>cd01898 Obg Obg subfamily. The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation. Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans. The E. coli homolog, ObgE is believed to function in ribosomal biogenesis. Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.

Probab=95.90 E-value=0.0072 Score=38.76 Aligned_cols=53 Identities=17% Similarity=0.248 Sum_probs=34.6 Q ss_pred EEEECCCCCCHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCC---CCCCCCCCHHHH Q ss_conf 999888999989999999974898059982110798998546---875222379998 Q gi|255764507|r 18 LIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVD---GKDYYFLSLSRF 71 (222) Q Consensus 18 ivl~GpsG~GK~tl~~~L~~~~~~~~~~v~~TTR~~R~gE~~---G~dY~Fvs~~~F 71 (222) T Consensus 3 VAiiG~pNvGKSTLlN~l~~~~~~V-~~~pgTT~~~~~g~i~~~~~~~i~~~DtpGi 58 (170) T cd01898 3 VGLVGLPNAGKSTLLSAISNAKPKI-ADYPFTTLVPNLGVVRVDDGRSFVVADIPGL 58 (170) T ss_pred EEEECCCCCCHHHHHHHHHCCCCEE-ECCCCCCCCCEEEEEEECCCCEEEEECCCCC T ss_conf 8998999998999999996787603-2566652374477999369856999648864

HHsearch alignment for GI: 255764507 and conserved domain: cd01898