RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764507|ref|YP_003065323.2| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] (222 letters) >gnl|CDD|30543 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism]. Length = 191 Score = 219 bits (561), Expect = 3e-58 Identities = 90/190 (47%), Positives = 132/190 (69%), Gaps = 5/190 (2%) Query: 14 RGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNE 73 +G+++++S PSGVGKST+ + LL+ D S+S TTR RP EVDG DY+F++ F E Sbjct: 3 KGLLIVLSGPSGVGKSTLVKALLE-DDKLRFSVSATTRKPRPGEVDGVDYFFVTEEEFEE 61 Query: 74 LKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFI 133 L + + F+E AE HGN+YGT R+P+E+ +++GKD++ DID QGA + K+M N +S FI Sbjct: 62 LIERDEFLEWAEYHGNYYGTSREPVEQALAEGKDVILDIDVQGALQVKKKMP-NAVSIFI 120 Query: 134 LPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILK 193 LPP+++EL RL R + +E + RL+NA EI + +DYV++NDDLE +L LK Sbjct: 121 LPPSLEELERRLKGR---GTDSEEVIARRLENAKKEISHADEFDYVIVNDDLEKALEELK 177 Query: 194 SVIEVERIRR 203 S+I ER+RR Sbjct: 178 SIILAERLRR 187 >gnl|CDD|73180 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.. Length = 137 Score = 157 bits (400), Expect = 2e-39 Identities = 67/178 (37%), Positives = 96/178 (53%), Gaps = 42/178 (23%) Query: 17 MLIISSPSGVGKSTIARHLLK-CDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELK 75 ++++S PSGVGKST+ + LL+ D NF S+S TTR RP EVDG DY+F+S F L Sbjct: 1 LIVLSGPSGVGKSTLLKRLLEEFDPNFGFSVSHTTRKPRPGEVDGVDYHFVSKEEFERLI 60 Query: 76 KANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILP 135 + F+E AE HGN+YGT + +EE +++GK ++ +ID QGA+ + K+ + +S FILP Sbjct: 61 ENGEFLEWAEFHGNYYGTSKAAVEEALAEGKIVILEIDVQGARQV-KKSYPDAVSIFILP 119 Query: 136 PTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILK 193 P DYV++NDDLE + LK Sbjct: 120 P----------------------------------------DYVIVNDDLEKAYEELK 137 >gnl|CDD|144280 pfam00625, Guanylate_kin, Guanylate kinase. Length = 182 Score = 148 bits (375), Expect = 1e-36 Identities = 74/183 (40%), Positives = 109/183 (59%), Gaps = 5/183 (2%) Query: 18 LIISSPSGVGKSTIARHLLKCDQN-FEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKK 76 +++S PSGVGKS I + LL F S+S TTR RP EVDGKDY+F+S Sbjct: 4 IVLSGPSGVGKSHIKKALLDEYPEKFGYSVSHTTRPPRPGEVDGKDYHFVSKEEMENDIS 63 Query: 77 ANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPP 136 AN F+E AE +GN+YGT ++ IE+ GK + D+D QG + L K + +S FI PP Sbjct: 64 ANEFLEHAEFNGNYYGTSKEAIEQIAESGKICILDVDIQGVKQLRKAE-LSPISVFIKPP 122 Query: 137 TMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVI 196 +++ L RL R E +EK+ R++ A E + + +DY+++NDDL+ + LK ++ Sbjct: 123 SLKVLQRRLKGR---GTEQEEKINKRMEAAEQEFQHYAEFDYIIVNDDLDEAYKKLKEIL 179 Query: 197 EVE 199 E E Sbjct: 180 EAE 182 >gnl|CDD|35926 KOG0707, KOG0707, KOG0707, Guanylate kinase [Nucleotide transport and metabolism]. Length = 231 Score = 105 bits (262), Expect = 1e-23 Identities = 67/193 (34%), Positives = 100/193 (51%), Gaps = 9/193 (4%) Query: 18 LIISSPSGVGKSTIARHLLKCDQN-FEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKK 76 +++S PSGVGKST+ + L + F S+S TTR R EV GK Y+F + F + K Sbjct: 40 IVLSGPSGVGKSTLLKRLREELGGMFGFSVSHTTRTPRAGEVHGKHYHFSTTEEFLSMIK 99 Query: 77 ANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPP 136 N FIE A GN YGT ++ + GK + DID QG Q + + + + FI PP Sbjct: 100 NNEFIEFATFSGNKYGTSIAAVQRLMLSGKVCILDIDLQGVQPI-RATSLDAIYIFIKPP 158 Query: 137 TMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWE---FYDYVLIN-DDLENSLSIL 192 +++ L RL R E +E + RL++A E + E +D V++N D LE + L Sbjct: 159 SIKILEERLRAR---GTETEESLLKRLKSAEEEFEILENSGSFDLVIVNSDRLEEAYKEL 215 Query: 193 KSVIEVERIRRHR 205 + I + H+ Sbjct: 216 EIFISSDDKESHQ 228 >gnl|CDD|35829 KOG0609, KOG0609, KOG0609, Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms]. Length = 542 Score = 90.4 bits (224), Expect = 3e-19 Identities = 52/188 (27%), Positives = 95/188 (50%), Gaps = 11/188 (5%) Query: 18 LIISSPSGVGKSTIARHLLKCD-QNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKK 76 L++ GVG+ + L++ + F ++ TTR R +EVDG +Y+F+S + Sbjct: 343 LVLIGAQGVGRRELKNKLIELNPDRFGTAVPHTTRPPRSDEVDGVEYHFVSKEEMEADIR 402 Query: 77 ANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSF--FIL 134 A F+E E GN YGT D + I+ GK + D++ Q + L + + FI Sbjct: 403 AGKFLEYGEYEGNLYGTSLDSVRNVIASGKICVLDVEPQALKVLRT---AEFKPYVIFIA 459 Query: 135 PPTMQEL-----CSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSL 189 PP+++EL + +S K D++ ++ ++A E + ++D +++N DL+ + Sbjct: 460 PPSLEELRALRKVAVMSTIVAKQFTDEDLQEIIDESARIEQQYGHYFDLIIVNSDLDKTF 519 Query: 190 SILKSVIE 197 LK+ IE Sbjct: 520 RELKTAIE 527 >gnl|CDD|33504 COG3709, COG3709, Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism]. Length = 192 Score = 45.7 bits (108), Expect = 9e-06 Identities = 38/155 (24%), Positives = 65/155 (41%), Gaps = 12/155 (7%) Query: 15 GMMLIISSPSGVGKSTI---ARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRF 71 G ++ + PSG GK T+ AR L V TR P + G+D+ LS + F Sbjct: 5 GRLIAVVGPSGAGKDTLLDAARARLAGRPRLHFVRRVITR---PADAGGEDHDALSEAEF 61 Query: 72 NELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSF 131 N AF + HG YG + I+ ++ G +L + ++ L Sbjct: 62 NTRAGQGAFALSWQAHGLSYGIPAE-IDLWLAAGDVVLVNGSRAVLPQARRRYPQ--LLV 118 Query: 132 FILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNA 166 + + + L RL+ R ++++E+ + RL A Sbjct: 119 VCITASPEVLAQRLAERGRESREE---ILARLARA 150 >gnl|CDD|38419 KOG3209, KOG3209, KOG3209, WW domain-containing protein [General function prediction only]. Length = 984 Score = 36.2 bits (83), Expect = 0.008 Identities = 28/123 (22%), Positives = 45/123 (36%), Gaps = 8/123 (6%) Query: 47 SVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGK 106 V RR E + DY F ++ F L+ + +E N+YGT + P E + Sbjct: 66 QVPCTTRRILEGEVPDYSFSTVPIFLCLEVSGCLLEFGTYESNYYGTPKPP--ECPADDD 123 Query: 107 DMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNA 166 ML D + N + S+ I M+ + ++ +ED QN Sbjct: 124 MMLTDQELLLPPNSAESYRKRTKSYSI----MENAGI--TTPEEEEEEDPGWENGSGQNY 177 Query: 167 YSE 169 E Sbjct: 178 SVE 180 >gnl|CDD|35927 KOG0708, KOG0708, KOG0708, Membrane-associated guanylate kinase MAGUK (contains PDZ, SH3, HOOK and GUK domains) [Nucleotide transport and metabolism]. Length = 359 Score = 32.6 bits (74), Expect = 0.097 Identities = 31/133 (23%), Positives = 50/133 (37%), Gaps = 6/133 (4%) Query: 67 SLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGS 126 S K FI+ + YGT I E KGK L D+ + L + Sbjct: 223 SREEMERDSKEETFIDAGQRSNGLYGTSVASIREVAEKGKHCLLDVGGDAIRRLQ-RNQI 281 Query: 127 NVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLE 186 + FI + ++ + R K ++ K L + E + ++ V+ LE Sbjct: 282 YPIVIFIRVKSKKQ----IKERNLKITGEQAKELLE-RARKLEQELDRYFTLVVQGGSLE 336 Query: 187 NSLSILKSVIEVE 199 LS +K +IE E Sbjct: 337 ELLSQVKDIIEDE 349 >gnl|CDD|37181 KOG1970, KOG1970, KOG1970, Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Energy production and conversion, Replication, recombination and repair]. Length = 634 Score = 31.2 bits (70), Expect = 0.22 Identities = 18/85 (21%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Query: 12 NHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRF 71 +L+++ PSG GKST + L K + +++ + E + FL Sbjct: 107 KLGSRILLLTGPSGCGKSTTVKVLSK-ELGYQLIEWSNPINLKEPENLHNETSFLMFPYQ 165 Query: 72 NELKKANAFIEKAEVHGNFYGTLRD 96 ++L +F+ +A +G+ + D Sbjct: 166 SQLAVFESFLLRATKYGSLQMSGDD 190 >gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 235 Score = 30.5 bits (69), Expect = 0.39 Identities = 12/24 (50%), Positives = 16/24 (66%) Query: 13 HRGMMLIISSPSGVGKSTIARHLL 36 RG +L I PSG GKST+ R ++ Sbjct: 24 RRGEILAIIGPSGSGKSTLLRLIV 47 >gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.. Length = 228 Score = 29.7 bits (67), Expect = 0.62 Identities = 20/69 (28%), Positives = 27/69 (39%), Gaps = 10/69 (14%) Query: 13 HRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFN 72 +G L + SG GKST+AR +L + SI DGKD LS Sbjct: 29 KKGETLGLVGESGSGKSTLARAILGLLKPTSGSI----------IFDGKDLLKLSRRLRK 78 Query: 73 ELKKANAFI 81 +K + Sbjct: 79 IRRKEIQMV 87 >gnl|CDD|146027 pfam03193, DUF258, Protein of unknown function, DUF258. Length = 161 Score = 29.5 bits (67), Expect = 0.77 Identities = 13/39 (33%), Positives = 14/39 (35%), Gaps = 7/39 (17%) Query: 23 PSGVGKSTIARHLLKCDQNFEMSISV-------TTRVRR 54 SGVGKST+ LL IS TT Sbjct: 43 QSGVGKSTLLNALLPELDLRTGEISEKLGRGRHTTTHVE 81 >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.. Length = 151 Score = 29.4 bits (66), Expect = 0.81 Identities = 14/66 (21%), Positives = 24/66 (36%), Gaps = 2/66 (3%) Query: 18 LIISSPSGVGKSTIARHLLKC--DQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELK 75 L++ P G GK+T+AR + + + V +FL F + Sbjct: 22 LLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASDLLEGLVVAELFGHFLVRLLFELAE 81 Query: 76 KANAFI 81 KA + Sbjct: 82 KAKPGV 87 >gnl|CDD|29833 cd01918, HprK_C, HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions. The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.. Length = 149 Score = 29.4 bits (66), Expect = 0.83 Identities = 11/23 (47%), Positives = 18/23 (78%) Query: 15 GMMLIISSPSGVGKSTIARHLLK 37 G+ ++I+ PSG+GKS +A L+K Sbjct: 14 GIGVLITGPSGIGKSELALELIK 36 >gnl|CDD|30835 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 265 Score = 29.3 bits (65), Expect = 0.84 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 16 MMLIISSPSGVGKSTIARHL 35 ++ + S GVGKST+A +L Sbjct: 59 VIAVTSGKGGVGKSTVAVNL 78 >gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 241 Score = 29.4 bits (66), Expect = 0.86 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 13 HRGMMLIISSPSGVGKSTIARHL 35 + G + + PSG GKST+ R L Sbjct: 25 NPGEFVALIGPSGAGKSTLLRCL 47 >gnl|CDD|30909 COG0563, Adk, Adenylate kinase and related kinases [Nucleotide transport and metabolism]. Length = 178 Score = 29.5 bits (66), Expect = 0.87 Identities = 32/156 (20%), Positives = 63/156 (40%), Gaps = 20/156 (12%) Query: 16 MMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELK 75 M ++I P G GKST+A+ L K + T + R + + + Sbjct: 1 MRILILGPPGAGKSTLAKKLAKKLGLPHLD---TGDILRAAIAERTELG----------E 47 Query: 76 KANAFIEKAEV--HGNFYGTLRDPIEETISKGKDMLFDI-----DWQGAQNLHKQMGSNV 128 + +I+K E+ G +++ ++E K +L + + L K++G + Sbjct: 48 EIKKYIDKGELVPDEIVNGLVKERLDEADCKAGFILDGFPRTLCQARALKRLLKELGVRL 107 Query: 129 LSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQ 164 L + L RL R + +++E V+ RL+ Sbjct: 108 DMVIELDVPEELLLERLLGRRVREDDNEETVKKRLK 143 >gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 178 Score = 29.4 bits (66), Expect = 0.91 Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 13 HRGMMLIISSPSGVGKSTIARHLLK 37 G ++ + PSG GKST+ R + Sbjct: 24 EAGEIVALLGPSGSGKSTLLRCIAG 48 >gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 258 Score = 29.0 bits (65), Expect = 0.98 Identities = 12/23 (52%), Positives = 16/23 (69%) Query: 13 HRGMMLIISSPSGVGKSTIARHL 35 ++G M+ I PSG GKST+ R L Sbjct: 28 NQGEMVAIIGPSGAGKSTLLRSL 50 >gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]. Length = 539 Score = 28.6 bits (64), Expect = 1.3 Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 11/53 (20%) Query: 13 HRGMMLIISSPSGVGKSTIARHLLK-----------CDQNFEMSISVTTRVRR 54 G L + SG GKST+AR L Q+ +++ R+RR Sbjct: 315 REGETLGLVGESGSGKSTLARILAGLLPPSSGSIIFDGQDLDLTGGELRRLRR 367 >gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substrates ranges from inorganic ions, nutrients such as amino acids, sugars, or peptides, hydrophobic drugs, to large polypeptides, such as HlyA.. Length = 173 Score = 28.6 bits (64), Expect = 1.3 Identities = 13/22 (59%), Positives = 15/22 (68%) Query: 15 GMMLIISSPSGVGKSTIARHLL 36 G L I PSG GKST+AR +L Sbjct: 28 GESLAIIGPSGSGKSTLARLIL 49 >gnl|CDD|144489 pfam00910, RNA_helicase, RNA helicase. This family includes RNA helicases thought to be involved in duplex unwinding during viral RNA replication. Members of this family are found in a variety of single stranded RNA viruses. Length = 105 Score = 28.4 bits (64), Expect = 1.5 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 18 LIISSPSGVGKSTIARHLLK 37 + + P G GKST+A++L + Sbjct: 1 IWLYGPPGCGKSTLAKYLAR 20 >gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 157 Score = 28.3 bits (63), Expect = 1.8 Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 13 HRGMMLIISSPSGVGKSTIARHLL 36 G ++ + P+G GKST+ R + Sbjct: 23 KAGEIVALVGPNGSGKSTLLRAIA 46 >gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 211 Score = 28.2 bits (63), Expect = 1.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 13 HRGMMLIISSPSGVGKSTIARHL 35 +G ++I P+G GKST+ R L Sbjct: 25 KKGEFVLIVGPNGSGKSTLLRLL 47 >gnl|CDD|73296 cd02020, CMPK, Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.. Length = 147 Score = 28.2 bits (63), Expect = 1.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 20 ISSPSGVGKSTIARHL 35 I P+G GKST+A+ L Sbjct: 4 IDGPAGSGKSTVAKLL 19 >gnl|CDD|110578 pfam01583, APS_kinase, Adenylylsulphate kinase. Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif. Length = 157 Score = 28.0 bits (63), Expect = 1.9 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Query: 14 RGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTT 50 RG + + SG GKSTIA L + + F ISV Sbjct: 1 RGCTVWFTGLSGSGKSTIANALER--KLFAQGISVYV 35 >gnl|CDD|143799 pfam00006, ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain. This family includes the ATP synthase alpha and beta subunits, the ATP synthase associated with flagella and the termination factor Rho. Length = 213 Score = 28.2 bits (64), Expect = 2.1 Identities = 9/29 (31%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Query: 4 DRLFPLTVNHRGMMLIISSPSGVGKSTIA 32 D L P+ +G + I SG GK+ + Sbjct: 7 DLLLPIG---KGQRIGIFGGSGTGKTVLL 32 >gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.. Length = 165 Score = 28.2 bits (62), Expect = 2.2 Identities = 7/20 (35%), Positives = 14/20 (70%) Query: 17 MLIISSPSGVGKSTIARHLL 36 ++++ P+G GK+T+A L Sbjct: 1 LILVFGPTGSGKTTLALQLA 20 >gnl|CDD|32733 COG2909, MalT, ATP-dependent transcriptional regulator [Transcription]. Length = 894 Score = 28.0 bits (62), Expect = 2.2 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 3 RDRLF-PLTVNHRGMMLIISSPSGVGKSTIA 32 R RL L + +++IS+P+G GK+T+ Sbjct: 24 RPRLLDRLRRANDYRLILISAPAGFGKTTLL 54 >gnl|CDD|34390 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 235 Score = 28.0 bits (62), Expect = 2.2 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 9 LTVNHRGMMLIISSPSGVGKSTIARHL 35 L+VN G +++ PSG GKST+ R L Sbjct: 32 LSVN-AGECVVLHGPSGSGKSTLLRSL 57 >gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]. Length = 591 Score = 27.9 bits (62), Expect = 2.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 2 NRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHL 35 N +L+ L G ++ I P+G+GKST + L Sbjct: 87 NGFKLYRLPTPRPGKVVGILGPNGIGKSTALKIL 120 >gnl|CDD|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]. Length = 580 Score = 27.9 bits (62), Expect = 2.4 Identities = 13/22 (59%), Positives = 15/22 (68%) Query: 15 GMMLIISSPSGVGKSTIARHLL 36 G L I PSG GKST+AR L+ Sbjct: 362 GEALGIIGPSGSGKSTLARLLV 383 >gnl|CDD|57925 cd01854, YjeQ_engC, YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.. Length = 287 Score = 27.8 bits (62), Expect = 2.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 14 RGMMLIISSPSGVGKSTIARHLL 36 +G ++ SGVGKST+ LL Sbjct: 160 KGKTSVLVGQSGVGKSTLINALL 182 >gnl|CDD|30194 cd02021, GntK, Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.. Length = 150 Score = 27.9 bits (62), Expect = 2.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 18 LIISSPSGVGKSTIARHL 35 +++ SG GKST+ + L Sbjct: 2 IVVMGVSGSGKSTVGKAL 19 >gnl|CDD|36405 KOG1191, KOG1191, KOG1191, Mitochondrial GTPase [Translation, ribosomal structure and biogenesis]. Length = 531 Score = 27.6 bits (61), Expect = 2.5 Identities = 13/49 (26%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Query: 14 RGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTR--VRRPNEVDG 60 G+ + I VGKS++ L + D++ + TTR + V+G Sbjct: 267 SGLQIAIVGRPNVGKSSLLNALSREDRSIVSPVPGTTRDAIEAQVTVNG 315 >gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 171 Score = 27.7 bits (62), Expect = 2.6 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Query: 9 LTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISV 48 LT+ G + I PSG GKST+ + LL+ I + Sbjct: 23 LTIK-PGEKVAIVGPSGSGKSTLLKLLLRLYDPTSGEILI 61 >gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]. Length = 252 Score = 27.5 bits (61), Expect = 2.7 Identities = 15/35 (42%), Positives = 19/35 (54%) Query: 14 RGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISV 48 RG L I SG GKST+AR L ++ SI + Sbjct: 32 RGETLGIVGESGSGKSTLARLLAGLEKPSSGSILL 66 >gnl|CDD|30875 COG0529, CysC, Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]. Length = 197 Score = 27.5 bits (61), Expect = 2.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Query: 11 VNHRGMMLIISSPSGVGKSTIARHL 35 +G ++ + SG GKSTIA L Sbjct: 19 KGQKGAVIWFTGLSGSGKSTIANAL 43 >gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]. Length = 386 Score = 27.6 bits (61), Expect = 3.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 13 HRGMMLIISSPSGVGKSTIARHL 35 G + +I SG GKST+ R L Sbjct: 52 EEGEIFVIMGLSGSGKSTLVRLL 74 >gnl|CDD|31682 COG1493, HprK, Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms]. Length = 308 Score = 27.5 bits (61), Expect = 3.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Query: 14 RGMMLIISSPSGVGKSTIARHLLK 37 G+ ++I+ PSG GKS +A L+K Sbjct: 144 FGVGVLITGPSGAGKSELALELIK 167 >gnl|CDD|33845 COG4088, COG4088, Predicted nucleotide kinase [Nucleotide transport and metabolism]. Length = 261 Score = 27.2 bits (60), Expect = 3.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Query: 16 MMLIISSPSGVGKSTIARHLLK 37 ++I++ G GK+T A+ L K Sbjct: 2 PLIILTGYPGSGKTTFAKELAK 23 >gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning]. Length = 223 Score = 27.5 bits (61), Expect = 3.2 Identities = 8/25 (32%), Positives = 15/25 (60%) Query: 13 HRGMMLIISSPSGVGKSTIARHLLK 37 +G + ++ PSG GKST+ + + Sbjct: 26 PKGEFVFLTGPSGAGKSTLLKLIYG 50 >gnl|CDD|30631 COG0283, Cmk, Cytidylate kinase [Nucleotide transport and metabolism]. Length = 222 Score = 27.5 bits (61), Expect = 3.4 Identities = 9/20 (45%), Positives = 15/20 (75%) Query: 16 MMLIISSPSGVGKSTIARHL 35 +++ I P+G GKST+A+ L Sbjct: 5 IIIAIDGPAGSGKSTVAKIL 24 >gnl|CDD|33725 COG3944, COG3944, Capsular polysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane]. Length = 226 Score = 27.5 bits (61), Expect = 3.4 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 7/80 (8%) Query: 125 GSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQ-----LRLQNAYSEI-KKWEFYDY 178 S ++SFF++ PT Q +++ + + Q L+L N Y+EI K D Sbjct: 31 ISAIVSFFVIKPTYQS-STQILVNQSDGDSTNLQFQDVQSSLQLVNTYAEIIKSPAVLDE 89 Query: 179 VLINDDLENSLSILKSVIEV 198 V+ LE + S L S I V Sbjct: 90 VVSELGLELTASQLSSKISV 109 >gnl|CDD|32257 COG2074, COG2074, 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]. Length = 299 Score = 27.2 bits (60), Expect = 3.5 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Query: 14 RGMM----LIISSPSGVGKSTIARHL 35 R M ++I SGVGKSTIA L Sbjct: 84 RKMKRPLIILIGGASGVGKSTIAGEL 109 >gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 236 Score = 27.1 bits (60), Expect = 3.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Query: 15 GMMLIISSPSGVGKSTIARHLLK 37 G + I PSG GKSTI R L + Sbjct: 27 GKKVAIVGPSGSGKSTILRLLFR 49 >gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]. Length = 268 Score = 27.1 bits (60), Expect = 3.6 Identities = 22/86 (25%), Positives = 33/86 (38%), Gaps = 14/86 (16%) Query: 14 RGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNE 73 G L + SG GKST+ R +L ++ I +GKD LS+ Sbjct: 38 EGETLGLVGESGCGKSTLGRLILGLEEPTSGEIL----------FEGKD--ITKLSKEER 85 Query: 74 LKKANAFIEKAEVHGNFYGTLRDPIE 99 ++ +EK + F R P E Sbjct: 86 RERVLELLEKVGLPEEFLY--RYPHE 109 >gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 259 Score = 27.2 bits (60), Expect = 3.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 15 GMMLIISSPSGVGKSTIARHL 35 G +L I P+G GKST+ + L Sbjct: 27 GEVLAILGPNGAGKSTLLKAL 47 >gnl|CDD|37215 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]. Length = 906 Score = 27.2 bits (60), Expect = 3.8 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 14 RGMMLIISSPSGVGKSTIAR 33 +G +L P GVGK++IA+ Sbjct: 437 QGKILCFVGPPGVGKTSIAK 456 >gnl|CDD|73290 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.. Length = 99 Score = 27.0 bits (59), Expect = 3.8 Identities = 7/18 (38%), Positives = 14/18 (77%) Query: 18 LIISSPSGVGKSTIARHL 35 ++++ GVGK+T+A +L Sbjct: 2 IVVTGKGGVGKTTLAANL 19 >gnl|CDD|146036 pfam03205, MobB, Molybdopterin guanine dinucleotide synthesis protein B. This protein contains a P-loop. Length = 122 Score = 26.9 bits (60), Expect = 3.9 Identities = 7/20 (35%), Positives = 12/20 (60%) Query: 18 LIISSPSGVGKSTIARHLLK 37 +++ P GK+T+ R LL Sbjct: 3 VLVVGPKDSGKTTLIRKLLN 22 >gnl|CDD|30990 COG0645, COG0645, Predicted kinase [General function prediction only]. Length = 170 Score = 27.2 bits (60), Expect = 4.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 15 GMMLIISSPSGVGKSTIARHL 35 G ++++ G GKST+AR L Sbjct: 1 GRLVLVGGLPGSGKSTLARGL 21 >gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 263 Score = 27.1 bits (60), Expect = 4.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Query: 13 HRGMMLIISSPSGVGKSTIARHLL 36 RG +L I SG GKST+ R +L Sbjct: 32 PRGEILAILGGSGSGKSTLLRLIL 55 >gnl|CDD|73295 cd02019, NK, Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.. Length = 69 Score = 26.8 bits (59), Expect = 4.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 20 ISSPSGVGKSTIARHL 35 I+ SG GKST+A+ L Sbjct: 4 ITGGSGSGKSTVAKKL 19 >gnl|CDD|31343 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]. Length = 284 Score = 26.8 bits (59), Expect = 4.4 Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Query: 19 IISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNEL 74 + S G GK+T+A +L + + V PN + L + E Sbjct: 6 VASGKGGTGKTTVAANLAVLLGDKYKLVLADCDVEAPN-----LHLLLGVEVLEEE 56 >gnl|CDD|73300 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily. Like the other members of the superfamily, MRP contains a ATP-binding domain at the N-termini. It is found in bacteria as a membrane-spanning protein and functions as a Na+/H+ antiporter.. Length = 169 Score = 27.0 bits (60), Expect = 4.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 18 LIISSPSGVGKSTIARHL 35 ++S GVGKST+A +L Sbjct: 3 AVMSGKGGVGKSTVAVNL 20 >gnl|CDD|32252 COG2069, CdhD, CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein) [Energy production and conversion]. Length = 403 Score = 26.9 bits (59), Expect = 4.4 Identities = 9/45 (20%), Positives = 20/45 (44%) Query: 111 DIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQED 155 D+D++ + VLS+ + MQ+ +R L+ ++ Sbjct: 237 DLDYERIAEAALKYDHVVLSWTQMDVNMQKTLNRKLLKRGLPRDR 281 >gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]. Length = 591 Score = 27.1 bits (60), Expect = 4.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Query: 13 HRGMMLIISSPSGVGKSTIARHLLK 37 +G + I +G GKSTI R LL+ Sbjct: 376 PKGEKVAIVGSNGSGKSTILRLLLR 400 >gnl|CDD|31270 COG1072, CoaA, Panthothenate kinase [Coenzyme metabolism]. Length = 283 Score = 26.8 bits (59), Expect = 4.6 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Query: 7 FPLTVNHRGMMLI-ISSPSGVGKSTIAR---HLLKCDQNFEMSISVTT 50 F T N + +I I+ VGKST AR LL VT Sbjct: 73 FLGTNNQQRPFIIGIAGSVAVGKSTTARILQALLSRWPESPKVDLVTM 120 >gnl|CDD|34242 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 223 Score = 26.9 bits (59), Expect = 4.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 13 HRGMMLIISSPSGVGKSTIARHL 35 G + I+ PSG GKST+ + + Sbjct: 27 RAGEFIAITGPSGCGKSTLLKIV 49 >gnl|CDD|145019 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyse amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family. Length = 212 Score = 26.6 bits (59), Expect = 5.0 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 24 SGVGKSTIARHLLKC 38 GVGK+T+A +L + Sbjct: 8 GGVGKTTLAANLARA 22 >gnl|CDD|37459 KOG2248, KOG2248, KOG2248, 3'-5' exonuclease [Replication, recombination and repair]. Length = 380 Score = 26.5 bits (58), Expect = 5.3 Identities = 27/110 (24%), Positives = 49/110 (44%), Gaps = 15/110 (13%) Query: 125 GSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDD 184 G +L F+ P + + + + +ED E + L++ E+ + + +L+ Sbjct: 244 GKVILDTFVKP--NKPVVDYNTRYSGITEEDLENSTITLEDVQKELLELISKNTILVGHS 301 Query: 185 LENSLSILK----SVIEVERIRRHR---------LKNGIGGFVGKLLKEE 221 LEN L LK SVI+ + +H LKN ++GKL++E Sbjct: 302 LENDLKALKLDHPSVIDTAVLFKHPTGPYPFKSSLKNLAKSYLGKLIQEG 351 >gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only]. Length = 444 Score = 26.7 bits (59), Expect = 5.5 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 3/70 (4%) Query: 19 IISSPSGVGKSTIARHLLKCDQNFEMSISVTTR--VRRPNEVDGKDYYFLSLSRFNELKK 76 II P+ VGKS++ +L ++ I+ TTR + E DG+ Y + + K Sbjct: 183 IIGRPN-VGKSSLINAILGEERVIVSDIAGTTRDSIDIEFERDGRKYVLIDTAGIRRKGK 241 Query: 77 ANAFIEKAEV 86 +EK V Sbjct: 242 ITESVEKYSV 251 >gnl|CDD|35279 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism]. Length = 790 Score = 26.5 bits (58), Expect = 5.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Query: 15 GMMLIISSPSGVGKSTIARHLLK 37 G + + PSG GKSTI R L + Sbjct: 564 GKTVALVGPSGAGKSTIMRLLFR 586 >gnl|CDD|34862 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones]. Length = 497 Score = 26.8 bits (59), Expect = 5.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Query: 15 GMMLIISSPSGVGKSTIARHLLK 37 G + I SG GKSTI R L + Sbjct: 289 GKTVAIVGESGAGKSTILRLLFR 311 >gnl|CDD|38232 KOG3022, KOG3022, KOG3022, Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]. Length = 300 Score = 26.4 bits (58), Expect = 5.7 Identities = 9/19 (47%), Positives = 14/19 (73%) Query: 17 MLIISSPSGVGKSTIARHL 35 +L++S GVGKST+ +L Sbjct: 50 ILVLSGKGGVGKSTVTVNL 68 >gnl|CDD|32119 COG1936, COG1936, Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]. Length = 180 Score = 26.4 bits (58), Expect = 5.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 16 MMLIISSPSGVGKSTIARHL 35 M++ I+ GVGK+T+ + L Sbjct: 1 MLIAITGTPGVGKTTVCKLL 20 >gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.. Length = 218 Score = 26.6 bits (59), Expect = 5.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 13 HRGMMLIISSPSGVGKSTIARHL 35 +G + I PSG GKST+ L Sbjct: 28 EKGEFVAIVGPSGSGKSTLLNIL 50 >gnl|CDD|35287 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism]. Length = 728 Score = 26.5 bits (58), Expect = 6.2 Identities = 11/21 (52%), Positives = 16/21 (76%) Query: 15 GMMLIISSPSGVGKSTIARHL 35 GM L+I+ P+G GKS++ R L Sbjct: 508 GMHLLITGPNGCGKSSLFRIL 528 >gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]. Length = 240 Score = 26.2 bits (58), Expect = 6.6 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Query: 9 LTVNHRGMMLIISSPSGVGKSTIAR 33 L+V +G +++I PSG GKST+ R Sbjct: 23 LSVE-KGEVVVIIGPSGSGKSTLLR 46 >gnl|CDD|31047 COG0703, AroK, Shikimate kinase [Amino acid transport and metabolism]. Length = 172 Score = 26.3 bits (58), Expect = 6.6 Identities = 11/24 (45%), Positives = 14/24 (58%) Query: 14 RGMMLIISSPSGVGKSTIARHLLK 37 R M +++ G GKSTI R L K Sbjct: 1 RNMNIVLIGFMGAGKSTIGRALAK 24 >gnl|CDD|31299 COG1102, Cmk, Cytidylate kinase [Nucleotide transport and metabolism]. Length = 179 Score = 26.4 bits (58), Expect = 6.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 16 MMLIISSPSGVGKSTIARHL 35 M++ IS G GK+T+AR L Sbjct: 1 MVITISGLPGSGKTTVAREL 20 >gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQMP system of S. typhimurium, where HisJ is the extracellular solute binding proteins and HisP is the ABC protein.. Length = 213 Score = 26.2 bits (58), Expect = 6.9 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Query: 9 LTVNHRGMMLIISSPSGVGKSTIAR 33 LTV +G +++I PSG GKST+ R Sbjct: 21 LTVK-KGEVVVIIGPSGSGKSTLLR 44 >gnl|CDD|144432 pfam00833, Ribosomal_S17e, Ribosomal S17. Length = 122 Score = 26.1 bits (58), Expect = 7.0 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Query: 184 DLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEE 221 D + + I EV I RL+N I G+V L+K Sbjct: 27 DFQTNKRICD---EVAIIPSKRLRNKIAGYVTHLMKRI 61 >gnl|CDD|33907 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]. Length = 242 Score = 26.1 bits (57), Expect = 7.1 Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Query: 6 LFPLTVN-HRGMMLIISSPSGVGKSTIAR--HLLKCDQNFEMSIS 47 LF +T++ G L++ PSG GKS++ R +LL+ ++ ++I+ Sbjct: 18 LFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIA 62 >gnl|CDD|37239 KOG2028, KOG2028, KOG2028, ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]. Length = 554 Score = 26.2 bits (57), Expect = 7.2 Identities = 39/176 (22%), Positives = 67/176 (38%), Gaps = 22/176 (12%) Query: 18 LIISSPSGVGKSTIARHLLKCDQN---FEMSISVTTRVRRPNEVDGKDYYFLSLSRFNEL 74 +I+ P G GK+T+AR + + + +S T D +D F L Sbjct: 165 MILWGPPGTGKTTLARLIASTSKKHSYRFVELSATN----AKTNDVRD-IFEQAQNEKSL 219 Query: 75 KKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGA--QNLHKQMGSNVLS-- 130 K + E+H F + +D + G DI GA +N Q+ + +LS Sbjct: 220 TKRKTILFIDEIH-RFNKSQQDTFLPHVENG-----DITLIGATTENPSFQLNAALLSRC 273 Query: 131 --FFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDD 184 F + + + + L RA + D E+ L N+ ++ DY+ D Sbjct: 274 RVFVLEKLPVNAVVTILM-RAIASLGDSERPTDPLPNSSMFVED-SIIDYLAYLSD 327 >gnl|CDD|133313 cd04113, Rab4, Rab4 subfamily. Rab4 has been implicated in numerous functions within the cell. It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A. Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane. It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 161 Score = 26.1 bits (58), Expect = 7.9 Identities = 7/20 (35%), Positives = 10/20 (50%) Query: 18 LIISSPSGVGKSTIARHLLK 37 II SG GKS + ++ Sbjct: 3 FIIIGSSGTGKSCLLHRFVE 22 >gnl|CDD|73051 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane. The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.. Length = 214 Score = 26.0 bits (57), Expect = 7.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 14 RGMMLIISSPSGVGKSTIARHLLK 37 G + + PSG GKST+ + + K Sbjct: 26 AGEFVFLVGPSGAGKSTLLKLIYK 49 >gnl|CDD|72995 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domain 1 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.. Length = 255 Score = 26.0 bits (57), Expect = 7.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 2 NRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHL 35 N +L L V G +L + P+G+GKST + L Sbjct: 13 NSFKLHRLPVPREGQVLGLVGPNGIGKSTALKIL 46 >gnl|CDD|111395 pfam02492, cobW, CobW/HypB/UreG, nucleotide-binding domain. This domain is found in HypB, a hydrogenase expression / formation protein, and UreG a urease accessory protein. Both these proteins contain a P-loop nucleotide binding motif. HypB has GTPase activity and is a guanine nucleotide binding protein. It is not known whether UreG binds GTP or some other nucleotide. Both enzymes are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression. UreG is required for functional incorporation of the urease nickel metallocenter. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins. This family of domains also contains P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, and the cobW gene product, which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans. Length = 174 Score = 26.0 bits (58), Expect = 8.2 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 18 LIISSPSGVGKSTIARHLLKCDQNFEMSISV 48 +++ G GK+T+ HLL+ D + I+V Sbjct: 3 TVLTGFLGSGKTTLLEHLLR-DNREGLKIAV 32 >gnl|CDD|48067 cd03490, Topoisomer_IB_N_1, Topoisomer_IB_N_1: A subgroup of the N-terminal DNA binding fragment found in eukaryotic DNA topoisomerase (topo) IB. Topo IB proteins include the monomeric yeast and human topo I and heterodimeric topo I from Leishmania donvanni. Topo I enzymes are divided into: topo type IA (bacterial) and type IB (eukaryotic). Topo I relaxes superhelical tension in duplex DNA by creating a single-strand nick, the broken strand can then rotate around the unbroken strand to remove DNA supercoils and, the nick is religated, liberating topo I. These enzymes regulate the topological changes that accompany DNA replication, transcription and other nuclear processes. Human topo I is the target of a diverse set of anticancer drugs including camptothecins (CPTs). CPTs bind to the topo I-DNA complex and inhibit religation of the single-strand nick, resulting in the accumulation of topo I-DNA adducts. In addition to differences in structure and some biochemical properties, Trypanosomatid parasite topos I differ from human topo I in their sensitivity to CPTs and other classical topo I inhibitors. Trypanosomatid topos I have putative roles in organizing the kinetoplast DNA network unique to these parasites. This family may represent more than one structural domain.. Length = 217 Score = 26.2 bits (57), Expect = 8.3 Identities = 15/64 (23%), Positives = 24/64 (37%), Gaps = 10/64 (15%) Query: 134 LPPTMQELCSRLSLRAKKNQEDKEKV----------QLRLQNAYSEIKKWEFYDYVLIND 183 LPP ++E+ + + N E KEK + + K D+ LI + Sbjct: 32 LPPNLEEIATYWAQSMGTNYETKEKFCKNFWKVFVNSFEKDHKFIRRCKLSDADFSLIKN 91 Query: 184 DLEN 187 LE Sbjct: 92 HLEE 95 >gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.. Length = 205 Score = 26.0 bits (57), Expect = 8.6 Identities = 21/85 (24%), Positives = 37/85 (43%), Gaps = 12/85 (14%) Query: 13 HRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISV-------TTRVRRPNEV-DGKDYY 64 + G ++ ++ +G GK+T+A+ L + SI + R + V DY Sbjct: 24 YAGEIIALTGKNGAGKTTLAKILAGLIKESSGSILLNGKPIKAKERRKSIGYVMQDVDYQ 83 Query: 65 FLSLSRFNEL----KKANAFIEKAE 85 + S EL K+ +A E+AE Sbjct: 84 LFTDSVREELLLGLKELDAGNEQAE 108 >gnl|CDD|72990 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding component of the bacterial CcmAB transporter. The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.. Length = 201 Score = 26.1 bits (57), Expect = 8.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 15 GMMLIISSPSGVGKSTIARHL 35 G L ++ P+G GK+T+ R L Sbjct: 26 GEALQVTGPNGSGKTTLLRIL 46 >gnl|CDD|31663 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]. Length = 366 Score = 25.7 bits (56), Expect = 9.3 Identities = 9/34 (26%), Positives = 16/34 (47%) Query: 4 DRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLK 37 L P R +II P+G GK+ + +++ Sbjct: 31 SFLAPALRGERPSNIIIYGPTGTGKTATVKFVME 64 >gnl|CDD|35591 KOG0370, KOG0370, KOG0370, Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only]. Length = 1435 Score = 25.7 bits (56), Expect = 9.6 Identities = 10/36 (27%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Query: 168 SEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRR 203 +I +W+ + ++ ++ S +KSV EV I R Sbjct: 723 VKIPRWDLSKFQRVSTEIG---SSMKSVGEVMAIGR 755 >gnl|CDD|31356 COG1162, COG1162, Predicted GTPases [General function prediction only]. Length = 301 Score = 25.6 bits (56), Expect = 10.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Query: 2 NRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLL 36 N D L L G + ++ SGVGKST+ LL Sbjct: 151 NGDGLEELAELLAGKITVLLGQSGVGKSTLINALL 185 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0657 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,703,250 Number of extensions: 137329 Number of successful extensions: 763 Number of sequences better than 10.0: 1 Number of HSP's gapped: 753 Number of HSP's successfully gapped: 143 Length of query: 222 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 132 Effective length of database: 4,318,927 Effective search space: 570098364 Effective search space used: 570098364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.1 bits)