>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=97.19 E-value=0.00092 Score=44.49 Aligned_cols=53 Identities=28% Similarity=0.436 Sum_probs=35.9 Q ss_pred CCCCEEEEEECCCCCCHHHHHHHHHHHCCCEEEEEEEEECCCCCCC--CCCCCCCCCCHHHHHHHHH Q ss_conf 4797299998889999899999999748980599821107989985--4687522237999866530 Q gi|255764507|r 12 NHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNE--VDGKDYYFLSLSRFNELKK 76 (222) Q Consensus 12 ~~r~~iivl~GpsG~GK~tl~~~L~~~~~~~~~~v~~TTR~~R~gE--~~G~dY~Fvs~~~F~~~i~ 76 (222) T Consensus 47 i~~GE~~~ivG~SGsGKSTLLr~i~GL~------------~p~~G~I~~~G~~i~~~~~~~l~~~r~ 101 (269) T cd03294 47 VREGEIFVIMGLSGSGKSTLLRCINRLI------------EPTSGKVLIDGQDIAAMSRKELRELRR 101 (269) T ss_pred ECCCCEEEEECCCCCHHHHHHHHHHCCC------------CCCCEEEEECCEECCCCCHHHHHHHHC T ss_conf 8899999999899848999999997599------------999759999999999999899988525

HHsearch alignment for GI: 255764507 and conserved domain: cd03294