RPSBLAST alignment of GI: 255764506 and MMDB domain: 1a8r_A_1-79

>1a8r_A (A:1-79) GTP cyclohydrolase I; purine hydrolysis, pterine synthesis; HET: GTP; 2.10A {Escherichia coli}Length = 79
 Score = 67.5 bits (165), Expect = 1e-12
 Identities = 11/47 (23%), Positives = 21/47 (44%), Gaps = 1/47 (2%)

Query: 14 KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSY-KELFAGY 59
           +         +  I++ +  D   + L +TP R+ K Y  E+F+G 
Sbjct: 32 NETRKSLIAGHMTEIMQLLNLDLADDSLMETPHRIAKMYVDEIFSGL 78