>gnl|CDD|29764 cd00651, TFold, Tunnelling fold (T-fold). The five known T-folds are found in five different enzymes with different functions: dihydroneopterin-triphosphate epimerase (DHNTPE), dihydroneopterin aldolase (DHNA) , GTP cyclohydrolase I (GTPCH-1), 6-pyrovoyl tetrahydropterin synthetase (PTPS), and uricase (UO,uroate/urate oxidase). They bind to substrates belonging to the purine or pterin families, and share a fold-related binding site with a glutamate or glutamine residue anchoring the substrate and a lot of conserved interactions. They also share a similar oligomerization mode: several T-folds join together to form a beta(2n)alpha(n) barrel, then two barrels join together in a head-to-head fashion to made up the native enzymes. The functional enzyme is a tetramer for UO, a hexamer for PTPS, an octamer for DHNA/DHNTPE and a decamer for GTPCH-1. The substrate is located in a deep and narrow pocket at the interface between monomers. In PTPS, the active site is located at the interface of three monomers, two from one trimer and one from the other trimer. In GTPCH-1, it is also located at the interface of three subunits, two from one pentamer and one from the other pentamer. There are four equivalent active sites in UO, six in PTPS, eight in DHNA/DHNTPE and ten in GTPCH-1. Each globular multimeric enzyme encloses a tunnel which is lined with charged residues for DHNA and UO, and with basic residues in PTPS. The N and C-terminal ends are located on one side of the T-fold while the residues involved in the catalytic activity are located at the opposite side. In PTPS, UO and DHNA/DHNTPE, the N and C-terminal extremities of the enzyme are located on the exterior side of the functional multimeric enzyme. In GTPCH-1, the extra C-terminal helix places the extremity inside the tunnel.. Length = 122

 Score = 43.2 bits (101), Expect = 6e-05
 Identities = 20/120 (16%), Positives = 39/120 (32%), Gaps = 16/120 (13%)

Query: 80  QDMVLIKDISFFSYC----EHHILPIWGKIHLAYIPKKHV----------IGLSKLVRIL 125
            D V +KD+   +          +    ++ +                     + + R+ 
Sbjct: 1   TDGVRVKDLLKVTRLGFVTLERTVGQIFEVDVTLSWDGKKAAASDDVATDTVYNTIYRLA 60

Query: 126 EVYSRRLQIQERLTMQIAHAIESSTDSK--GVAVLIEGQHMCMSMRGIKRDGLTTVTTAF 183
           + Y    Q+ ERL  +IA+ I     S    V V  +  H  +  RG+ +   +   T  
Sbjct: 61  KEYVEGSQLIERLAEEIAYLIAEHFLSSVAEVKVEEKKPHAVIPDRGVFKPTDSPGVTIE 120