RPSBLAST alignment of GI: 255764506 and protein with PDBid: 1a8r

>1a8r_A GTP cyclohydrolase I; purine hydrolysis, pterine synthesis; HET: GTP; 2.10A {Escherichia coli} SCOP: d.96.1.1 PDB: 1n3r_A* 1fbx_A 1gtp_A 1n3s_A* 1n3t_F* 1a9c_A* Length = 221
 Score =  162 bits (410), Expect = 8e-41
 Identities = 62/186 (33%), Positives = 95/186 (51%), Gaps = 4/186 (2%)

Query: 19  EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSY-KELFAGYKQIPTTQDTSRFHFGEAS 77
                 +  I++ +  D   + L +TP R+ K Y  E+F+G                   
Sbjct: 37  SLIAGHMTEIMQLLNLDLADDSLMETPHRIAKMYVDEIFSGLDY---ANFPKITLIENKM 93

Query: 78  KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137
           K  +MV ++DI+  S CE H + I GK  +AYIPK  VIGLSK+ RI++ +++R Q+QER
Sbjct: 94  KVDEMVTVRDITLTSTCESHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQER 153

Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197
           LT QI  A+++   +  VAV I+  H C+  RGI+     T TT+  G F   +     F
Sbjct: 154 LTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRHEF 213

Query: 198 LKMTHN 203
           L+   +
Sbjct: 214 LRAVRH 219