVPFFGKVHIGYLPRKKVLGLSKFARVVEVFSRRLQVQERLTKQIA 357

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTH 202
             +    +  G AV++E QHMCM MRG+++   TT T+   G F  D    D FL++ +
Sbjct: 358 EVLMEVLNPTGCAVIVEAQHMCMLMRGVQKTQTTTTTSTMLGTFRVDARTRDEFLRLLY 416


>gi|330842858|ref|XP_003293386.1| GTP cyclohydrolase I [Dictyostelium purpureum]
 gi|325076301|gb|EGC30099.1| GTP cyclohydrolase I [Dictyostelium purpureum]
          Length = 230

 Score =  164 bits (414), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 120/182 (65%), Gaps = 4/182 (2%)

Query: 17  TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEA 76
            +E  + +++ +L  +G+D  REGL  TP R+ K+      GY+Q    +      F E 
Sbjct: 45  VLENMQGSVKNLLECLGEDTSREGLLKTPLRMSKALLFFTHGYEQ-SVDEVVGEAIFNE- 102

Query: 77  SKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQE 136
             + +MV+++DI  FS CEHH++P  GK H+ YIP + V+GLSKL RI E+++RRLQ+QE
Sbjct: 103 -NHHEMVVVRDIDIFSLCEHHMVPFHGKCHIGYIPDQKVLGLSKLARIAEIFARRLQVQE 161

Query: 137 RLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD-KGKTD 195
           RLT QIA AI+++ +  GVAV+IE  HMCM MRG+++ G +TVT++  G F +D + + +
Sbjct: 162 RLTRQIAQAIQTALNPMGVAVVIEASHMCMVMRGVQKPGASTVTSSVCGIFEKDSRTRAE 221

Query: 196 FF 197
           FF
Sbjct: 222 FF 223


>gi|226944459|ref|YP_002799532.1| GTP cyclohydrolase I [Azotobacter vinelandii DJ]
 gi|259647316|sp|C1DHG2|GCH1_AZOVD RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|226719386|gb|ACO78557.1| GTP cyclohydrolase I [Azotobacter vinelandii DJ]
          Length = 181

 Score =  164 bits (414), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 111/174 (63%), Gaps = 5/174 (2%)

Query: 28  ILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSRFHFGEASKYQDMVLIK 86
           IL  +G+D  REGL DTP R  K+ + L  GY+Q +    + + F    +S   +MV++K
Sbjct: 10  ILAQLGEDVSREGLVDTPKRAAKAMQYLCRGYQQTLEEVVNGALF----SSDNSEMVMVK 65

Query: 87  DISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAI 146
           +I  +S CEHH+LP  GK H+AY+P   V+GLSK+ RI+++++RRLQIQE LT QIA A+
Sbjct: 66  NIELYSLCEHHMLPFIGKAHVAYLPNGKVLGLSKVARIVDMFARRLQIQENLTRQIAEAV 125

Query: 147 ESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKM 200
           E  T + GV V+IE QHMCM MRG+++   T VT+   G F  +      FL +
Sbjct: 126 EQVTGASGVGVVIEAQHMCMMMRGVEKQNSTLVTSVMLGHFRSNTATRSEFLSL 179


>gi|241889398|ref|ZP_04776699.1| GTP cyclohydrolase I [Gemella haemolysans ATCC 10379]
 gi|241863941|gb|EER68322.1| GTP cyclohydrolase I [Gemella haemolysans ATCC 10379]
          Length = 186

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 112/173 (64%), Gaps = 5/173 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78
           E+++E I+ +L  IG+D  R GL DTP R +K Y+EL +     P  +  + F     S 
Sbjct: 5   EQSQELIKTLLENIGEDTSRAGLLDTPKRCVKMYEELLSKTNVDPKEEINTFFE----SD 60

Query: 79  YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPK-KHVIGLSKLVRILEVYSRRLQIQER 137
             + +L+KDI F+S CEHH+LP +G  H+AY+P  K + GLSKL R++E  SRRLQIQE 
Sbjct: 61  NDEPILVKDIQFYSLCEHHMLPFYGVCHIAYVPNNKKITGLSKLARLVESASRRLQIQED 120

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           +T+ + +AIE     KGV V+IE +HMCM+MRGIK+ G  TVT+  TG F  D
Sbjct: 121 MTLMLVNAIEEQLQPKGVYVIIEAEHMCMAMRGIKKIGSKTVTSKKTGVFLED 173


>gi|303259403|ref|ZP_07345380.1| GTP cyclohydrolase I [Streptococcus pneumoniae SP-BS293]
 gi|303261158|ref|ZP_07347107.1| GTP cyclohydrolase I [Streptococcus pneumoniae SP14-BS292]
 gi|303263486|ref|ZP_07349409.1| GTP cyclohydrolase I [Streptococcus pneumoniae BS397]
 gi|303265778|ref|ZP_07351676.1| GTP cyclohydrolase I [Streptococcus pneumoniae BS457]
 gi|303267791|ref|ZP_07353593.1| GTP cyclohydrolase I [Streptococcus pneumoniae BS458]
 gi|302637995|gb|EFL68481.1| GTP cyclohydrolase I [Streptococcus pneumoniae SP14-BS292]
 gi|302639337|gb|EFL69795.1| GTP cyclohydrolase I [Streptococcus pneumoniae SP-BS293]
 gi|302642487|gb|EFL72832.1| GTP cyclohydrolase I [Streptococcus pneumoniae BS458]
 gi|302644686|gb|EFL74935.1| GTP cyclohydrolase I [Streptococcus pneumoniae BS457]
 gi|302647259|gb|EFL77483.1| GTP cyclohydrolase I [Streptococcus pneumoniae BS397]
          Length = 184

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 112/172 (65%), Gaps = 4/172 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+++I+  +G+D +REGL++TP RV + Y+E+F+G  Q      +  F   +     +MV
Sbjct: 9   AVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID----DNMV 64

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           + KDI F + CEHH LP +GK H+AYIP   V GLSKL R +EVYS++ QIQERL +++A
Sbjct: 65  VEKDIFFHTMCEHHFLPFYGKAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIEVA 124

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTD 195
            A+     +KG  V+IE +HMCMSMRG+++ G  T+TT   G F  DK   D
Sbjct: 125 DALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRD 176


>gi|119469674|ref|ZP_01612543.1| GTP cyclohydrolase I [Alteromonadales bacterium TW-7]
 gi|119446921|gb|EAW28192.1| GTP cyclohydrolase I [Alteromonadales bacterium TW-7]
          Length = 184

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/181 (43%), Positives = 116/181 (64%), Gaps = 3/181 (1%)

Query: 20  EAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKY 79
           E K++ + I+  +G+D +REGL DTP R  K+ + L  GY+Q   T D    +    S  
Sbjct: 4   ELKDSYQKIITAVGEDAEREGLLDTPKRAAKAMEYLTQGYRQ---TLDEITNNAVFTSDA 60

Query: 80  QDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLT 139
            DMVL+++I  +S CEHH+LP  G+ H+AYIP   V+GLSK  RI++++SRR QIQE+LT
Sbjct: 61  DDMVLVQNIELYSMCEHHLLPFIGRCHIAYIPNGKVLGLSKFARIVDMFSRRFQIQEQLT 120

Query: 140 MQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLK 199
            QIA A+E  T +KGV V++E +HMCM MRG+++   +  T+   G F  D    + FL+
Sbjct: 121 HQIAKAVEEVTGAKGVGVIVEAKHMCMMMRGVEKQNSSMRTSVMLGNFRSDPKTRNEFLQ 180

Query: 200 M 200
           +
Sbjct: 181 L 181


>gi|325282098|ref|YP_004254640.1| GTP cyclohydrolase 1 [Odoribacter splanchnicus DSM 20712]
 gi|324313907|gb|ADY34460.1| GTP cyclohydrolase 1 [Odoribacter splanchnicus DSM 20712]
          Length = 208

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 117/183 (63%), Gaps = 3/183 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            K   E+     + IL+ +G+DPDREGL  TP RV K+ + +  GY + P     S   F
Sbjct: 20  NKTKTEQLSYHYKEILKLLGEDPDREGLVKTPYRVAKAMQFMTRGYHENPEEILRSAL-F 78

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   Y+ MV++K+I  +S CEHH+LP  G+ H+AYIP  ++ GLSK+ R++E +SRRLQ
Sbjct: 79  KE--DYRQMVIVKNIEIYSMCEHHMLPFIGQAHVAYIPNGYITGLSKIARVVEAFSRRLQ 136

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           +QERLT  I + I+++ +  GVAV+IE QHMCM MRG+++    T T+ F+G F +   +
Sbjct: 137 VQERLTNDIKNCIQNTLNPLGVAVVIEAQHMCMMMRGVQKQNSVTTTSDFSGAFEKLATR 196

Query: 194 TDF 196
            +F
Sbjct: 197 EEF 199


>gi|283457234|ref|YP_003361804.1| GTP cyclohydrolase I [Rothia mucilaginosa DY-18]
 gi|283133219|dbj|BAI63984.1| GTP cyclohydrolase I [Rothia mucilaginosa DY-18]
          Length = 198

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 116/182 (63%), Gaps = 19/182 (10%)

Query: 13  LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-----IPTTQD 67
           + +P +E A   +R IL  IG+DPDR+GL+ TP RV ++Y E F+G  Q     + TT D
Sbjct: 12  VDQPRIEAA---VREILLAIGEDPDRDGLQQTPARVARAYAEFFSGLHQDAGEILGTTFD 68

Query: 68  TSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRIL 125
            +         + +MVL+KDI F+S CEHH++P  G  H+ YIP     V GLSKL R++
Sbjct: 69  IA---------HSEMVLVKDIPFYSTCEHHLVPFHGVAHVGYIPGPDGKVTGLSKLARVV 119

Query: 126 EVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           ++Y+RR Q+QERLT Q+  A+E   + +G  V+IE +HMCMSMRG+++ G  TVT+A  G
Sbjct: 120 DLYARRPQVQERLTTQVVEALEEHLNPRGAIVVIEAEHMCMSMRGVRKPGAKTVTSAVRG 179

Query: 186 EF 187
             
Sbjct: 180 AL 181


>gi|125717076|ref|YP_001034209.1| GTP cyclohydrolase I [Streptococcus sanguinis SK36]
 gi|323353611|ref|ZP_08088144.1| GTP cyclohydrolase I [Streptococcus sanguinis VMC66]
 gi|166220294|sp|A3CKF4|GCH1_STRSV RecName: Full=GTP cyclohydrolase 1; AltName: Full=GTP
           cyclohydrolase I; Short=GTP-CH-I
 gi|125496993|gb|ABN43659.1| GTP cyclohydrolase I, putative [Streptococcus sanguinis SK36]
 gi|322121557|gb|EFX93320.1| GTP cyclohydrolase I [Streptococcus sanguinis VMC66]
 gi|325689575|gb|EGD31580.1| GTP cyclohydrolase I [Streptococcus sanguinis SK115]
 gi|327467015|gb|EGF12529.1| GTP cyclohydrolase I [Streptococcus sanguinis SK330]
 gi|332364248|gb|EGJ42023.1| GTP cyclohydrolase I [Streptococcus sanguinis SK1059]
 gi|332364512|gb|EGJ42283.1| GTP cyclohydrolase I [Streptococcus sanguinis SK355]
          Length = 184

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 114/180 (63%), Gaps = 5/180 (2%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+  I+  +G+D  REGL++TP R+ K Y+E+FAG  +         F   +     +MV
Sbjct: 9   AVAQIIEAVGEDGSREGLQETPQRIAKMYQEIFAGLGETAEEHLAKSFEIID----NNMV 64

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           + KDI F S CEHH LP +GK+H+AY+P   V GLSKL R +EVY+++ QIQERLT++IA
Sbjct: 65  VEKDIFFHSMCEHHFLPFYGKVHIAYVPNGRVAGLSKLARTVEVYAKKPQIQERLTVEIA 124

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKG-KTDFFLKMTH 202
            A+     ++G  V +E +HMCM+MRG+++ G  TVTTA  G  + DK  K + +  M H
Sbjct: 125 EALMDYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGVLATDKDLKNEAYKLMGH 184


>gi|325961736|ref|YP_004239642.1| GTP cyclohydrolase I [Arthrobacter phenanthrenivorans Sphe3]
 gi|323467823|gb|ADX71508.1| GTP cyclohydrolase I [Arthrobacter phenanthrenivorans Sphe3]
          Length = 214

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 116/180 (64%), Gaps = 9/180 (5%)

Query: 10  NMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTS 69
           + K+ +P +E A   +R IL  IG+DPDR GL DTP RV K+Y E+FAG    P    ++
Sbjct: 26  HQKVDRPRIEAA---VREILLAIGEDPDRGGLVDTPKRVAKAYAEVFAGLHHDPADVLST 82

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEV 127
            F       ++++VL+KDI F+S CEHH++P  G  H+ YIP     V GLSKL R++++
Sbjct: 83  TFDL----DHEELVLVKDIPFYSTCEHHLVPFHGVAHVGYIPSHDGKVTGLSKLARLVDI 138

Query: 128 YSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEF 187
           Y+RR Q+QERLT +I  A+      +G  V++E +HMCMSMRGI++ G  TVT+A  G+ 
Sbjct: 139 YARRPQVQERLTTEIVEAMVRYLKPRGAIVVVECEHMCMSMRGIRKPGAKTVTSAVRGQL 198


>gi|226304115|ref|YP_002764073.1| GTP cyclohydrolase I [Rhodococcus erythropolis PR4]
 gi|226183230|dbj|BAH31334.1| GTP cyclohydrolase I [Rhodococcus erythropolis PR4]
          Length = 205

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 112/167 (67%), Gaps = 6/167 (3%)

Query: 21  AKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQ 80
           A+ A+R +L  +G+DP+R GL DTP RV +SYKE+FAG    P     + F  G    +Q
Sbjct: 24  AEAAVRELLIAVGEDPERPGLLDTPARVARSYKEIFAGLYSEPDDALNTTFDEG----HQ 79

Query: 81  DMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKH--VIGLSKLVRILEVYSRRLQIQERL 138
           ++VL++DI  FS CEHH++   G  H+ YIP K   V GLSKL R++++Y++R Q+QERL
Sbjct: 80  ELVLVRDIPMFSTCEHHLVSFHGVAHVGYIPGKSGKVTGLSKLARVVDLYAKRPQVQERL 139

Query: 13