RPSBLAST alignment for GI: 255764506 and conserved domain: pfam01227

>gnl|CDD|144718 pfam01227, GTP_cyclohydroI, GTP cyclohydrolase I. This family includes GTP cyclohydrolase enzymes and a family of related bacterial proteins. Length = 86
 Score =  142 bits (361), Expect = 6e-35
 Identities = 48/86 (55%), Positives = 65/86 (75%)

Query: 100 PIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLI 159
           P +GK H+AYIP   VIGLSKL R ++ ++RRLQ+QERLT QIA A+  +   KGVAV+I
Sbjct: 1   PFFGKAHIAYIPNGKVIGLSKLARYVDSFARRLQVQERLTNQIADALVEALKPKGVAVVI 60

Query: 160 EGQHMCMSMRGIKRDGLTTVTTAFTG 185
           E +H+CM+MRG+++ G  TVT+A  G
Sbjct: 61  EAEHLCMTMRGVRKPGSKTVTSALRG 86