255764507

255764507

guanylate kinase

GeneID in NCBI database:8209930Locus tag:CLIBASIA_04045
Protein GI in NCBI database:255764507Protein Accession:YP_003065323.2
Gene range:+(888015, 888683)Protein Length:222aa
Gene description:guanylate kinase
COG prediction:[F] Guanylate kinase
KEGG prediction:gmk; guanylate kinase (EC:2.7.4.8); K00942 guanylate kinase [EC:2.7.4.8]
SEED prediction:Guanylate kinase (EC 2.7.4.8)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:Purine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL
cccccccccccccccEEEEEEccccccHHHHHHHHHcccccEEEEEEEEEcccccccccccccccccHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHccccEEEEccHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
cccEEcccHHHHccccEEEEEccccccHHHHHHHHHHccccEEEccEEEcccccccccEcccEEEccHHHHHHHHHcccEEEEEEEccEEEEEEHHHHHHHHHHccEEEEEccHHHHHHHHccHHHccEEEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcc
mnrdrlfpltvnhRGMMliisspsgvgksTIARHLLKCDQNFEMSISVTtrvrrpnevdgkdyYFLSLSRFNELKKANAFIEKAEVhgnfygtlrdpIEETISKGKDMLFDIDWQGAQNLHKQmgsnvlsffilppTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL
MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCdqnfemsisvttrvrrpnevdgKDYYFLSLSRFNELKKANAFIEKAEvhgnfygtlrDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRakknqedkekVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERirrhrlkngiggfvgkllkeel
MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL
*************RGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKE**
MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAK*********QLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL
**RDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRxxxxxxxxxxxxxxxxxxxxxIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL
MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL
MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target222 guanylate kinase [Candidatus Liberibacter asiaticus str
254780132186 guanylate kinase [Candidatus Liberibacter asiaticu 7e-18
254781197185 guanylate kinase [Candidatus Liberibacter asiaticu 2e-17
>gi|254780132|ref|YP_003064545.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 186 Back     alignment 
 Score = 82.0 bits (201), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 66/128 (51%)

Query: 17  MLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKK 76
           + ++   SGVGK+TIA+ ++   +   M + VTTR  R +E    DY F+S S+F   K 
Sbjct: 4   IFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKH 63

Query: 77  ANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPP 136
              FIE  +V   +YG L++ I   +  G D+L  +  QG   L K     V S FI PP
Sbjct: 64  TGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPP 123

Query: 137 TMQELCSR 144
           +  EL  R
Sbjct: 124 SEAELIQR 131
>gi|254781197|ref|YP_003065610.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Back     alignment 
 Score = 80.9 bits (198), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 91/190 (47%), Gaps = 11/190 (5%)

Query: 17  MLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKK 76
           + ++   SGVG++TIA+ ++   +   M + VTTR  R +E    DY F+S S+F   K 
Sbjct: 4   IFVLIGASGVGETTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKH 63

Query: 77  ANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPP 136
              FIE  +V   +YG L++ I   +  G D+L  +  QG   L K     V S FI PP
Sbjct: 64  TGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPP 123

Query: 137 TMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVI 196
           +  EL  R   R K+ ++    +   L        K   Y + ++N+ L  +   +  + 
Sbjct: 124 SEAELIQR---RIKRREDTPFNLDPDL------FGKNHSYSFTIVNNHLPTACRQVGFIR 174

Query: 197 EVERIRRHRL 206
           E   +++HR+
Sbjct: 175 EF--VKQHRI 182

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target222 guanylate kinase [Candidatus Liberibacter asiaticus str
315122659224 guanylate kinase [Candidatus Liberibacter solanacearum 1 5e-94
86357086220 guanylate kinase [Rhizobium etli CFN 42] Length = 220 1 2e-62
190891130220 guanylate kinase [Rhizobium etli CIAT 652] Length = 220 1 4e-62
222148146220 guanylate kinase [Agrobacterium vitis S4] Length = 220 1 5e-62
116251329220 guanylate kinase [Rhizobium leguminosarum bv. viciae 38 1 2e-61
209548665220 guanylate kinase [Rhizobium leguminosarum bv. trifolii 1 8e-61
150395983219 guanylate kinase [Sinorhizobium medicae WSM419] Length 1 1e-60
15964900219 guanylate kinase [Sinorhizobium meliloti 1021] Length = 1 1e-60
325292480220 Guanylate kinase [Agrobacterium sp. H13-3] Length = 220 1 2e-59
15888441220 guanylate kinase [Agrobacterium tumefaciens str. C58] L 1 5e-59
>gi|315122659|ref|YP_004063148.1| guanylate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 224 Back     alignment and organism information
 Score =  347 bits (891), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 196/222 (88%)

Query: 1   MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDG 60
           MNR  L P+TV+HRG+MLIISSPSGVGKSTIARH+LK D NFEMSISVTTR RRP+EVDG
Sbjct: 1   MNRYHLSPMTVDHRGIMLIISSPSGVGKSTIARHILKSDHNFEMSISVTTRSRRPDEVDG 60

Query: 61  KDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNL 120
           +DY+FL+L++F EL+KA+AFIE AEVHGNFYGTLRDPIE  IS+G+DMLFDIDWQGA +L
Sbjct: 61  EDYHFLTLNKFEELQKAHAFIEWAEVHGNFYGTLRDPIERAISQGRDMLFDIDWQGAHHL 120

Query: 121 HKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVL 180
            K M S+++SFFILPPTM EL SRL +RA KNQE+KE VQLRL+NAY EIK+W +YDYV+
Sbjct: 121 RKHMKSDIVSFFILPPTMHELRSRLIMRATKNQEEKEMVQLRLKNAYLEIKQWNYYDYVI 180

Query: 181 INDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL 222
           +NDDLE+SL ++KSVI VER+RR+RL N I GFVG+LL+EE+
Sbjct: 181 VNDDLEDSLGMVKSVIGVERMRRNRLINSISGFVGRLLEEEV 222



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357086|ref|YP_468978.1| guanylate kinase [Rhizobium etli CFN 42] Length = 220 Back     alignment and organism information
>gi|190891130|ref|YP_001977672.1| guanylate kinase [Rhizobium etli CIAT 652] Length = 220 Back     alignment and organism information
>gi|222148146|ref|YP_002549103.1| guanylate kinase [Agrobacterium vitis S4] Length = 220 Back     alignment and organism information
>gi|116251329|ref|YP_767167.1| guanylate kinase [Rhizobium leguminosarum bv. viciae 3841] Length = 220 Back     alignment and organism information
>gi|209548665|ref|YP_002280582.1| guanylate kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 220 Back     alignment and organism information
>gi|150395983|ref|YP_001326450.1| guanylate kinase [Sinorhizobium medicae WSM419] Length = 219 Back     alignment and organism information
>gi|15964900|ref|NP_385253.1| guanylate kinase [Sinorhizobium meliloti 1021] Length = 219 Back     alignment and organism information
>gi|325292480|ref|YP_004278344.1| Guanylate kinase [Agrobacterium sp. H13-3] Length = 220 Back     alignment and organism information
>gi|15888441|ref|NP_354122.1| guanylate kinase [Agrobacterium tumefaciens str. C58] Length = 220 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target222 guanylate kinase [Candidatus Liberibacter asiaticus str
PRK00300205 PRK00300, gmk, guanylate kinase; Provisional 9e-79
TIGR03263180 TIGR03263, guanyl_kin, guanylate kinase 3e-66
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2e-39
smart00072184 smart00072, GuKc, Guanylate kinase homologues 3e-39
pfam00625182 pfam00625, Guanylate_kin, Guanylate kinase 1e-36
PRK14738206 PRK14738, gmk, guanylate kinase; Provisional 3e-35
PRK14737186 PRK14737, gmk, guanylate kinase; Provisional 7e-35
PLN02772398 PLN02772, PLN02772, guanylate kinase 5e-29
KOG0707231 KOG0707, KOG0707, KOG0707, Guanylate kinase [Nucleotide 1e-23
KOG0609542 KOG0609, KOG0609, KOG0609, Calcium/calmodulin-dependent 3e-19
COG0194191 COG0194, Gmk, Guanylate kinase [Nucleotide transport an 3e-58
COG3709192 COG3709, COG3709, Uncharacterized component of phosphon 9e-06
TIGR02322179 TIGR02322, phosphon_PhnN, phosphonate metabolism protei 0.002
>gnl|CDD|178968 PRK00300, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|132307 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information
>gnl|CDD|73180 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|128386 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|144280 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|184809 PRK14738, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|178371 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|35926 KOG0707, KOG0707, KOG0707, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|35829 KOG0609, KOG0609, KOG0609, Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|30543 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|33504 COG3709, COG3709, Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162806 TIGR02322, phosphon_PhnN, phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 222 guanylate kinase [Candidatus Liberibacter asiaticus str
PRK00300208 gmk guanylate kinase; Provisional 100.0
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 100.0
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 100.0
pfam00625182 Guanylate_kin Guanylate kinase. 100.0
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 100.0
KOG0609542 consensus 100.0
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 100.0
KOG0707231 consensus 100.0
TIGR02322183 phosphon_PhnN phosphonate metabolism protein/1,5-bispho 99.96
COG3709192 Uncharacterized component of phosphonate metabolism [In 99.9
KOG0708359 consensus 99.75
PRK05480209 uridine kinase; Provisional 98.9
PRK00698204 tmk thymidylate kinase; Validated 98.59
PRK08356195 hypothetical protein; Provisional 98.58
TIGR01359189 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006 98.54
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 98.54
PRK11545177 gntK gluconate kinase 1; Provisional 98.53
PRK04220306 2-phosphoglycerate kinase; Provisional 98.47
PRK02496185 adk adenylate kinase; Provisional 98.46
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 98.41
PRK08233182 hypothetical protein; Provisional 98.39
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 98.39
PRK09825176 idnK D-gluconate kinase; Provisional 98.37
PRK03839180 putative kinase; Provisional 98.37
PRK12339197 2-phosphoglycerate kinase; Provisional 98.34
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 98.32
PRK01184183 hypothetical protein; Provisional 98.31
PTZ00301210 uridine kinase; Provisional 98.25
PRK00131175 aroK shikimate kinase; Reviewed 98.23
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 98.22
PRK00279215 adk adenylate kinase; Reviewed 98.21
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 98.17
PRK04182178 cytidylate kinase; Provisional 98.11
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 98.1
PRK13973216 thymidylate kinase; Provisional 98.05
PRK13975198 thymidylate kinase; Provisional 98.02
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 98.01
PRK13974212 thymidylate kinase; Provisional 98.0
KOG3079195 consensus 97.95
PRK12337492 2-phosphoglycerate kinase; Provisional 97.91
PRK13946195 shikimate kinase; Provisional 97.9
PRK12338320 hypothetical protein; Provisional 97.89
PRK13947171 shikimate kinase; Provisional 97.89
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 97.86
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 97.8
PRK03731172 aroL shikimate kinase II; Reviewed 97.73
PRK07933213 thymidylate kinase; Validated 97.73
PRK04040189 adenylate kinase; Provisional 97.68
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 97.64
PRK03003474 engA GTP-binding protein EngA; Reviewed 97.63
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 97.62
PRK05057172 aroK shikimate kinase I; Reviewed 97.61
TIGR01360191 aden_kin_iso1 adenylate kinase; InterPro: IPR006267 Mem 97.58
PRK13948182 shikimate kinase; Provisional 97.53
PRK13949169 shikimate kinase; Provisional 97.51
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 97.49
PRK05541176 adenylylsulfate kinase; Provisional 97.41
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 97.34
PRK00093438 engA GTP-binding protein EngA; Reviewed 97.3
PRK13976202 thymidylate kinase; Provisional 97.26
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 97.23
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 97.23
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 97.17
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 97.01
PRK13808297 adenylate kinase; Provisional 96.96
PRK03846198 adenylylsulfate kinase; Provisional 96.87
COG3265161 GntK Gluconate kinase [Carbohydrate transport and metab 96.76
PRK00889175 adenylylsulfate kinase; Provisional 96.75
PRK11537 317 putative GTP-binding protein YjiA; Provisional 96.65
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 96.56
TIGR01351232 adk adenylate kinases; InterPro: IPR006259 Most members 96.4
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and metabol 96.34
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 96.15
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 96.06
TIGR00235220 udk uridine kinase; InterPro: IPR000764 Uridine kinase 95.8
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 95.37
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 100.0
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 98.34
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 97.97
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 97.77
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 97.75
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 97.71
PRK04195 403 replication factor C large subunit; Provisional 97.68
PRK07667190 uridine kinase; Provisional 97.62
KOG3354191 consensus 97.62
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 97.59
TIGR00041211 DTMP_kinase thymidylate kinase; InterPro: IPR000062 Thy 97.51
KOG1384 348 consensus 97.47
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 97.44
PRK09435325 arginine/ornithine transport system ATPase; Provisional 97.25
KOG3347176 consensus 97.23
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.19
pfam00406186 ADK Adenylate kinase. 97.17
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 97.09
KOG1969 877 consensus 96.98
PRK13342 417 recombination factor protein RarA; Reviewed 96.77
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 96.61
COG0645170 Predicted kinase [General function prediction only] 96.59
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 96.57
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.31
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 96.26
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 96.05
pfam03976229 PPK2 Polyphosphate kinase 2 (PPK2). Inorganic polyphosp 95.71
PRK06696227 uridine kinase; Validated 98.46
PRK09270230 frcK putative fructose transport system kinase; Reviewe 98.37
PRK07429 331 phosphoribulokinase; Provisional 98.19
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 97.95
PRK00625173 shikimate kinase; Provisional 97.81
pfam02223186 Thymidylate_kin Thymidylate kinase. 97.76
PRK06547184 hypothetical protein; Provisional 97.5
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 97.42
pfam01121179 CoaE Dephospho-CoA kinase. This family catalyses the ph 97.23
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 97.21
COG3911183 Predicted ATPase [General function prediction only] 97.05
COG4639168 Predicted kinase [General function prediction only] 96.92
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 96.82
TIGR01187 331 potA polyamine ABC transporter, ATP-binding protein; In 96.52
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 98.3
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.85
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 97.76
PRK07261171 topology modulation protein; Provisional 97.75
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.75
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 97.69
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 97.65
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 97.49
PRK08118167 topology modulation protein; Reviewed 97.47
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 97.44
PRK10789569 putative multidrug transporter membrane\ATP-binding com 97.43
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 97.37
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 97.33
PRK10790593 putative multidrug transporter membrane\ATP-binding com 97.32
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.32
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 97.23
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 97.22
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 97.21
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttransla 97.14
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 97.14
TIGR01192592 chvA glucan exporter ATP-binding protein; InterPro: IPR 97.13
PRK11153 343 metN DL-methionine transporter ATP-binding subunit; Pro 96.97
TIGR00017223 cmk cytidylate kinase; InterPro: IPR003136 This family 96.96
PRK05342 411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 96.8
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 96.74
KOG0057591 consensus 96.6
PTZ002651467 multidrug resistance protein (mdr1); Provisional 96.58
KOG1970 634 consensus 96.52
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 96.39
TIGR01188 343 drrA daunorubicin resistance ABC transporter, ATP-bindi 96.36
COG0802149 Predicted ATPase or kinase [General function prediction 96.32
COG1160444 Predicted GTPases [General function prediction only] 96.12
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 96.08
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 96.06
PRK13764 605 ATPase; Provisional 96.05
PRK10646153 putative ATPase; Provisional 96.05
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 95.8
COG4525259 TauB ABC-type taurine transport system, ATPase componen 95.37
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 98.03
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.97
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 97.79
PRK12289351 ribosome-associated GTPase; Reviewed 97.71
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 97.68
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 97.67
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 97.57
PTZ00088225 adenylate kinase 1; Provisional 97.57
pfam03193161 DUF258 Protein of unknown function, DUF258. 97.54
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 97.51
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 97.41
PRK06762166 hypothetical protein; Provisional 97.36
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 97.34
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 97.23
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 97.23
KOG0058716 consensus 97.21
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 97.19
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 97.17
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 97.16
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 97.15
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 97.13
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 97.13
KOG2004 906 consensus 97.11
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 97.09
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 97.09
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.08
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 97.08
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 97.07
PRK01889353 ribosome-associated GTPase; Reviewed 97.07
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 97.06
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 97.06
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 97.05
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 97.05
PRK00098298 ribosome-associated GTPase; Reviewed 97.05
PRK09984262 phosphonate/organophosphate ester transporter subunit; 97.05
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 97.04
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 97.04
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 97.04
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 97.03
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 97.03
cd03234226 ABCG_White The White subfamily represents ABC transport 97.03
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 97.03
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 97.03
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 97.02
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 97.02
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 97.02
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 97.02
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 97.02
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.0
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 96.99
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.99
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.98
PRK10744257 phosphate transporter subunit; Provisional 96.97
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 96.97
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 96.96
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 96.96
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 96.95
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 96.94
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 96.94
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 96.94
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 96.94
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 96.94
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.94
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 96.92
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 96.92
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 96.92
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 96.92
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 96.92
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 96.91
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 96.91
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 96.91
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 96.9
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 96.9
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 96.9
COG1162301 Predicted GTPases [General function prediction only] 96.89
PRK12288344 ribosome-associated GTPase; Reviewed 96.89
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 96.89
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.89
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 96.89
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 96.89
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.89
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 96.89
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 96.89
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 96.88
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 96.88
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 96.88
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 96.87
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.87
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 96.86
PRK00023225 cmk cytidylate kinase; Provisional 96.86
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 96.86
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 96.85
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 96.85
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 96.85
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 96.85
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 96.85
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.85
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.84
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.84
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.84
PRK03695245 vitamin B12-transporter ATPase; Provisional 96.83
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 96.83
COG3842 352 PotA ABC-type spermidine/putrescine transport systems, 96.83
PRK00089296 era GTP-binding protein Era; Reviewed 96.82
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.82
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.82
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.82
PRK13542224 consensus 96.81
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.81
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 96.81
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.8
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.8
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 96.8
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 96.8
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.8
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 96.8
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 96.79
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 96.79
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 96.79
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 96.79
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 96.78
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 96.78
PRK10908222 cell division protein FtsE; Provisional 96.78
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 96.77
PRK08058329 DNA polymerase III subunit delta'; Validated 96.77
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 96.77
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 96.77
TIGR00630956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 96.73
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 96.73
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.72
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 96.72
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 96.72
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.72
COG4778235 PhnL ABC-type phosphonate transport system, ATPase comp 96.71
PRK13544208 consensus 96.71
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 96.71
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 96.71
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 96.7
COG3596296 Predicted GTPase [General function prediction only] 96.69
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 96.69
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.69
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.69
COG2884223 FtsE Predicted ATPase involved in cell division [Cell d 96.68
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 96.68
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 96.68
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 96.67
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.67
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 96.66
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.65
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 96.64
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 96.63
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 96.61
TIGR02169 1202 SMC_prok_A chromosome segregation protein SMC; InterPro 96.6
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.59
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 96.59
PRK05201 442 hslU ATP-dependent protease ATP-binding subunit; Provis 96.59
TIGR00390 463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 96.57
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 96.57
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 96.56
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 96.56
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 96.55
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 96.55
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 96.54
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 96.53
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 96.53
TIGR00630 956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 96.52
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 96.52
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 96.51
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 96.49
KOG0061 613 consensus 96.48
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 96.47
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 96.47
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 96.45
PRK11288 501 araG L-arabinose transporter ATP-binding protein; Provi 96.45
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S1; Pr 96.44
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 96.43
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 96.41
cd01896233 DRG The developmentally regulated GTP-binding protein ( 96.4
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 96.38
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 96.38
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 96.37
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 96.35
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 96.35
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 96.34
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 96.33
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 96.33
KOG1191531 consensus 96.32
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 96.31
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 96.31
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 96.3
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 96.3
PRK10865 857 protein disaggregation chaperone; Provisional 96.27
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 96.24
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.24
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 96.24
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 96.22
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 96.21
PRK11147 632 ABC transporter ATPase component; Reviewed 96.21
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 96.21
PRK13536306 nodulation factor exporter subunit NodI; Provisional 96.21
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 96.2
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.17
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.17
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 96.17
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 96.16
COG0486454 ThdF Predicted GTPase [General function prediction only 96.16
PRK00635 1809 excinuclease ABC subunit A; Provisional 96.16
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 96.15
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.15
PRK10636638 putative ABC transporter ATP-binding protein; Provision 96.13
PRK11147632 ABC transporter ATPase component; Reviewed 96.12
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 96.12
PRK10246 1047 exonuclease subunit SbcC; Provisional 96.11
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 96.1
KOG0055 1228 consensus 96.09
CHL00095823 clpC Clp protease ATP binding subunit 96.08
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.08
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 96.08
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 96.05
PRK09183258 transposase/IS protein; Provisional 96.04
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 96.04
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.02
PRK00093 438 engA GTP-binding protein EngA; Reviewed 96.01
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 95.99
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.99
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 95.98
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, ATPa 95.97
smart00382148 AAA ATPases associated with a variety of cellular activ 95.96
KOG0744423 consensus 95.96
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 95.92
COG1123539 ATPase components of various ABC-type transport systems 95.92
PRK13768253 GTPase; Provisional 95.91
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 95.9
PRK03918 882 chromosome segregation protein; Provisional 95.9
PRK13409 590 putative ATPase RIL; Provisional 95.87
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.86
PRK06851 368 hypothetical protein; Provisional 95.85
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 95.85
PRK04213195 GTP-binding protein; Provisional 95.84
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 95.84
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 95.84
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein super 95.81
PRK00454196 engB GTPase EngB; Reviewed 95.79
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 95.78
PRK08181269 transposase; Validated 95.77
PRK00635 1809 excinuclease ABC subunit A; Provisional 95.76
PRK13341 726 recombination factor protein RarA/unknown domain fusion 95.76
PRK03003 474 engA GTP-binding protein EngA; Reviewed 95.74
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 95.73
COG0419 908 SbcC ATPase involved in DNA repair [DNA replication, re 95.72
PTZ00243 1560 ABC transporter; Provisional 95.68
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 95.68
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These protein 95.67
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 95.67
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 95.67
COG0410237 LivF ABC-type branched-chain amino acid transport syste 95.66
PRK13549513 xylose transporter ATP-binding subunit; Provisional 95.66
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 95.64
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 95.63
PRK00440318 rfc replication factor C small subunit; Reviewed 95.63
PRK06217185 hypothetical protein; Validated 95.61
PRK06526254 transposase; Provisional 95.61
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 95.61
PRK09700510 D-allose transporter ATP-binding protein; Provisional 95.6
PRK13851343 type IV secretion system protein VirB11; Provisional 95.59
PRK13900332 type IV secretion system ATPase VirB11; Provisional 95.57
TIGR00618 1063 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins 95.57
PRK01156 895 chromosome segregation protein; Provisional 95.56
pfam04670230 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 wa 95.55
PRK10762501 D-ribose transporter ATP binding protein; Provisional 95.53
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 95.52
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 95.5
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 95.47
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 95.43
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 95.43
PRK11860662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 95.43
cd03116159 MobB Molybdenum is an essential trace element in the fo 95.39
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 95.38
PRK13695174 putative NTPase; Provisional 95.36
pfam00004131 AAA ATPase family associated with various cellular acti 95.36
cd03115173 SRP The signal recognition particle (SRP) mediates the 95.35
TIGR01189204 ccmA heme ABC exporter, ATP-binding protein CcmA; Inter 95.31
COG4559259 ABC-type hemin transport system, ATPase component [Inor 95.31
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 95.3
PRK05707328 DNA polymerase III subunit delta'; Validated 95.28
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 95.27
PRK00081199 coaE dephospho-CoA kinase; Reviewed 97.8
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 97.39
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) ca 95.92
pfam01202158 SKI Shikimate kinase. 95.83
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 97.72
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 97.62
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 97.48
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 97.46
PRK10522547 multidrug transporter membrane component/ATP-binding co 97.44
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 97.42
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 97.39
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 97.39
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 97.38
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 97.35
cd03246173 ABCC_Protease_Secretion This family represents the ABC 97.35
TIGR01186 372 proV glycine betaine/L-proline transport ATP binding su 97.34
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 97.33
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 97.32
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 97.25
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 97.22
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 97.22
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 97.19
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 97.14
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 97.13
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 97.13
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 97.11
COG4619223 ABC-type uncharacterized transport system, ATPase compo 97.06
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 97.06
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 97.02
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 97.02
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 97.01
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 97.01
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 96.97
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 96.92
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 96.92
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 96.9
KOG0056790 consensus 96.89
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 96.84
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 96.83
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 96.71
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 96.67
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 96.66
COG1127263 Ttg2A ABC-type transport system involved in resistance 96.53
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 96.52
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 96.51
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 96.48
TIGR02770239 nickel_nikD nickel import ATP-binding protein NikD; Int 96.45
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 96.45
COG4988559 CydD ABC-type transport system involved in cytochrome b 96.4
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 96.38
PRK06761281 hypothetical protein; Provisional 96.01
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 95.8
COG4618580 ArpD ABC-type protease/lipase transport system, ATPase 95.8
KOG00551228 consensus 95.76
pfam00774223 consensus 97.66
KOG3812475 consensus 97.48
KOG3580 1027 consensus 95.8
KOG3209 984 consensus 97.34
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>pfam00625 Guanylate_kin Guanylate kinase Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>KOG0609 consensus Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>KOG0707 consensus Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN; InterPro: IPR012699 Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds , including phosphites as well as phosphonates Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0708 consensus Back     alignment and domain information
>PRK05480 uridine kinase; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006266 This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>pfam07931 CPT Chloramphenicol phosphotransferase-like protein Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>KOG3079 consensus Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information