RPSBLAST alignment for GI: 255764506 and conserved domain: TIGR00063

>gnl|CDD|129173 TIGR00063, folE, GTP cyclohydrolase I. GTP cyclohydrolase I (EC 3.5.4.16) catalyzes the biosynthesis of formic acid and dihydroneopterin triphosphate from GTP. This reaction is the first step in the biosynthesis of tetrahydrofolate in prokaryotes, of tetrahydrobiopterin in vertebrates, and of pteridine-containing pigments in insects. Length = 180
 Score =  198 bits (506), Expect = 7e-52
 Identities = 89/175 (50%), Positives = 118/175 (67%), Gaps = 3/175 (1%)

Query: 24  AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMV 83
           A+R IL  IG+D +REGL +TP RV K Y E+F+GY      + T    F E  K+ +MV
Sbjct: 4   AMREILELIGEDLNREGLLETPKRVAKMYVEIFSGYDYANFPKITLAI-FQE--KHDEMV 60

Query: 84  LIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIA 143
           L++DI+F S CEHH++P  GK H+AYIPK  VIGLSK+ RI+E ++RR Q+QERLT QIA
Sbjct: 61  LVRDITFTSTCEHHLVPFDGKAHVAYIPKDKVIGLSKIARIVEFFARRPQVQERLTQQIA 120

Query: 144 HAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198
            A++   +  GVAV++E  HMCM MRGI++ G  TVT+A  G F  D+     FL
Sbjct: 121 EALQEILEPNGVAVVVEATHMCMKMRGIRKPGSATVTSALGGLFKSDQKTRAEFL 175