Query         gi|255764508|ref|YP_003065363.2| hypothetical protein CLIBASIA_04245 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 242
No_of_seqs    121 out of 1521
Neff          8.2 
Searched_HMMs 13730
Date          Wed Jun  1 10:56:48 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 255764508.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1c7qa_ c.80.1.2 (A:) Phosphog  83.8     1.2 8.6E-05   21.0   6.1  119   65-205    70-197 (442)
  2 d2d13a1 c.26.2.1 (A:2-227) Hyp  78.7     1.8 0.00013   19.9   8.0  110   66-200     4-119 (226)
  3 d1r1ma_ d.79.7.1 (A:) Outer me  72.4     2.6 0.00019   18.8   5.1   63   87-154    21-92  (140)
  4 d2aizp1 d.79.7.1 (P:1-134) Pep  66.3     3.5 0.00025   18.0   5.5   63   87-154    39-110 (134)
  5 d2nzug1 c.93.1.1 (G:58-332) Gl  65.2     3.6 0.00026   17.9   8.4   94  100-198   112-207 (275)
  6 d2hqsc1 d.79.7.1 (C:68-173) Pe  63.8     3.8 0.00028   17.7   6.3   62   88-154    12-82  (106)
  7 d1u94a1 c.37.1.11 (A:6-268) Re  53.6     3.1 0.00023   18.3   2.0   46  135-182    96-141 (263)
  8 d2nvma1 d.326.1.1 (A:2-118) Xi  53.4     2.6 0.00019   18.8   1.6   25  129-154    88-112 (117)
  9 d1vbka1 c.26.2.6 (A:176-307) H  52.8       5 0.00036   17.0   2.9   64  133-200    18-84  (132)
 10 d2nwva1 d.326.1.1 (A:2-113) Hy  50.2     3.8 0.00028   17.7   2.0   24  133-156    79-102 (112)
 11 d2ioja1 c.98.2.2 (A:206-325) H  49.6     6.6 0.00048   16.2   3.2   45  114-169    70-114 (120)
 12 d2nlva1 d.326.1.1 (A:1-111) Hy  49.3       4 0.00029   17.6   2.0   24  133-156    78-101 (111)
 13 d1xp8a1 c.37.1.11 (A:15-282) R  47.3     5.4 0.00039   16.7   2.4   45  136-182   100-144 (268)
 14 d1a9xa2 c.24.1.1 (A:936-1073)   44.0       8 0.00058   15.6   4.3   62  113-192    33-101 (138)
 15 d1mo6a1 c.37.1.11 (A:1-269) Re  41.1     5.8 0.00042   16.5   1.7   53  135-189   102-155 (269)
 16 d1nria_ c.80.1.3 (A:) Hypothet  39.9     9.2 0.00067   15.2   5.5  103   66-184    60-167 (248)
 17 d1jyea_ c.93.1.1 (A:) Lac-repr  39.8     9.3 0.00067   15.2   7.3   93  100-199   110-203 (271)
 18 d1j8yf2 c.37.1.10 (F:87-297) G  38.2     9.8 0.00071   15.0   8.1   72  128-199    53-157 (211)
 19 d1vi6a_ c.23.15.1 (A:) Ribosom  37.6      10 0.00073   15.0   8.8  132   92-241    46-180 (193)
 20 d1w5fa1 c.32.1.1 (A:22-215) Ce  36.4     1.8 0.00013   19.8  -1.5   66  116-182    88-156 (194)
 21 d1dbqa_ c.93.1.1 (A:) Purine r  35.2      11 0.00079   14.7  10.8   93  102-198   113-205 (282)
 22 d1tk9a_ c.80.1.3 (A:) Phosphoh  34.9      11  0.0008   14.7   4.6   99   67-182    43-146 (188)
 23 d1v4va_ c.87.1.3 (A:) UDP-N-ac  34.3      11 0.00082   14.7   9.4   82  113-196   112-225 (373)
 24 d1jq5a_ e.22.1.2 (A:) Glycerol  34.0      11 0.00083   14.6   4.2   10   66-75     86-95  (366)
 25 d1p3wa_ c.67.1.3 (A:) Cysteine  33.0      12 0.00086   14.5   8.3   65  140-205    60-126 (391)
 26 d2ebna_ c.1.8.5 (A:) Endo-beta  32.9      12 0.00087   14.5   6.2  113   66-180    35-167 (285)
 27 d1edta_ c.1.8.5 (A:) Endo-beta  31.3      13 0.00092   14.3   5.3  113   66-181    33-164 (265)
 28 d1vk3a3 d.139.1.1 (A:167-345)   31.1      13 0.00092   14.3   6.8   68  131-205    77-150 (179)
 29 d1xm3a_ c.1.31.1 (A:) Thiazole  30.7      13 0.00094   14.3   6.3   65  142-206    59-135 (251)
 30 d1rq2a1 c.32.1.1 (A:8-205) Cel  28.9      14   0.001   14.1   2.3   66  116-182    89-157 (198)
 31 d1ozha1 c.31.1.3 (A:188-366) C  28.6      14   0.001   14.0   3.8   43   95-145     8-51  (179)
 32 d1t35a_ c.129.1.1 (A:) Hypothe  28.3      14   0.001   14.0   2.3   24  174-197    78-101 (179)
 33 d1yvka1 d.108.1.1 (A:5-156) Hy  28.0      14   0.001   14.0   4.8   40  166-206    86-125 (152)
 34 d1e6ua_ c.2.1.2 (A:) GDP-4-ket  27.7      15  0.0011   13.9   2.4   14  185-198   253-266 (315)
 35 d1gvha3 c.25.1.5 (A:254-396) F  27.6      15  0.0011   13.9   2.4   25  174-198   104-128 (143)
 36 d1utaa_ d.58.52.1 (A:) Cell di  25.2      16  0.0012   13.7   2.0   19  126-144    50-68  (77)
 37 d2f8ja1 c.67.1.1 (A:1-334) His  23.1      18  0.0013   13.4   4.9   65  132-206    63-127 (334)
 38 d1tvca2 c.25.1.2 (A:111-251) M  22.8      17  0.0012   13.5   1.6   26  174-199   102-127 (141)
 39 d1cqxa3 c.25.1.5 (A:262-403) F  22.7      18  0.0013   13.3   2.4   23  175-197   103-125 (142)
 40 d1fg7a_ c.67.1.1 (A:) Histidin  22.4      18  0.0013   13.3   5.6   67  133-205    61-128 (354)
 41 d1vkha_ c.69.1.32 (A:) Putativ  21.8      19  0.0014   13.2   3.6   20  184-203   220-239 (263)
 42 d2b8ea1 c.108.1.7 (A:416-434,A  21.4      19  0.0014   13.2   3.5   54  115-184    40-93  (135)
 43 d1u11a_ c.23.8.1 (A:) N5-CAIR   20.6      20  0.0014   13.1   3.1   82  116-205     6-89  (159)
 44 d1byka_ c.93.1.1 (A:) Trehalos  20.0      20  0.0015   13.0   7.2   87  102-199   109-198 (255)

No 1  
>d1c7qa_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Bacillus stearothermophilus [TaxId: 1422]}
Probab=83.77  E-value=1.2  Score=21.01  Aligned_cols=119  Identities=15%  Similarity=0.069  Sum_probs=62.4

Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHH-HHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             875899962521377776555434682058999-9999999825200575338970688887788827999999997499
Q gi|255764508|r   65 DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI-FETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV  143 (242)
Q Consensus        65 ~~d~IVVLGgG~~~~~~~~~~~~~~~~~~~~Rl-~~a~~L~~~~~~~~~~~~ii~SGg~~~~~~~~Ea~~m~~~l~~~Gv  143 (242)
                      +.+.|||+|-|-.              +...|+ .+++.-+.. .......++.+.+...      ....+.+.+...-.
T Consensus        70 ~~~~vV~iGIGGS--------------~LGpk~~~~aL~~~~~-~~~~~~~~i~f~~~n~------d~~~~~~~l~~l~~  128 (442)
T d1c7qa_          70 HSDALVVIGIGGS--------------YLGARAAIEALSHTFH-NQMNDTTQIYFAGQNI------SSTYISHLLDVLEG  128 (442)
T ss_dssp             HCSEEEEECCGGG--------------THHHHHHHHHHSCTTG-GGSSSSCEEEEESSSC------CHHHHHHHHHHHTT
T ss_pred             CCCEEEEEECCHH--------------HHHHHHHHHHHHHHHH-HHCCCCCCEEEECCCC------CHHHHHHHHHCCCC
T ss_conf             6987999804077--------------7999999999877876-4226665357505889------87899999843477


Q ss_pred             CHHHHHCCHHHHHHHHHHHH---HHHHHHHCC-----CCCEEEECCHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             98781111014665777999---999976236-----864088534588999999999769818998426
Q gi|255764508|r  144 ERDDIKLETQSLDTFQNAQF---SSSMIKNMQ-----GKNIILVSSAYHLKRSQLYFQHFGINTKASCSD  205 (242)
Q Consensus       144 ~~~~I~~e~~s~nT~ena~~---~~~il~~~~-----~~~vilVTsa~Hm~RA~~~f~~~gi~~~p~~~d  205 (242)
                      ...-+++-+||-+|.|.+.+   .+++++++.     .++++++|++- -......+++.|+++.+.|.+
T Consensus       129 ~~t~~iviSKSg~T~ETl~~~~~~~~~l~~~~~~~~~~~~~~v~t~~~-~~~l~~~a~~~~~~~f~~~~~  197 (442)
T d1c7qa_         129 KDLSINVISKSGTTTEPAIAFRIFRDYMEKKYGKEEARKRIYVTTDRT-KGALKKLADQEGYETFVIPDN  197 (442)
T ss_dssp             CCEEEEEECSSSCCHHHHHHHHHHHHHHHHHHCHHHHTTSEEEEECSS-CSHHHHHHHHHTCEEEECCTT
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHCEEECCCCC-HHHHHHHHHHHHHHHHHHHHH
T ss_conf             760389844998865588999999999987304266652611123440-123433102666555424321


No 2  
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
Probab=78.66  E-value=1.8  Score=19.87  Aligned_cols=110  Identities=11%  Similarity=0.114  Sum_probs=58.7

Q ss_pred             CCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEECCC---CCC-CCCCCHHHHHHHHHHHC
Q ss_conf             75899962521377776555434682058999999999982520057533897068---888-77888279999999974
Q gi|255764508|r   66 GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG---DPQ-KHGLAESIVYNNKLLES  141 (242)
Q Consensus        66 ~d~IVVLGgG~~~~~~~~~~~~~~~~~~~~Rl~~a~~L~~~~~~~~~~~~ii~SGg---~~~-~~~~~Ea~~m~~~l~~~  141 (242)
                      .+++|..+||.+                  -..+...+.++|..-.   .++.+-.   +-. .+++ ..+..+.++..+
T Consensus         4 ~~V~vl~SGGKD------------------S~lAl~~a~~~G~eV~---~L~t~~~~~~~s~~~h~~-~~~ll~~qAeal   61 (226)
T d2d13a1           4 ADVAVLYSGGKD------------------SNYALYWALKSGLRVR---YLVSMVSENEESYMYHTP-NVELTSLQARAL   61 (226)
T ss_dssp             CEEEEECCSSHH------------------HHHHHHHHHHTTCEEE---EEEEEECCC----------CCTTHHHHHHHH
T ss_pred             EEEEEEECCCHH------------------HHHHHHHHHHCCCEEE---EEEEEECCCCCCCCCCCC-CHHHHHHHHHHC
T ss_conf             219999268699------------------9999999998599059---999984378996716578-899999999863


Q ss_pred             CCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEE--EECCHHHHHHHHHHHHHCCCEEE
Q ss_conf             999878111101466577799999997623686408--85345889999999997698189
Q gi|255764508|r  142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII--LVSSAYHLKRSQLYFQHFGINTK  200 (242)
Q Consensus       142 Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vi--lVTsa~Hm~RA~~~f~~~gi~~~  200 (242)
                      |+|--   ....+.+..++.....+.+++.+.+.++  =+-|.+|--|-...+++.|+++.
T Consensus        62 giPl~---~~~~~~~~e~~~~~l~~~l~~~~v~~vv~Gdi~~~~~r~r~e~~c~~~gl~~~  119 (226)
T d2d13a1          62 GIPII---KGFTKGEKEKEVEDLKNVLEGLKVDGIVAGALASRYQKERIENVARELGLKVY  119 (226)
T ss_dssp             TCCEE---EEEC--CTTSHHHHHHHHHHTBCCSEEECCCSSCHHHHHHHHHHHHHHTCEEE
T ss_pred             CCCCE---EEECCCCCHHHHHHHHHHHHHCCCCCEEECCEECHHHHHHHHHHHHHCCCEEE
T ss_conf             89826---87347861299999999998607253676100038889999866876594898


No 3  
>d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]}
Probab=72.36  E-value=2.6  Score=18.82  Aligned_cols=63  Identities=14%  Similarity=0.121  Sum_probs=40.5

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCC-------CH--HHHHHHHHHHCCCCHHHHHCCHHH
Q ss_conf             346820589999999999825200575338970688887788-------82--799999999749998781111014
Q gi|255764508|r   87 IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL-------AE--SIVYNNKLLESGVERDDIKLETQS  154 (242)
Q Consensus        87 ~~~~~~~~~Rl~~a~~L~~~~~~~~~~~~ii~SGg~~~~~~~-------~E--a~~m~~~l~~~Gv~~~~I~~e~~s  154 (242)
                      .++...+...+.+-++..+..+    ..+|.+.| .....|.       |+  |+..+++|.+.|++.++|.....+
T Consensus        21 ~~l~~~~~~~L~~l~~~l~~~~----~~~i~I~G-htD~~G~~~~N~~LS~~RA~~V~~~L~~~Gi~~~ri~~~g~G   92 (140)
T d1r1ma_          21 DSLRAEAQDNLKVLAQRLSRTN----IQSVRVEG-HTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLG   92 (140)
T ss_dssp             SCCCHHHHHHHHHHHHHHTTSC----EEEEEEEE-ECCSSSCHHHHHHHHHHHHHHHHHHHHHTTCCGGGEEEEECT
T ss_pred             CCCCHHHHHHHHHHHHHHHHCC----CCEEEEEE-EECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEE
T ss_conf             4279899999999999872199----70899998-606544212103678899999999999759993759999972


No 4  
>d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]}
Probab=66.29  E-value=3.5  Score=18.00  Aligned_cols=63  Identities=8%  Similarity=0.127  Sum_probs=41.3

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCC-------C--HHHHHHHHHHHCCCCHHHHHCCHHH
Q ss_conf             346820589999999999825200575338970688887788-------8--2799999999749998781111014
Q gi|255764508|r   87 IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL-------A--ESIVYNNKLLESGVERDDIKLETQS  154 (242)
Q Consensus        87 ~~~~~~~~~Rl~~a~~L~~~~~~~~~~~~ii~SGg~~~~~~~-------~--Ea~~m~~~l~~~Gv~~~~I~~e~~s  154 (242)
                      .++...+...+..-+++.+.++    +.+|.+.|- ....+.       +  =|...+++|++.||++++|.....+
T Consensus        39 ~~L~~~~~~~L~~la~~l~~~~----~~~i~I~Gh-tD~~g~~~~N~~LS~~RA~~V~~~L~~~Gi~~~ri~~~g~G  110 (134)
T d2aizp1          39 YDITGEYVQILDAHAAYLNATP----AAKVLVEGN-TDERGTPEYNIALGQRRADAVKGYLAGKGVDAGKLGTVSYG  110 (134)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHST----TCCEEEEEE-CCSSSCHHHHHHHHHHHHHHHHHHHHHTTCCGGGEEEEECT
T ss_pred             CCCCHHHHHHHHHHHHHHHHCC----CCEEEEEEC-CCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECC
T ss_conf             1249889999999999998699----968999604-34332211101378999999998997718753455137754


No 5  
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
Probab=65.19  E-value=3.6  Score=17.86  Aligned_cols=94  Identities=16%  Similarity=0.130  Sum_probs=54.5

Q ss_pred             HHHHHHHCCCCCCCCEEEECCCCCCC--CCCCHHHHHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             99999825200575338970688887--7888279999999974999878111101466577799999997623686408
Q gi|255764508|r  100 TMRLYKSCKQHSMHCTIIISGGDPQK--HGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII  177 (242)
Q Consensus       100 a~~L~~~~~~~~~~~~ii~SGg~~~~--~~~~Ea~~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vi  177 (242)
                      +-.|.+.|..+    -.+++| ....  ..........+...+.|++.+.........+..+.....++++.++...+.+
T Consensus       112 ~~~l~~~G~~~----i~~~~~-~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ai  186 (275)
T d2nzug1         112 VQSLIDSGHKN----IAFVSG-TLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAI  186 (275)
T ss_dssp             HHHHHHTTCSC----EEEEES-CTTSHHHHTTHHHHHHHHHHHTTCCCCGGGEEECCSSHHHHHHHHHHHHTSSSCCSEE
T ss_pred             HHHHHHHCCCC----EEEEEC-CCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHHCCCCCEEE
T ss_conf             89988752551----589934-8654315667777899999983999770058833688788899999998449997189


Q ss_pred             EECCHHHHHHHHHHHHHCCCE
Q ss_conf             853458899999999976981
Q gi|255764508|r  178 LVSSAYHLKRSQLYFQHFGIN  198 (242)
Q Consensus       178 lVTsa~Hm~RA~~~f~~~gi~  198 (242)
                      +.+++.....++..+++.|++
T Consensus       187 ~~~~d~~A~g~~~~l~~~g~~  207 (275)
T d2nzug1         187 FVGTDEMALGVIHGAQDRGLN  207 (275)
T ss_dssp             EESSHHHHHHHHHHHHTTTCC
T ss_pred             EECCHHHHHHHHHHHHHCCCC
T ss_conf             846747777799987653998


No 6  
>d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]}
Probab=63.80  E-value=3.8  Score=17.70  Aligned_cols=62  Identities=13%  Similarity=0.168  Sum_probs=40.3

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCC-------C--HHHHHHHHHHHCCCCHHHHHCCHHH
Q ss_conf             46820589999999999825200575338970688887788-------8--2799999999749998781111014
Q gi|255764508|r   88 EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL-------A--ESIVYNNKLLESGVERDDIKLETQS  154 (242)
Q Consensus        88 ~~~~~~~~Rl~~a~~L~~~~~~~~~~~~ii~SGg~~~~~~~-------~--Ea~~m~~~l~~~Gv~~~~I~~e~~s  154 (242)
                      .+...+...+.+-+++.+..+    ..+|.+-| .....+.       +  =|+..+++|++.||+.++|.....+
T Consensus        12 ~l~~~~~~~L~~l~~~l~~~~----~~~i~I~G-htD~~g~~~~N~~LS~~RA~~V~~~L~~~Gi~~~ri~~~g~G   82 (106)
T d2hqsc1          12 DIRSDFAQMLDAHANFLRSNP----SYKVTVEG-HADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYG   82 (106)
T ss_dssp             CCCGGGHHHHHHHHHHHHHCT----TCCEEEEE-CCCSSSCHHHHHHHHHHHHHHHHHHHHHTTCCGGGEEEEECT
T ss_pred             CCCHHHHHHHHHHHHHHHHCC----CCEEEEEE-CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEC
T ss_conf             389889999999999998689----95799984-334221046665588998767999998669866448999835


No 7  
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}
Probab=53.59  E-value=3.1  Score=18.27  Aligned_cols=46  Identities=20%  Similarity=0.147  Sum_probs=32.4

Q ss_pred             HHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCH
Q ss_conf             999997499987811110146657779999999762368640885345
Q gi|255764508|r  135 NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA  182 (242)
Q Consensus       135 ~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa  182 (242)
                      .+++..+|++.++++...  .||.|++....+-+.+.+...+++|=|-
T Consensus        96 ~~~a~~~Gvd~d~v~~~~--~~~~E~~~~~i~~l~~~~~~~liViDSi  141 (263)
T d1u94a1          96 PIYARKLGVDIDNLLCSQ--PDTGEQALEICDALARSGAVDVIVVDSV  141 (263)
T ss_dssp             HHHHHHTTCCGGGCEEEC--CSSHHHHHHHHHHHHHHTCCSEEEEECG
T ss_pred             HHHHHHHCCCHHHEEEEC--CCCHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             999998399879979962--8989999999999985499989999886


No 8  
>d2nvma1 d.326.1.1 (A:2-118) XisI {Anabaena variabilis [TaxId: 1172]}
Probab=53.39  E-value=2.6  Score=18.76  Aligned_cols=25  Identities=20%  Similarity=0.339  Sum_probs=19.3

Q ss_pred             CHHHHHHHHHHHCCCCHHHHHCCHHH
Q ss_conf             82799999999749998781111014
Q gi|255764508|r  129 AESIVYNNKLLESGVERDDIKLETQS  154 (242)
Q Consensus       129 ~Ea~~m~~~l~~~Gv~~~~I~~e~~s  154 (242)
                      +|. ..++.|++.|||+++|++--.+
T Consensus        88 TE~-gIA~eLv~~GVPk~dIVLgFh~  112 (117)
T d2nvma1          88 TNL-AIVDEMLVAGIPQTDIILGFHH  112 (117)
T ss_dssp             STT-HHHHHHHHTTCCGGGEEETTSC
T ss_pred             CCC-CHHHHHHHCCCCHHHEEEEECC
T ss_conf             420-2899999849988997983068


No 9  
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
Probab=52.80  E-value=5  Score=16.97  Aligned_cols=64  Identities=11%  Similarity=0.182  Sum_probs=29.9

Q ss_pred             HHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCC---CEEEECCHHHHHHHHHHHHHCCCEEE
Q ss_conf             999999974999878111101466577799999997623686---40885345889999999997698189
Q gi|255764508|r  133 VYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK---NIILVSSAYHLKRSQLYFQHFGINTK  200 (242)
Q Consensus       133 ~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~---~vilVTsa~Hm~RA~~~f~~~gi~~~  200 (242)
                      +..-.+.+.|+.-.-+.+ +.+..+.|-+....+.+++....   +.+++.   +..+...++++.|-+.+
T Consensus        18 VAa~lmmkRG~~V~~v~f-~~~~~~~ekv~~l~~~L~~y~~~~~~~~~v~~---~~~~~~riA~~~~a~~i   84 (132)
T d1vbka1          18 LAIFLMMKRGVEVIPVYI-GKDDKNLEKVRSLWNLLKRYSYGSKGFLVVAE---SFDRVLKLIRDFGVKGV   84 (132)
T ss_dssp             HHHHHHHHBTCEEEEEEE-SCSSHHHHHHHHHHHHHHTTCTTSCCCCEEES---SHHHHHHHHHHHTCCEE
T ss_pred             HHHHHHHHCCCEEEEEEE-CCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEE---HHHHHHHHHHHHHHHCE
T ss_conf             999999977987999997-18888999999999999984899872899950---89999999999646264


No 10 
>d2nwva1 d.326.1.1 (A:2-113) Hypothetical protein Ava3320 {Anabaena variabilis [TaxId: 1172]}
Probab=50.25  E-value=3.8  Score=17.72  Aligned_cols=24  Identities=29%  Similarity=0.386  Sum_probs=19.0

Q ss_pred             HHHHHHHHCCCCHHHHHCCHHHHH
Q ss_conf             999999974999878111101466
Q gi|255764508|r  133 VYNNKLLESGVERDDIKLETQSLD  156 (242)
Q Consensus       133 ~m~~~l~~~Gv~~~~I~~e~~s~n  156 (242)
                      ..++.|++.|||+++|++--.+-.
T Consensus        79 gIa~eLv~~GVPk~dIVLgFh~P~  102 (112)
T d2nwva1          79 GIATELMRLGVTNNDIVLAFHPPD  102 (112)
T ss_dssp             CHHHHHHHTTCCGGGEEETTSCGG
T ss_pred             CHHHHHHHCCCCHHHEEEEECCCC
T ss_conf             279999984998899899406833


No 11 
>d2ioja1 c.98.2.2 (A:206-325) Hypothetical protein AF1212 {Archaeoglobus fulgidus [TaxId: 2234]}
Probab=49.63  E-value=6.6  Score=16.18  Aligned_cols=45  Identities=20%  Similarity=0.184  Sum_probs=28.2

Q ss_pred             CEEEECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             33897068888778882799999999749998781111014665777999999976
Q gi|255764508|r  114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK  169 (242)
Q Consensus       114 ~~ii~SGg~~~~~~~~Ea~~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~  169 (242)
                      .-+|+|||...+     .+ +.+.+.+.|+|     +-....|||+-+....+.+.
T Consensus        70 ~~iIltgg~~p~-----~~-i~~la~~~~ip-----il~t~~dTf~ta~~l~~~~~  114 (120)
T d2ioja1          70 RCLILTGNLEPV-----QL-VLTKAEERGVP-----VILTGHDTLTAVSRLESVFG  114 (120)
T ss_dssp             EEEEEETTCCCC-----HH-HHHHHHHHTCC-----EEECSSCHHHHHHHHHTTCS
T ss_pred             EEEEEECCCCCC-----HH-HHHHHHHCCCE-----EEEECCCHHHHHHHHHHHHH
T ss_conf             199997999988-----89-99999767983-----99977879999999999975


No 12 
>d2nlva1 d.326.1.1 (A:1-111) Hypothetical protein Ava3825 {Anabaena variabilis [TaxId: 1172]}
Probab=49.29  E-value=4  Score=17.56  Aligned_cols=24  Identities=33%  Similarity=0.326  Sum_probs=19.0

Q ss_pred             HHHHHHHHCCCCHHHHHCCHHHHH
Q ss_conf             999999974999878111101466
Q gi|255764508|r  133 VYNNKLLESGVERDDIKLETQSLD  156 (242)
Q Consensus       133 ~m~~~l~~~Gv~~~~I~~e~~s~n  156 (242)
                      ..++.|++.|||+++|++--.+-.
T Consensus        78 gIa~eLv~~GVPk~dIVLgFh~P~  101 (111)
T d2nlva1          78 NPAEELVMMGVPREDIVLGLQAPY  101 (111)
T ss_dssp             CHHHHHHHTTCCGGGEEETTSCGG
T ss_pred             CHHHHHHHCCCCHHHEEEECCCCC
T ss_conf             279999984998899899406823


No 13 
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}
Probab=47.26  E-value=5.4  Score=16.73  Aligned_cols=45  Identities=16%  Similarity=0.178  Sum_probs=29.3

Q ss_pred             HHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCH
Q ss_conf             99997499987811110146657779999999762368640885345
Q gi|255764508|r  136 NKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA  182 (242)
Q Consensus       136 ~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa  182 (242)
                      +++..+|++.++++.-..  +|.|++....+.+-+.+...+++|=|-
T Consensus       100 ~~a~~~Gvd~d~i~~~~~--~~~E~~~~~~~~l~~~~~~~liIiDSi  144 (268)
T d1xp8a1         100 VYARALGVNTDELLVSQP--DNGEQALEIMELLVRSGAIDVVVVDSV  144 (268)
T ss_dssp             HHHHHTTCCGGGCEEECC--SSHHHHHHHHHHHHTTTCCSEEEEECT
T ss_pred             HHHHHHCCCCHHEEEECC--CCHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             999982898123799748--999999999999986589719999454


No 14 
>d1a9xa2 c.24.1.1 (A:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=44.04  E-value=8  Score=15.63  Aligned_cols=62  Identities=23%  Similarity=0.192  Sum_probs=37.6

Q ss_pred             CCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECC-------HHHH
Q ss_conf             533897068888778882799999999749998781111014665777999999976236864088534-------5889
Q gi|255764508|r  113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS-------AYHL  185 (242)
Q Consensus       113 ~~~ii~SGg~~~~~~~~Ea~~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTs-------a~Hm  185 (242)
                      +.+|..|.|            .+++|.+.||+.+.|--...+   .+|+.   +++++..++=|+=.|+       .|+|
T Consensus        33 Gf~i~AT~G------------Ta~~L~~~Gi~~~~v~ki~~~---~p~i~---d~i~~gkidlVINt~~~~~~~~dg~~I   94 (138)
T d1a9xa2          33 GFELDATHG------------TAIVLGEAGINPRLVNKVHEG---RPHIQ---DRIKNGEYTYIINTTSGRRAIEDSRVI   94 (138)
T ss_dssp             TCEEEECHH------------HHHHHHTTTCCCEECBCTTTC---SSBHH---HHHHHTCCSEEEECCCSHHHHHHTHHH
T ss_pred             CCEEEECCC------------HHHHHHHHCCCCCCCCCCCCC---CCCHH---HHHHCCCEEEEEECCCCCCCCCCHHHH
T ss_conf             987886686------------489998722453110134666---52076---787449767999889997545248999


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|255764508|r  186 KRSQLYF  192 (242)
Q Consensus       186 ~RA~~~f  192 (242)
                      +|+...+
T Consensus        95 RR~Av~~  101 (138)
T d1a9xa2          95 RRSALQY  101 (138)
T ss_dssp             HHHHHHT
T ss_pred             HHHHHHC
T ss_conf             9999974


No 15 
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=41.07  E-value=5.8  Score=16.53  Aligned_cols=53  Identities=19%  Similarity=0.248  Sum_probs=31.8

Q ss_pred             HHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCH-HHHHHHH
Q ss_conf             999997499987811110146657779999999762368640885345-8899999
Q gi|255764508|r  135 NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA-YHLKRSQ  189 (242)
Q Consensus       135 ~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa-~Hm~RA~  189 (242)
                      .+++.++|++.++++.-..  +|.|++....+.+-..+....++|=|- -+.+|+.
T Consensus       102 ~e~a~~~GvD~d~il~~~~--~~~E~~~~~~~~l~~~~~~~liIiDSi~al~~~~E  155 (269)
T d1mo6a1         102 PDYAKKLGVDTDSLLVSQP--DTGEQALEIADMLIRSGALDIVVIDSVAALVPRAE  155 (269)
T ss_dssp             HHHHHHHTCCGGGCEEECC--SSHHHHHHHHHHHHHTTCEEEEEEECSTTCCCHHH
T ss_pred             HHHHHHHCCCHHHEEEECC--CCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHH
T ss_conf             9999980998899589669--98999999999998559987899933024560888


No 16 
>d1nria_ c.80.1.3 (A:) Hypothetical protein HI0754 {Haemophilus influenzae [TaxId: 727]}
Probab=39.91  E-value=9.2  Score=15.22  Aligned_cols=103  Identities=14%  Similarity=0.129  Sum_probs=55.7

Q ss_pred             CCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCC-----CCHHHHHHHHHHH
Q ss_conf             75899962521377776555434682058999999999982520057533897068888778-----8827999999997
Q gi|255764508|r   66 GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHG-----LAESIVYNNKLLE  140 (242)
Q Consensus        66 ~d~IVVLGgG~~~~~~~~~~~~~~~~~~~~Rl~~a~~L~~~~~~~~~~~~ii~SGg~~~~~~-----~~Ea~~m~~~l~~  140 (242)
                      ..-|+..|+|...               ..-+..|.++......+.....-++.||+.....     ....+...+.+.+
T Consensus        60 gGrl~y~G~GtSg---------------rla~~dA~E~~ptf~~~~~~v~~~iagg~~al~~~~e~~ed~~~~~~~~l~~  124 (248)
T d1nria_          60 GGRLIYIGAGTSG---------------RLGVLDASECPPTFGVSTEMVKGIIAGGECAIRHPVEGAEDNTKAVLNDLQS  124 (248)
T ss_dssp             TCCEEEEESHHHH---------------HHHHHHHHHHHHHHCCCTTSEEEEETTCTHHHHSCCTTGGGCTTHHHHHHHH
T ss_pred             CCEEEEEECCCCC---------------HHHHHHHHHCCCCCCCCCHHEEEEECCCHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             9859998268530---------------2899899870775688803401100158188874364115657999989986


Q ss_pred             CCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHH
Q ss_conf             49998781111014665777999999976236864088534588
Q gi|255764508|r  141 SGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYH  184 (242)
Q Consensus       141 ~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa~H  184 (242)
                      .++.++++++-=.+--+-.|.....+..++.|.. .+.+|+..+
T Consensus       125 ~~~~~~DvvIgISaSG~Tp~vl~al~~Ak~~Ga~-ti~i~~n~~  167 (248)
T d1nria_         125 IHFSKNDVLVGIAASGRTPYVIAGLQYAKSLGAL-TISIASNPK  167 (248)
T ss_dssp             TTCCTTSEEEEECTTSCCHHHHHHHHHHHHHTCE-EEEEESSTT
T ss_pred             CCCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCC-EEEEECCCC
T ss_conf             4888231799982598863348999998762865-079862783


No 17 
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
Probab=39.81  E-value=9.3  Score=15.21  Aligned_cols=93  Identities=10%  Similarity=0.037  Sum_probs=53.5

Q ss_pred             HHHHHHHCCCCCCCCEEEECCCCCCCCCCCH-HHHHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             9999982520057533897068888778882-799999999749998781111014665777999999976236864088
Q gi|255764508|r  100 TMRLYKSCKQHSMHCTIIISGGDPQKHGLAE-SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL  178 (242)
Q Consensus       100 a~~L~~~~~~~~~~~~ii~SGg~~~~~~~~E-a~~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vil  178 (242)
                      +-.|.++|..+    -.+++| ........| .+..++.+.+.|++.......+  .+..+......+++.+++....++
T Consensus       110 ~~~L~~~G~~~----i~~i~~-~~~~~~~~~R~~g~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~ai~  182 (271)
T d1jyea_         110 VEHLVALGHQQ----IALLAG-PLSSVSARLRLAGWHKYLTRNQIQPIAEREGD--WSAMSGFQQTMQMLNEGIVPTAML  182 (271)
T ss_dssp             HHHHHHHTCCS----EEEEEC-CTTSHHHHHHHHHHHHHHHHTTCCCSEEEECC--SSHHHHHHHHHHHHHTTCCCSEEE
T ss_pred             EEEEECCCCCC----CCCCCC-CCCCCHHHHHHHHHHHHHHHCCCCCCCEECCC--CCCCCCCCHHHHHHHCCCCCCHHH
T ss_conf             01220112454----332223-44551577656788777664135421000011--111124420223331245652111


Q ss_pred             ECCHHHHHHHHHHHHHCCCEE
Q ss_conf             534588999999999769818
Q gi|255764508|r  179 VSSAYHLKRSQLYFQHFGINT  199 (242)
Q Consensus       179 VTsa~Hm~RA~~~f~~~gi~~  199 (242)
                      +++..-...++..+++.|+++
T Consensus       183 ~~~~~~a~~~~~~l~~~g~~v  203 (271)
T d1jyea_         183 VANDQMALGAMRAITESGLRV  203 (271)
T ss_dssp             ESSHHHHHHHHHHHHHTTCCB
T ss_pred             CCCHHHHHHHHHHHHHHHCCC
T ss_conf             232044457878678750568


No 18 
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}
Probab=38.17  E-value=9.8  Score=15.05  Aligned_cols=72  Identities=15%  Similarity=0.095  Sum_probs=45.4

Q ss_pred             CCHHHHHHHHHHHCCCCH-------------------------HHHHCCHHHHHHHHH----HHHHHHHHHHCCCCCEEE
Q ss_conf             882799999999749998-------------------------781111014665777----999999976236864088
Q gi|255764508|r  128 LAESIVYNNKLLESGVER-------------------------DDIKLETQSLDTFQN----AQFSSSMIKNMQGKNIIL  178 (242)
Q Consensus       128 ~~Ea~~m~~~l~~~Gv~~-------------------------~~I~~e~~s~nT~en----a~~~~~il~~~~~~~vil  178 (242)
                      +...+.++.|+..+|+|-                         +-|++|..+++.+++    ..+.+++.+..+...++|
T Consensus        53 ~ga~eQL~~~a~~l~v~~~~~~~~~~~~~~~~~a~~~~~~~~~d~IlIDTaGr~~~~~~~~~~~el~~~~~~~~~~~~~L  132 (211)
T d1j8yf2          53 PAALEQLQQLGQQIGVPVYGEPGEKDVVGIAKRGVEKFLSEKMEIIIVDTAGRHGYGEEAALLEEMKNIYEAIKPDEVTL  132 (211)
T ss_dssp             HHHHHHHHHHHHHHTCCEECCTTCCCHHHHHHHHHHHHHHTTCSEEEEECCCSCCTTCHHHHHHHHHHHHHHHCCSEEEE
T ss_pred             CCHHHHHHHHCCCCCCCEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             51567898740146842230244102447899999874026773699853776763136678999999986259766899


Q ss_pred             ECCHH----HHHHHHHHHHHCCCEE
Q ss_conf             53458----8999999999769818
Q gi|255764508|r  179 VSSAY----HLKRSQLYFQHFGINT  199 (242)
Q Consensus       179 VTsa~----Hm~RA~~~f~~~gi~~  199 (242)
                      |-|+.    ++..+...|+..+++.
T Consensus       133 Vl~a~~~~~~~~~~~~~~~~~~~~~  157 (211)
T d1j8yf2         133 VIDASIGQKAYDLASKFNQASKIGT  157 (211)
T ss_dssp             EEEGGGGGGHHHHHHHHHHHCTTEE
T ss_pred             EEECCCCCCHHHHHHHHHCCCCCCE
T ss_conf             9843568406778766530367553


No 19 
>d1vi6a_ c.23.15.1 (A:) Ribosomal protein S2 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
Probab=37.64  E-value=10  Score=14.99  Aligned_cols=132  Identities=14%  Similarity=0.082  Sum_probs=73.1

Q ss_pred             CHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCH-HHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             058999999999982520057533897068888778882799999999749998-7811110146657779999999762
Q gi|255764508|r   92 QSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVER-DDIKLETQSLDTFQNAQFSSSMIKN  170 (242)
Q Consensus        92 ~~~~Rl~~a~~L~~~~~~~~~~~~ii~SGg~~~~~~~~Ea~~m~~~l~~~Gv~~-~~I~~e~~s~nT~ena~~~~~il~~  170 (242)
                      .+.+.+..|++..+... +   -.+++-|.....     ....++++...|.+- ..=|+...=+|.         ....
T Consensus        46 kT~~~L~~A~~~l~~~~-~---~~ILfVgtk~~~-----~~~v~~~A~~~g~~~v~~RWlgG~LTN~---------~~~~  107 (193)
T d1vi6a_          46 KLDERIRVAAKFLSRYE-P---SKILLVAARQYA-----HKPVQMFSKVVGSDYIVGRFIPGTLTNP---------MLSE  107 (193)
T ss_dssp             HHHHHHHHHHHHHTTSC-G---GGEEEEECSGGG-----HHHHHHHHHHHCCEEEESSCCTTTTTCT---------TSTT
T ss_pred             HHHHHHHHHHHHHHHHC-C---CCEEEEECCCCH-----HHHHHHHHHHCCCCCCCCCCCCCCCCCH---------HHHH
T ss_conf             99999999999997742-6---752776226216-----7899999986399854453457743316---------7752


Q ss_pred             CCCCCEEEECCHHHHHHHHHHHHHCCCEEEEEE-CCCCCC-CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             368640885345889999999997698189984-266443-11137545788989999999999999998648
Q gi|255764508|r  171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASC-SDYLNA-YYSIIPLSANFYLTELALKEYIGILIAYYRGN  241 (242)
Q Consensus       171 ~~~~~vilVTsa~Hm~RA~~~f~~~gi~~~p~~-~d~~~~-~~~~~p~~~~l~~~~~~~~E~ig~l~~~~~g~  241 (242)
                      ....++++|+++.+-.-|...+.+.|+.+++.. ||-.+. ....+|..+.-..+-.++...++-.+.+.||.
T Consensus       108 ~~~P~~liv~dp~~d~~ai~Ea~~l~IPvI~ivDTn~~p~~vdy~IP~Ndds~~Si~li~~~l~~ai~~~k~~  180 (193)
T d1vi6a_         108 YREPEVVFVNDPAIDKQAVSEATAVGIPVVALCDSNNSSADVDLVIPTNNKGRRALAIVYWLLAREIAKIRGQ  180 (193)
T ss_dssp             CCCCSEEEESCTTTTHHHHHHHHHTTCCEEEEECTTCCCTTCSEEEESCCSCHHHHHHHHHHHHHHHHHHHTC
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             0555189997686107899999873897266731679985244688688873879999999999999998188


No 20 
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]}
Probab=36.36  E-value=1.8  Score=19.81  Aligned_cols=66  Identities=17%  Similarity=0.154  Sum_probs=43.3

Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHH---CCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCH
Q ss_conf             8970688887788827999999997499987811---110146657779999999762368640885345
Q gi|255764508|r  116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIK---LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA  182 (242)
Q Consensus       116 ii~SGg~~~~~~~~Ea~~m~~~l~~~Gv~~~~I~---~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa  182 (242)
                      +++..|.+.+.+..-+...++.+.++|++.=.+.   ...++....+||...-+-++++ .+.++++-++
T Consensus        88 vfi~AGlGGgTGtgaapviA~~ake~g~lvv~ivtlPF~~EG~~r~~~A~~gl~~L~~~-~D~~Ivi~Nd  156 (194)
T d1w5fa1          88 VFITAGFGGGTGTGASPVIAKIAKEMGILTVAIVTTPFYFEGPERLKKAIEGLKKLRKH-VDTLIKISNN  156 (194)
T ss_dssp             EEEEEETTSSHHHHHHHHHHHHHHHTTCEEEEEEEECCGGGCHHHHHHHHHHHHHHHHT-CSEEEEEEHH
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHHHH-HHHHHEEHHH
T ss_conf             99998558876520678899999981996599996033566789999899999999997-3154032387


No 21 
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=35.22  E-value=11  Score=14.75  Aligned_cols=93  Identities=6%  Similarity=0.069  Sum_probs=49.7

Q ss_pred             HHHHHCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECC
Q ss_conf             99982520057533897068888778882799999999749998781111014665777999999976236864088534
Q gi|255764508|r  102 RLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS  181 (242)
Q Consensus       102 ~L~~~~~~~~~~~~ii~SGg~~~~~~~~Ea~~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTs  181 (242)
                      .+.+.|..+    -.++++.............-.....+.|.+...........+.........+++........++.++
T Consensus       113 ~l~~~G~~~----i~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~ai~~~~  188 (282)
T d1dbqa_         113 YLIERGHRE----IGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGG  188 (282)
T ss_dssp             HHHHTTCCS----EEEECCC------CHHHHHHHHHHHHTTCCCCGGGBCCCCSSHHHHHHHHHHHHTSSSCCSEEEESC
T ss_pred             HHCCCCCCC----CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             320333221----2234687300456666666888876027776613798346311447999999984799995589851


Q ss_pred             HHHHHHHHHHHHHCCCE
Q ss_conf             58899999999976981
Q gi|255764508|r  182 AYHLKRSQLYFQHFGIN  198 (242)
Q Consensus       182 a~Hm~RA~~~f~~~gi~  198 (242)
                      +..-..++...+..|+.
T Consensus       189 d~~a~g~~~~l~~~g~~  205 (282)
T d1dbqa_         189 DIMAMGALCAADEMGLR  205 (282)
T ss_dssp             HHHHHHHHHHHHHTTCC
T ss_pred             CHHHHHHHHHHHHCCCC
T ss_conf             55666577888760688


No 22 
>d1tk9a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Campylobacter jejuni [TaxId: 197]}
Probab=34.94  E-value=11  Score=14.72  Aligned_cols=99  Identities=15%  Similarity=0.114  Sum_probs=49.3

Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCC-----CCCCCHHHHHHHHHHHC
Q ss_conf             5899962521377776555434682058999999999982520057533897068888-----77888279999999974
Q gi|255764508|r   67 NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ-----KHGLAESIVYNNKLLES  141 (242)
Q Consensus        67 d~IVVLGgG~~~~~~~~~~~~~~~~~~~~Rl~~a~~L~~~~~~~~~~~~ii~SGg~~~-----~~~~~Ea~~m~~~l~~~  141 (242)
                      .-|++.|.|.               .+..-..-+.++.+.+...++..|.+.-+++..     .++..-.+...+++...
T Consensus        43 gkI~~~GnGg---------------Sa~~A~h~a~el~~~~~~~r~~l~~i~l~~~~a~~ta~~nd~~~e~~f~~ql~~~  107 (188)
T d1tk9a_          43 GKILICGNGG---------------SAADAQHFAAELSGRYKKERKALAGIALTTDTSALSAIGNDYGFEFVFSRQVEAL  107 (188)
T ss_dssp             CCEEEEESTH---------------HHHHHHHHHHHHHSCSSSCCCCCCEEESSCCHHHHHHHHHHTCGGGHHHHHHHHH
T ss_pred             CEEEEECCCC---------------CCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             9899987887---------------5223647777625876555444334257786122323235467799999999983


Q ss_pred             CCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCH
Q ss_conf             99987811110146657779999999762368640885345
Q gi|255764508|r  142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA  182 (242)
Q Consensus       142 Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa  182 (242)
                      |-+ +++++--.+..+-.|..+..+..++++.+ ++.+|..
T Consensus       108 ~~~-gDili~iS~SG~S~nii~a~~~Ak~~g~~-ti~ltg~  146 (188)
T d1tk9a_         108 GNE-KDVLIGISTSGKSPNVLEALKKAKELNML-CLGLSGK  146 (188)
T ss_dssp             CCT-TCEEEEECSSSCCHHHHHHHHHHHHTTCE-EEEEEEG
T ss_pred             CCC-CCEEEEECCCCCCCHHHHHHHHHHHHCCE-EEEEECC
T ss_conf             688-84799953798881268888999851153-8998079


No 23 
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]}
Probab=34.30  E-value=11  Score=14.65  Aligned_cols=82  Identities=11%  Similarity=0.092  Sum_probs=48.0

Q ss_pred             CCEEE-ECCCCCCC---CCCCHH-----------------HHHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHH-
Q ss_conf             53389-70688887---788827-----------------999999997499987811110146657779999999762-
Q gi|255764508|r  113 HCTII-ISGGDPQK---HGLAES-----------------IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN-  170 (242)
Q Consensus       113 ~~~ii-~SGg~~~~---~~~~Ea-----------------~~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~-  170 (242)
                      +.|++ +-||.-++   ++.+|.                 +..++.+.++|.++++|..-..  ..+++....+++.+. 
T Consensus       112 ~ipi~HiegG~rsg~~~~~~~de~~R~~iskls~~hf~~t~~~~~~L~~~Ge~~~~I~~vG~--p~~D~i~~~~~~~~~~  189 (373)
T d1v4va_         112 GIPVGHVEAGLRSGNLKEPFPEEANRRLTDVLTDLDFAPTPLAKANLLKEGKREEGILVTGQ--TGVDAVLLAAKLGRLP  189 (373)
T ss_dssp             TCCEEEETCCCCCSCTTSSTTHHHHHHHHHHHCSEEEESSHHHHHHHHTTTCCGGGEEECCC--HHHHHHHHHHHHCCCC
T ss_pred             HHHHEEECCCCCCCCCCCCCCHHHHHHHHCCCCCEEEECCHHHHHHHHHHCCCCCCEEECCC--CHHHHHHHHHHHCCCC
T ss_conf             21222413434554335676166666552234432551221566666663045421344266--2155777654311000


Q ss_pred             --CCCCCEEEEC--------CHHHHHHHHHHHHHCC
Q ss_conf             --3686408853--------4588999999999769
Q gi|255764508|r  171 --MQGKNIILVS--------SAYHLKRSQLYFQHFG  196 (242)
Q Consensus       171 --~~~~~vilVT--------sa~Hm~RA~~~f~~~g  196 (242)
                        ...++.++||        +.-.+..+........
T Consensus       190 ~~~~~~~~~lvt~hr~~n~~~~~~~~~~~~~~~~~~  225 (373)
T d1v4va_         190 EGLPEGPYVTVTMHRRENWPLLSDLAQALKRVAEAF  225 (373)
T ss_dssp             TTCCSSCEEEECCCCGGGGGGHHHHHHHHHHHHHHC
T ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             223445531688426555312789999999986533


No 24 
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
Probab=34.00  E-value=11  Score=14.62  Aligned_cols=10  Identities=30%  Similarity=0.713  Sum_probs=4.7

Q ss_pred             CCEEEEECCC
Q ss_conf             7589996252
Q gi|255764508|r   66 GNIIVLLGNG   75 (242)
Q Consensus        66 ~d~IVVLGgG   75 (242)
                      .|.||-+|||
T Consensus        86 ~D~IiavGGG   95 (366)
T d1jq5a_          86 AAIVIGVGGG   95 (366)
T ss_dssp             CSEEEEEESH
T ss_pred             CCEEEEECCC
T ss_conf             8689981688


No 25 
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]}
Probab=33.04  E-value=12  Score=14.52  Aligned_cols=65  Identities=12%  Similarity=0.098  Sum_probs=27.8

Q ss_pred             HCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCH-HHHHH-HHHHHHHCCCEEEEEECC
Q ss_conf             7499987811110146657779999999762368640885345-88999-999999769818998426
Q gi|255764508|r  140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA-YHLKR-SQLYFQHFGINTKASCSD  205 (242)
Q Consensus       140 ~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa-~Hm~R-A~~~f~~~gi~~~p~~~d  205 (242)
                      -.|+++++|.+-+.+..-...+..+.........+ .+++++. |+.-+ .....+..|.++..+|.|
T Consensus        60 ~lg~~~~~I~~~~~~t~~l~~~~~~~~~~~~~~gd-~Vv~~~~~~~s~~~~~~~~~~~G~~v~~v~~~  126 (391)
T d1p3wa_          60 LVGADPREIVFTSGATESDNLAIKGAANFYQKKGK-HIITSKTEHKAVLDTCRQLEREGFEVTYLAPQ  126 (391)
T ss_dssp             HHTCCGGGEEEESSHHHHHHHHHHHHHHHHGGGCC-EEEEETTSCHHHHHHHHHHHHTTCEEEEECCC
T ss_pred             HCCCCCCCEEEECCHHHHHHHHHHHHHHHHCCCCC-EEEEECCCCCHHHHHHHHHHHCCCEEEEECCC
T ss_conf             73999781999798899999999642353057998-89992465413899999999759889996788


No 26 
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]}
Probab=32.87  E-value=12  Score=14.51  Aligned_cols=113  Identities=11%  Similarity=0.074  Sum_probs=51.0

Q ss_pred             CCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEC-CCCCCCCCC---CH------HHHHH
Q ss_conf             758999625213777765554346820589999999999825200575338970-688887788---82------79999
Q gi|255764508|r   66 GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS-GGDPQKHGL---AE------SIVYN  135 (242)
Q Consensus        66 ~d~IVVLGgG~~~~~~~~~~~~~~~~~~~~Rl~~a~~L~~~~~~~~~~~~ii~S-Gg~~~~~~~---~E------a~~m~  135 (242)
                      -|.||+.-..++.+................-+.......+..+++  +.|+++| ||...+.+.   ++      +..+.
T Consensus        35 ~d~v~~~~a~i~~d~~~~~~~~~~~~~~~~~~~~~~~~i~~~q~~--g~KvllsigG~~~~~~~~~~~~~~~~~F~~~~~  112 (285)
T d2ebna_          35 VDMVVLFSANINYDAANDKVFVSNNPNVQHLLTNRAKYLKPLQDK--GIKVILSILGNHDRSGIANLSTARAKAFAQELK  112 (285)
T ss_dssp             CCEEEEEEEEEEEETTTTEEEEECCHHHHHHHHTHHHHTHHHHHT--TCEEEEEEECCSSSCCTTCBCHHHHHHHHHHHH
T ss_pred             CCEEEEEEEECCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             669988742046776776144235820666555279999998728--987999962687886544579999999999999


Q ss_pred             HHHHHCCCCHHHHHCCHHH----------HHHHHHHHHHHHHHHHCCCCCEEEEC
Q ss_conf             9999749998781111014----------66577799999997623686408853
Q gi|255764508|r  136 NKLLESGVERDDIKLETQS----------LDTFQNAQFSSSMIKNMQGKNIILVS  180 (242)
Q Consensus       136 ~~l~~~Gv~~~~I~~e~~s----------~nT~ena~~~~~il~~~~~~~vilVT  180 (242)
                      +++.+.|.+-=+|-.|.-+          ....+|....-+-+++.-.++.+-++
T Consensus       113 ~~~~~y~lDGiDiD~Ey~~~~~~~~~~~~~~~~~~~~~li~eLr~~~~~~~lt~a  167 (285)
T d2ebna_         113 NTCDLYNLDGVFFDDEYSAYQTPPPSGFVTPSNNAAARLAYETKQAMPNKLVTVY  167 (285)
T ss_dssp             HHHHHHTCCEEEEECCSCCCCSSCCTTBCCCCHHHHHHHHHHHHHHCTTSEEEEE
T ss_pred             HHHHHCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9999759967860665764457786555742688999999999987798728999


No 27 
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]}
Probab=31.34  E-value=13  Score=14.34  Aligned_cols=113  Identities=11%  Similarity=0.138  Sum_probs=48.3

Q ss_pred             CCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHH-HHHHHHHHCCCCCCCCEEEEC-CCCCCCCCC----CH------HHH
Q ss_conf             758999625213777765554346820589999-999999825200575338970-688887788----82------799
Q gi|255764508|r   66 GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIF-ETMRLYKSCKQHSMHCTIIIS-GGDPQKHGL----AE------SIV  133 (242)
Q Consensus        66 ~d~IVVLGgG~~~~~~~~~~~~~~~~~~~~Rl~-~a~~L~~~~~~~~~~~~ii~S-Gg~~~~~~~----~E------a~~  133 (242)
                      .|.|++..+.++.+..........+.+. +.+. ......+..+++  +.|+++| ||...+.+.    ++      +..
T Consensus        33 ~d~v~~~~a~i~~d~~~~~~~~~~~~~~-~~~~~~~~~~i~~l~~~--g~KvllsiGG~~~~~~f~~~~s~~~~~~Fa~~  109 (265)
T d1edta_          33 FDVAVIFAANINYDTGTKTAYLHFNENV-QRVLDNAVTQIRPLQQQ--GIKVLLSVLGNHQGAGFANFPSQQAASAFAKQ  109 (265)
T ss_dssp             CSEEEEEEEEEEEETTTTEEEEECCHHH-HHHHHTHHHHTHHHHHT--TCEEEEEEEECTTSCCTTCCSSHHHHHHHHHH
T ss_pred             EEEEEEEEEECCCCCCCCEEEEECCCCH-HHHHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCEECCCHHHHHHHHHH
T ss_conf             2399980465135777770677208325-45444089999999748--98799997168688771216899999999999


Q ss_pred             HHHHHHHCCCCHHHHHCCHH-------HHHHHHHHHHHHHHHHHCCCCCEEEECC
Q ss_conf             99999974999878111101-------4665777999999976236864088534
Q gi|255764508|r  134 YNNKLLESGVERDDIKLETQ-------SLDTFQNAQFSSSMIKNMQGKNIILVSS  181 (242)
Q Consensus       134 m~~~l~~~Gv~~~~I~~e~~-------s~nT~ena~~~~~il~~~~~~~vilVTs  181 (242)
                      +.+++.+.|.+-=+|-.|.-       .....+|.....+-+++.-.++.+.++.
T Consensus       110 ~~~~~~~~~~DGiDiD~Eyp~~~~~~~~~~d~~~~~~ll~~lR~~l~~~~is~a~  164 (265)
T d1edta_         110 LSDAVAKYGLDGVDFDDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYN  164 (265)
T ss_dssp             HHHHHHHHTCCEEEEECSSCCTTGGGCCCCCSSHHHHHHHHHHHHCTTSEEEEES
T ss_pred             HHHHHHHCCCCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCEEEEEE
T ss_conf             9999970699843720546766678988512889999999999864305799995


No 28 
>d1vk3a3 d.139.1.1 (A:167-345) Phosphoribosylformylglycinamidine synthase II, domains 2 and 4 {Thermotoga maritima [TaxId: 2336]}
Probab=31.09  E-value=13  Score=14.32  Aligned_cols=68  Identities=12%  Similarity=0.151  Sum_probs=42.2

Q ss_pred             HHHHHHHHHHC--C--CCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHCCCEE--EEEEC
Q ss_conf             79999999974--9--998781111014665777999999976236864088534588999999999769818--99842
Q gi|255764508|r  131 SIVYNNKLLES--G--VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT--KASCS  204 (242)
Q Consensus       131 a~~m~~~l~~~--G--v~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa~Hm~RA~~~f~~~gi~~--~p~~~  204 (242)
                      +.+..+.+..-  |  |..++|-..+...+.+       +++-.....++++..++-+..+...++++.|+..  ++..+
T Consensus        77 ~~al~Ema~~~~~G~~i~l~~i~~~~~~~~~~-------e~lfsEsq~R~vv~v~~~~~~~~~~~~~~~~~~~~~IG~vt  149 (179)
T d1vk3a3          77 LSATSELVAKGNLGAIVHLDRVPLREPDMEPW-------EILISESQERMAVVTSPQKASRILEIARKHLLFGDVVAEVI  149 (179)
T ss_dssp             HHHHHHHHHHTTCEEEEEGGGSCBSSTTCCHH-------HHHHCCCSSEEEEEECGGGHHHHHHHHHHTTCEEEEEEEEE
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCC-------EEEEECCCCCEEEEECHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             57888998737966999871334344345741-------04771576727998442689999999998399933789995


Q ss_pred             C
Q ss_conf             6
Q gi|255764508|r  205 D  205 (242)
Q Consensus       205 d  205 (242)
                      +
T Consensus       150 ~  150 (179)
T d1vk3a3         150 E  150 (179)
T ss_dssp             S
T ss_pred             C
T ss_conf             4


No 29 
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]}
Probab=30.69  E-value=13  Score=14.27  Aligned_cols=65  Identities=14%  Similarity=0.042  Sum_probs=49.5

Q ss_pred             CCCHHHH--HCCHHHHHHHHHHHHHHHHHHHCCCCCEE----------EECCHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9998781--11101466577799999997623686408----------85345889999999997698189984266
Q gi|255764508|r  142 GVERDDI--KLETQSLDTFQNAQFSSSMIKNMQGKNII----------LVSSAYHLKRSQLYFQHFGINTKASCSDY  206 (242)
Q Consensus       142 Gv~~~~I--~~e~~s~nT~ena~~~~~il~~~~~~~vi----------lVTsa~Hm~RA~~~f~~~gi~~~p~~~d~  206 (242)
                      -++..++  +--+.+-.|.|+|+.++++.++-...+++          |--+.+-...|-...-+.|++|-||-+|.
T Consensus        59 ~i~~~~~~lLPNTAGc~tA~EAvr~A~lARE~~~t~~IKLEVi~D~~~L~PD~~etl~Aae~Lv~eGF~VlpY~~~D  135 (251)
T d1xm3a_          59 QLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDD  135 (251)
T ss_dssp             TCCGGGSEEEEECTTCSSHHHHHHHHHHHHHTTCCSSEEECCBCCTTTCCBCHHHHHHHHHHHHHTTCCEEEEECSC
T ss_pred             HCCCCCEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             31555459725429875099999999999981589668999734887768887799999999986896799961789


No 30 
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=28.85  E-value=14  Score=14.07  Aligned_cols=66  Identities=9%  Similarity=0.162  Sum_probs=41.2

Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHH---CCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCH
Q ss_conf             8970688887788827999999997499987811---110146657779999999762368640885345
Q gi|255764508|r  116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIK---LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA  182 (242)
Q Consensus       116 ii~SGg~~~~~~~~Ea~~m~~~l~~~Gv~~~~I~---~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa  182 (242)
                      ++++.|.+.+.|..-+..+++.+.++|+..=.|.   ++.++....++|.+.-+-+++. .+.++++-++
T Consensus        89 vfi~AGlGGgTGtGaaPviA~iake~g~l~v~ivt~PF~~EG~~r~~~A~~gl~~L~~~-~D~~Ivi~Nd  157 (198)
T d1rq2a1          89 VFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRSNQAENGIAALRES-CDTLIVIPND  157 (198)
T ss_dssp             EEEEEETTSSHHHHHHHHHHHHHHHHTCEEEEEEEECCGGGCHHHHHHHHHHHHHHHHH-CSEEEEEEHH
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHHHHHH-HCEEEEECHH
T ss_conf             99997158987741699999999985992899995581777899999999999999986-2759996034


No 31 
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
Probab=28.64  E-value=14  Score=14.05  Aligned_cols=43  Identities=19%  Similarity=0.169  Sum_probs=20.4

Q ss_pred             HHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCHH-HHHHHHHHHCCCCH
Q ss_conf             9999999999825200575338970688887788827-99999999749998
Q gi|255764508|r   95 SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES-IVYNNKLLESGVER  145 (242)
Q Consensus        95 ~Rl~~a~~L~~~~~~~~~~~~ii~SGg~~~~~~~~Ea-~~m~~~l~~~Gv~~  145 (242)
                      +.+.+++++.++-+  +   |+|+.|+....   +++ +.+.+++.+.|+|-
T Consensus         8 ~~i~~~~~~L~~Ak--r---Pvii~G~g~~~---~~a~~~l~~lae~~giPv   51 (179)
T d1ozha1           8 DAIDQVAKLIAQAK--N---PIFLLGLMASQ---PENSKALRRLLETSHIPV   51 (179)
T ss_dssp             HHHHHHHHHHHHCS--S---EEEEECGGGGS---GGGHHHHHHHHHHHCCCE
T ss_pred             HHHHHHHHHHHHCC--C---EEEEECHHHCH---HHHHHHHHHHHHHCCCEE
T ss_conf             99999999999679--9---79998511271---308999999997436248


No 32 
>d1t35a_ c.129.1.1 (A:) Hypothetical protein YvdD {Bacillus subtilis [TaxId: 1423]}
Probab=28.33  E-value=14  Score=14.01  Aligned_cols=24  Identities=8%  Similarity=0.120  Sum_probs=13.3

Q ss_pred             CCEEEECCHHHHHHHHHHHHHCCC
Q ss_conf             640885345889999999997698
Q gi|255764508|r  174 KNIILVSSAYHLKRSQLYFQHFGI  197 (242)
Q Consensus       174 ~~vilVTsa~Hm~RA~~~f~~~gi  197 (242)
                      -...++|..+|.+...+.-..-++
T Consensus        78 ~~~~~~~~~~~~Rk~~m~~~sdaf  101 (179)
T d1t35a_          78 LTELIEVNGMHERKAKMSELADGF  101 (179)
T ss_dssp             CSEEEEESHHHHHHHHHHHHCSEE
T ss_pred             CEEEEEECCHHHHHHHHHHHCCEE
T ss_conf             102455353899989999726737


No 33 
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]}
Probab=27.98  E-value=14  Score=13.97  Aligned_cols=40  Identities=15%  Similarity=0.200  Sum_probs=31.0

Q ss_pred             HHHHHCCCCCEEEECCHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             99762368640885345889999999997698189984266
Q gi|255764508|r  166 SMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY  206 (242)
Q Consensus       166 ~il~~~~~~~vilVTsa~Hm~RA~~~f~~~gi~~~p~~~d~  206 (242)
                      +.+++.+.+++.+-|.. +-.+|...+++.|++..+.--||
T Consensus        86 ~~a~~~g~~~~~l~~~~-~n~~a~~fYek~GF~~~~~~~~~  125 (152)
T d1yvka1          86 EKAKKLGADTIEIGTGN-SSIHQLSLYQKCGFRIQAIDHDF  125 (152)
T ss_dssp             HHHHHTTCSEEEEEEET-TCHHHHHHHHHTTCEEEEEETTH
T ss_pred             HHHHHHCCCCCCEEECC-CCHHHHHHHHHCCCEEEEEECCC
T ss_conf             88642000201012145-87999999998899999899373


No 34 
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]}
Probab=27.67  E-value=15  Score=13.94  Aligned_cols=14  Identities=14%  Similarity=0.064  Sum_probs=6.2

Q ss_pred             HHHHHHHHHHCCCE
Q ss_conf             99999999976981
Q gi|255764508|r  185 LKRSQLYFQHFGIN  198 (242)
Q Consensus       185 m~RA~~~f~~~gi~  198 (242)
                      ...+..+.+..|.+
T Consensus       253 ~~~~~~i~~~~~~~  266 (315)
T d1e6ua_         253 RELAQTIAKVVGYK  266 (315)
T ss_dssp             HHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHCCC
T ss_conf             99999999986998


No 35 
>d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=27.64  E-value=15  Score=13.94  Aligned_cols=25  Identities=8%  Similarity=0.167  Sum_probs=16.9

Q ss_pred             CCEEEECCHHHHHHHHHHHHHCCCE
Q ss_conf             6408853458899999999976981
Q gi|255764508|r  174 KNIILVSSAYHLKRSQLYFQHFGIN  198 (242)
Q Consensus       174 ~~vilVTsa~Hm~RA~~~f~~~gi~  198 (242)
                      ..+++-=+.-.+.-....++..|++
T Consensus       104 ~~~~iCGp~~m~~~v~~~L~~~G~~  128 (143)
T d1gvha3         104 MQFYLCGPVGFMQFTAKQLVDLGVK  128 (143)
T ss_dssp             CEEEEESCHHHHHHHHHHHHHTTCC
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCCC
T ss_conf             4799848489999999999985999


No 36 
>d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]}
Probab=25.23  E-value=16  Score=13.66  Aligned_cols=19  Identities=21%  Similarity=0.167  Sum_probs=11.0

Q ss_pred             CCCCHHHHHHHHHHHCCCC
Q ss_conf             7888279999999974999
Q gi|255764508|r  126 HGLAESIVYNNKLLESGVE  144 (242)
Q Consensus       126 ~~~~Ea~~m~~~l~~~Gv~  144 (242)
                      ....||+.+.+.|.+.|++
T Consensus        50 ~~~~~A~~~~~~L~~~G~~   68 (77)
T d1utaa_          50 KGKENADSTLNRLKMAGHT   68 (77)
T ss_dssp             BTTTHHHHHHHHHHHHCCS
T ss_pred             CCHHHHHHHHHHHHHCCCC
T ss_conf             9999999999999986998


No 37 
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]}
Probab=23.10  E-value=18  Score=13.40  Aligned_cols=65  Identities=8%  Similarity=0.054  Sum_probs=41.5

Q ss_pred             HHHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             999999997499987811110146657779999999762368640885345889999999997698189984266
Q gi|255764508|r  132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY  206 (242)
Q Consensus       132 ~~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa~Hm~RA~~~f~~~gi~~~p~~~d~  206 (242)
                      +.+++++...||++++|++-+-+.    ++.+.  +++.  .+++++..-.|...+  ..++..|.+++++|.|.
T Consensus        63 ~aia~~~~~~~v~~d~I~it~G~~----~~l~~--l~~~--~d~v~i~~P~y~~~~--~~~~~~g~~~v~v~~~~  127 (334)
T d2f8ja1          63 EKILSYLDTDFLSKNNVSVGNGAD----EIIYV--MMLM--FDRSVFFPPTYSCYR--IFAKAVGAKFLEVPLTK  127 (334)
T ss_dssp             HHHHHHHTCSSCCGGGEEEEEHHH----HHHHH--HHHH--SSEEEECSSCCHHHH--HHHHHHTCCEEECCCCT
T ss_pred             HHHHHHHCCCCCCCCEEEECCCCH----HHHHH--HHHH--CCCCCCCCCCCCCCC--CCHHCCCCCCCCCCCCC
T ss_conf             999987354578820388537521----67777--7640--343211122232221--00002687421343333


No 38 
>d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]}
Probab=22.79  E-value=17  Score=13.48  Aligned_cols=26  Identities=15%  Similarity=0.132  Sum_probs=14.1

Q ss_pred             CCEEEECCHHHHHHHHHHHHHCCCEE
Q ss_conf             64088534588999999999769818
Q gi|255764508|r  174 KNIILVSSAYHLKRSQLYFQHFGINT  199 (242)
Q Consensus       174 ~~vilVTsa~Hm~RA~~~f~~~gi~~  199 (242)
                      ..+++-=++-.|.=.....+..|++.
T Consensus       102 ~~vyiCGp~~m~~~v~~~l~~~Gv~~  127 (141)
T d1tvca2         102 PDIYLCGPPGMIDAACELVRSRGIPG  127 (141)
T ss_dssp             SEEEEESSHHHHHHHHHHHHHHCCCC
T ss_pred             CEEECCCCHHHHHHHHHHHHHCCCCH
T ss_conf             21350087999999999999839998


No 39 
>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}
Probab=22.67  E-value=18  Score=13.34  Aligned_cols=23  Identities=9%  Similarity=0.244  Sum_probs=10.6

Q ss_pred             CEEEECCHHHHHHHHHHHHHCCC
Q ss_conf             40885345889999999997698
Q gi|255764508|r  175 NIILVSSAYHLKRSQLYFQHFGI  197 (242)
Q Consensus       175 ~vilVTsa~Hm~RA~~~f~~~gi  197 (242)
                      .+++--++-.|.=....+++.|+
T Consensus       103 ~vyiCGp~~m~~~v~~~L~~~G~  125 (142)
T d1cqxa3         103 DYYICGPIPFMRMQHDALKNLGI  125 (142)
T ss_dssp             EEEEESSHHHHHHHHHHHHHTTC
T ss_pred             EEEEECCHHHHHHHHHHHHHCCC
T ss_conf             49997881689999999998599


No 40 
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]}
Probab=22.40  E-value=18  Score=13.31  Aligned_cols=67  Identities=15%  Similarity=0.190  Sum_probs=36.4

Q ss_pred             HHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEE-CCHHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             99999997499987811110146657779999999762368640885-34588999999999769818998426
Q gi|255764508|r  133 VYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILV-SSAYHLKRSQLYFQHFGINTKASCSD  205 (242)
Q Consensus       133 ~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilV-Tsa~Hm~RA~~~f~~~gi~~~p~~~d  205 (242)
                      ..+..+...||++++|++.+-|..-...+..   .+.+. .+..+++ +..|.+.+  ..++..|.++.+++.+
T Consensus        61 Lr~~ia~~~gv~pe~I~it~Gs~eai~~~~~---~~~~p-gd~~Vl~~~P~y~~~~--~~~~~~g~~v~~~~~~  128 (354)
T d1fg7a_          61 VIENYAQYAGVKPEQVLVSRGADEGIELLIR---AFCEP-GKDAILYCPPTYGMYS--VSAETIGVECRTVPTL  128 (354)
T ss_dssp             HHHHHHHHHTSCGGGEEEESHHHHHHHHHHH---HHCCT-TTCEEEECSSSCTHHH--HHHHHHTCEEEECCCC
T ss_pred             HHHHHHHHHCCCHHHEEECCCCHHHHHHHHH---HHHCC-CCCCCCCCCCCCCCCH--HHHHCCCCEEECCCCC
T ss_conf             9999999849786785533572488888887---75312-3333456632231110--1121268422104533


No 41 
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=21.76  E-value=19  Score=13.22  Aligned_cols=20  Identities=10%  Similarity=0.022  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHCCCEEEEEE
Q ss_conf             89999999997698189984
Q gi|255764508|r  184 HLKRSQLYFQHFGINTKASC  203 (242)
Q Consensus       184 Hm~RA~~~f~~~gi~~~p~~  203 (242)
                      |..+-....++.|.++.-+.
T Consensus       220 ~s~~l~~~L~~~g~~~~~~~  239 (263)
T d1vkha_         220 QTNCLISCLQDYQLSFKLYL  239 (263)
T ss_dssp             HHHHHHHHHHHTTCCEEEEE
T ss_pred             HHHHHHHHHHHCCCCEEEEE
T ss_conf             99999999997899889999


No 42 
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
Probab=21.45  E-value=19  Score=13.18  Aligned_cols=54  Identities=9%  Similarity=0.035  Sum_probs=23.9

Q ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHH
Q ss_conf             3897068888778882799999999749998781111014665777999999976236864088534588
Q gi|255764508|r  115 TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYH  184 (242)
Q Consensus       115 ~ii~SGg~~~~~~~~Ea~~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTsa~H  184 (242)
                      ..++||..        .+.......++|++  .+.-+-.    -++-...-+-++.  ...+..|-+..+
T Consensus        40 v~ilTGD~--------~~~a~~ia~~lgI~--~v~~~~~----p~~k~~~v~~~q~--~~~v~~vGDg~n   93 (135)
T d2b8ea1          40 VGMITGDN--------WRSAEAISRELNLD--LVIAEVL----PHQKSEEVKKLQA--KEVVAFVGDGIN   93 (135)
T ss_dssp             EEEECSSC--------HHHHHHHHHHHTCS--EEECSCC----HHHHHHHHHHHTT--TSCEEEEECSSS
T ss_pred             EEEECCCC--------HHHHHHHHHHHHHH--HHCCCCC----HHHHHHHHHHHHC--CCEEEEEECCCC
T ss_conf             99975863--------35556777654222--1012110----2679999999985--997899967877


No 43 
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]}
Probab=20.62  E-value=20  Score=13.07  Aligned_cols=82  Identities=13%  Similarity=0.037  Sum_probs=40.6

Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCEEEECC--HHHHHHHHHHHH
Q ss_conf             897068888778882799999999749998781111014665777999999976236864088534--588999999999
Q gi|255764508|r  116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS--AYHLKRSQLYFQ  193 (242)
Q Consensus       116 ii~SGg~~~~~~~~Ea~~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~~~~~il~~~~~~~vilVTs--a~Hm~RA~~~f~  193 (242)
                      .|++|++ ++  .+-++-..+.|.++||+-+  ..-..++-|-+......+-.+.++.+ ++++-.  +-|++=...-. 
T Consensus         6 ~IimGS~-SD--~~v~~~a~~~L~~~gI~~e--~~v~SAHR~p~~l~~~~~~~e~~~~~-viIa~AG~aaaLpgvva~~-   78 (159)
T d1u11a_           6 GIIMGSQ-SD--WETMRHADALLTELEIPHE--TLIVSAHRTPDRLADYARTAAERGLN-VIIAGAGGAAHLPGMCAAW-   78 (159)
T ss_dssp             EEEESSG-GG--HHHHHHHHHHHHHTTCCEE--EEECCTTTCHHHHHHHHHHTTTTTCC-EEEEEEESSCCHHHHHHHH-
T ss_pred             EEEECCH-HH--HHHHHHHHHHHHHHCCCEE--EEEEHHHHCHHHHHHHHHHHHHCCCE-EEEEEECCCCCCCCCEEEE-
T ss_conf             9995777-55--9999999999999099559--98746864868899999999865974-8998715888776633221-


Q ss_pred             HCCCEEEEEECC
Q ss_conf             769818998426
Q gi|255764508|r  194 HFGINTKASCSD  205 (242)
Q Consensus       194 ~~gi~~~p~~~d  205 (242)
                       .-..++++|++
T Consensus        79 -t~~PVIgvP~~   89 (159)
T d1u11a_          79 -TRLPVLGVPVE   89 (159)
T ss_dssp             -CSSCEEEEEEC
T ss_pred             -CCEEEEEECCC
T ss_conf             -35057885246


No 44 
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=20.01  E-value=20  Score=12.99  Aligned_cols=87  Identities=14%  Similarity=0.096  Sum_probs=46.8

Q ss_pred             HHHHHCCCCCCCCEEEECCCCCCCCCCCH--HHHHHHHHHHCCCCHHHHHCCHHHHHHHHHHH-HHHHHHHHCCCCCEEE
Q ss_conf             99982520057533897068888778882--79999999974999878111101466577799-9999976236864088
Q gi|255764508|r  102 RLYKSCKQHSMHCTIIISGGDPQKHGLAE--SIVYNNKLLESGVERDDIKLETQSLDTFQNAQ-FSSSMIKNMQGKNIIL  178 (242)
Q Consensus       102 ~L~~~~~~~~~~~~ii~SGg~~~~~~~~E--a~~m~~~l~~~Gv~~~~I~~e~~s~nT~ena~-~~~~il~~~~~~~vil  178 (242)
                      .|.++|..     +|.+-|+.........  .+...+.+.+.|+....+.-..    +.+++. ..++++.+ +. ..++
T Consensus       109 ~L~~~g~~-----~i~~i~~~~~~~~~~~~r~~g~~~~~~~~~i~~~~~~~~~----~~~~~~~~~~~~l~~-~~-~aii  177 (255)
T d1byka_         109 RLYDQGHR-----NISYLGVPHSDVTTGKRRHEAYLAFCKAHKLHPVAALPGL----AMKQGYENVAKVITP-ET-TALL  177 (255)
T ss_dssp             HHHHTTCC-----CEEEECCCTTSTTTTHHHHHHHHHHHHHTTCCCEEECCCS----CHHHHHHHSGGGCCT-TC-CEEE
T ss_pred             HHHHHCCC-----CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCC----CHHHHHHHHHHHHCC-CC-CEEE
T ss_conf             99985125-----4323577744550777776679999997399862013778----778888999997077-65-4430


Q ss_pred             ECCHHHHHHHHHHHHHCCCEE
Q ss_conf             534588999999999769818
Q gi|255764508|r  179 VSSAYHLKRSQLYFQHFGINT  199 (242)
Q Consensus       179 VTsa~Hm~RA~~~f~~~gi~~  199 (242)
                      ++++.....++...+..|++.
T Consensus       178 ~~~d~~A~g~~~~l~~~g~~d  198 (255)
T d1byka_         178 CATDTLALGASKYLQEQRIDT  198 (255)
T ss_dssp             ESSHHHHHHHHHHHHHTTCCS
T ss_pred             CCCHHHHHHHHHHHHHHCCCC
T ss_conf             344365756999999848664


Done!