BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764507|ref|YP_003065323.2| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] (222 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764507|ref|YP_003065323.2| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 222 Score = 458 bits (1179), Expect = e-131, Method: Compositional matrix adjust. Identities = 222/222 (100%), Positives = 222/222 (100%) Query: 1 MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDG 60 MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDG Sbjct: 1 MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDG 60 Query: 61 KDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNL 120 KDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNL Sbjct: 61 KDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNL 120 Query: 121 HKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVL 180 HKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVL Sbjct: 121 HKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVL 180 Query: 181 INDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL 222 INDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL Sbjct: 181 INDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEEL 222 >gi|254780132|ref|YP_003064545.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 186 Score = 82.0 bits (201), Expect = 7e-18, Method: Compositional matrix adjust. Identities = 46/128 (35%), Positives = 66/128 (51%) Query: 17 MLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKK 76 + ++ SGVGK+TIA+ ++ + M + VTTR R +E DY F+S S+F K Sbjct: 4 IFVLIGASGVGKTTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKH 63 Query: 77 ANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPP 136 FIE +V +YG L++ I + G D+L + QG L K V S FI PP Sbjct: 64 TGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPP 123 Query: 137 TMQELCSR 144 + EL R Sbjct: 124 SEAELIQR 131 >gi|254781197|ref|YP_003065610.1| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 80.9 bits (198), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 55/190 (28%), Positives = 91/190 (47%), Gaps = 11/190 (5%) Query: 17 MLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKK 76 + ++ SGVG++TIA+ ++ + M + VTTR R +E DY F+S S+F K Sbjct: 4 IFVLIGASGVGETTIAKQVVLNSEYLVMPVGVTTRRPRVDEKQYIDYRFISQSQFKGWKH 63 Query: 77 ANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPP 136 FIE +V +YG L++ I + G D+L + QG L K V S FI PP Sbjct: 64 TGLFIETTKVRDEYYGYLKEDINNPMEHGYDILLILTHQGLAPLKKLYEDQVTSIFIAPP 123 Query: 137 TMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVI 196 + EL R R K+ ++ + L K Y + ++N+ L + + + Sbjct: 124 SEAELIQR---RIKRREDTPFNLDPDL------FGKNHSYSFTIVNNHLPTACRQVGFIR 174 Query: 197 EVERIRRHRL 206 E +++HR+ Sbjct: 175 EF--VKQHRI 182 >gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Score = 28.1 bits (61), Expect = 0.12, Method: Compositional matrix adjust. Identities = 12/20 (60%), Positives = 15/20 (75%) Query: 14 RGMMLIISSPSGVGKSTIAR 33 RG +II+ PSG GKST+ R Sbjct: 42 RGERVIIAGPSGSGKSTLIR 61 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 27.7 bits (60), Expect = 0.16, Method: Compositional matrix adjust. Identities = 9/29 (31%), Positives = 19/29 (65%) Query: 10 TVNHRGMMLIISSPSGVGKSTIARHLLKC 38 + ++G++L P GVGK+++A+ + K Sbjct: 361 VIKNKGLILCFVGPPGVGKTSLAQSIAKA 389 >gi|254781121|ref|YP_003065534.1| hypothetical protein CLIBASIA_05115 [Candidatus Liberibacter asiaticus str. psy62] Length = 185 Score = 26.6 bits (57), Expect = 0.33, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 8/59 (13%) Query: 163 LQNAYSEIKKWEFYDYVLINDDLENSLSILKSVIEVERIRRHRLKNGIGGFVGKLLKEE 221 L+N +S +W Y Y +N L SLS+ +V +E +R +G+ F+ L KEE Sbjct: 39 LRNQFS---RWSVYVYPDLNKKLCFSLSVPVTVEPLEGVR-----HGVNFFIISLKKEE 89 >gi|254780829|ref|YP_003065242.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 437 Score = 25.8 bits (55), Expect = 0.64, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 7/36 (19%) Query: 3 RDRLFPLTVNHRGMMLIISSPSGVGKSTIARHLLKC 38 RD L P + ++L+ P+GVGK+ I+R L + Sbjct: 48 RDELMP-----KNILLV--GPTGVGKTAISRRLARL 76 >gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 25.4 bits (54), Expect = 0.88, Method: Compositional matrix adjust. Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 5/30 (16%) Query: 7 FPLTVN-----HRGMMLIISSPSGVGKSTI 31 FP+ N +G ++ + SPSG GKSTI Sbjct: 23 FPVLENVHLSLKKGEIVALVSPSGTGKSTI 52 >gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Score = 24.6 bits (52), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/71 (25%), Positives = 29/71 (40%), Gaps = 16/71 (22%) Query: 20 ISSPSGVGKSTIARHLLKCDQNFEMSISVTT----------------RVRRPNEVDGKDY 63 I P+G GKSTI R + D+ + + T + + N ++G + Sbjct: 37 ILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFTVGYLPQEPQLDLSKTVKENIIEGVAH 96 Query: 64 YFLSLSRFNEL 74 L R+NEL Sbjct: 97 KQAILDRYNEL 107 >gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Score = 23.9 bits (50), Expect = 2.5, Method: Compositional matrix adjust. Identities = 8/17 (47%), Positives = 13/17 (76%) Query: 19 IISSPSGVGKSTIARHL 35 + S P+GVGK+ I++ L Sbjct: 511 VFSGPTGVGKTEISKQL 527 >gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Score = 23.5 bits (49), Expect = 3.1, Method: Compositional matrix adjust. Identities = 11/23 (47%), Positives = 14/23 (60%) Query: 15 GMMLIISSPSGVGKSTIARHLLK 37 G M + PSG GKSTI L++ Sbjct: 379 GKMTALVGPSGSGKSTIINLLMR 401 >gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Score = 23.1 bits (48), Expect = 4.4, Method: Compositional matrix adjust. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 5/42 (11%) Query: 23 PSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYY 64 PSG GKST R L + ++ + + + +DGK+ Y Sbjct: 40 PSGCGKSTFLRCLNRMNETIDNCVFTGEII-----LDGKNIY 76 >gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Score = 23.1 bits (48), Expect = 4.4, Method: Compositional matrix adjust. Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Query: 15 GMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNEL 74 G ++I S GKS++ L K D I TTR ++D + Y + +S + Sbjct: 219 GYKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLD-LEGYLVKISDTAGI 277 Query: 75 KKANAFIEKAEVHGNF 90 ++ + +EK + F Sbjct: 278 RETDDIVEKEGIKRTF 293 >gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Score = 22.7 bits (47), Expect = 5.7, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 18 LIISSPSGVGKSTI 31 ++I PSG GKST+ Sbjct: 28 IVILGPSGAGKSTL 41 >gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 22.3 bits (46), Expect = 6.6, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 14 RGMMLIISSPSGVGKSTIARHL 35 +G +L++ SG GKST+ R + Sbjct: 54 KGEILVLMGLSGAGKSTLLRSI 75 >gi|254780306|ref|YP_003064719.1| DNA topoisomerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 837 Score = 22.3 bits (46), Expect = 7.2, Method: Compositional matrix adjust. Identities = 29/128 (22%), Positives = 51/128 (39%), Gaps = 15/128 (11%) Query: 44 MSISVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIEKAEVHGNFYGTLRDPIEETIS 103 MS VRR D+Y R K NA + N + L +++ + Sbjct: 311 MSPDALEAVRRSITSHYGDHYLPEKPRIYSSKSKNAQEAHEAIRPNDFDFLPSKMKQFLD 370 Query: 104 KGKDMLFDIDWQGAQNLHKQMGS--------NVLSFF-----ILPPTMQELCSRLSLRAK 150 + L+++ W+ +++ QM S N+++ + L T LC L+ Sbjct: 371 SDQFQLYNLIWK--RSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVW 428 Query: 151 KNQEDKEK 158 +NQ D+EK Sbjct: 429 ENQYDQEK 436 >gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Score = 22.3 bits (46), Expect = 7.3, Method: Compositional matrix adjust. Identities = 9/14 (64%), Positives = 12/14 (85%) Query: 24 SGVGKSTIARHLLK 37 SGVGKST+A+ L + Sbjct: 392 SGVGKSTVAKLLYR 405 >gi|254780479|ref|YP_003064892.1| A/G-specific adenine glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 356 Score = 21.9 bits (45), Expect = 8.9, Method: Compositional matrix adjust. Identities = 10/20 (50%), Positives = 15/20 (75%) Query: 19 IISSPSGVGKSTIARHLLKC 38 I+S+ +G+G T AR+L KC Sbjct: 82 ILSAWAGLGYYTRARNLKKC 101 >gi|254780709|ref|YP_003065122.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 321 Score = 21.9 bits (45), Expect = 9.3, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 17/26 (65%) Query: 12 NHRGMMLIISSPSGVGKSTIARHLLK 37 +HR ++++ +GVGK+T+ L K Sbjct: 108 SHRPHVILVVGVNGVGKTTVIGKLSK 133 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.137 0.392 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 143,115 Number of Sequences: 1233 Number of extensions: 5743 Number of successful extensions: 42 Number of sequences better than 100.0: 22 Number of HSP's better than 100.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 24 Number of HSP's gapped (non-prelim): 22 length of query: 222 length of database: 328,796 effective HSP length: 71 effective length of query: 151 effective length of database: 241,253 effective search space: 36429203 effective search space used: 36429203 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 36 (18.5 bits)