PSIBLAST alignment of GI: 255764506 and protein with PDB id: 1n3t

>gi|38492506|pdb|1N3T|F Chain F, Biosynthesis Of Pteridins. Reaction Mechanism Of Gtp Cyclohydrolase I Length = 221
>gi|38492507|pdb|1N3T|G Chain G, Biosynthesis Of Pteridins. Reaction Mechanism Of Gtp Cyclohydrolase I Length = 221
 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 64/195 (32%), Positives = 101/195 (51%), Gaps = 5/195 (2%)

Query: 12  KLKKPTVEE-AKEAIRVILRWIGDDPDREGLKDTPDRVIKSY-KELFAGYKQIPTTQDTS 69
           ++   T +      +  I++ +  D   + L +TP R+ K Y  E+F+G       + T 
Sbjct: 29  EMDNETRKSLIAGHMTEIMQLLNLDLADDSLMETPHRIAKMYVDEIFSGLDYANFPKITL 88

Query: 70  RFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYS 129
                   K  +MV ++DI+  S CEHH + I GK  +AYIPK  VIGLSK+ RI++ ++
Sbjct: 89  ---IENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFA 145

Query: 130 RRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSR 189
           +R Q+QERLT QI  A+++   +  VAV I+  H  +  RGI+     T TT+  G F  
Sbjct: 146 QRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYSVKARGIRDATSATTTTSLGGLFKS 205

Query: 190 DKGKTDFFLKMTHNQ 204
            +     FL+   + 
Sbjct: 206 SQNTRHEFLRAVRHH 220