>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.

Probab=97.32 E-value=0.00046 Score=46.43 Aligned_cols=52 Identities=23% Similarity=0.255 Sum_probs=38.4 Q ss_pred CCCEEEEEECCCCCCHHHHHHHHHHHC-CCEEEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHH Q ss_conf 797299998889999899999999748-980599821107989985468752223799986653 Q gi|255764507|r 13 HRGMMLIISSPSGVGKSTIARHLLKCD-QNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELK 75 (222) Q Consensus 13 ~r~~iivl~GpsG~GK~tl~~~L~~~~-~~~~~~v~~TTR~~R~gE~~G~dY~Fvs~~~F~~~i 75 (222) T Consensus 26 ~~G~~vaivG~sGsGKSTll~ll~gl~~p~~G~I-----------~i~g~di~~~~~~~~r~~i 78 (237) T cd03252 26 KPGEVVGIVGRSGSGKSTLTKLIQRFYVPENGRV-----------LVDGHDLALADPAWLRRQV 78 (237) T ss_pred CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEE-----------EECCEECCCCCHHHHHHHC T ss_conf 7999999999999859999999967765798789-----------9999995518999998601

HHsearch alignment for GI: 255764507 and conserved domain: cd03252