BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764508|ref|YP_003065363.2| hypothetical protein
CLIBASIA_04245 [Candidatus Liberibacter asiaticus str. psy62]
         (242 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764508|ref|YP_003065363.2| hypothetical protein CLIBASIA_04245 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254547859|gb|ACT57423.2| hypothetical protein CLIBASIA_04245 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 242

 Score =  498 bits (1281), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 242/242 (100%), Positives = 242/242 (100%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP
Sbjct: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG
Sbjct: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS
Sbjct: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG
Sbjct: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240

Query: 241 NR 242
           NR
Sbjct: 241 NR 242


>gi|33599364|ref|NP_886924.1| hypothetical protein BB0375 [Bordetella bronchiseptica RB50]
 gi|33566960|emb|CAE30873.1| putative exported protein [Bordetella bronchiseptica RB50]
          Length = 251

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 93/223 (41%), Positives = 136/223 (60%), Gaps = 10/223 (4%)

Query: 13  WHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVL 71
           W    ++ R ++ +S  ++LF  +G G I   LL  LQ  YQ +P ++  W +  N IVL
Sbjct: 18  WRQWRRASRMLYGLS--LVLFLALGCGPIAAWLLDGLQSDYQAKPPIA--WGQR-NAIVL 72

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
           LG GT       A RIEP   SY+RI E  R Y  C++ +  C +I+SGGD   HG AE+
Sbjct: 73  LGAGTEQA----AGRIEPGIFSYARIVEAARRYHDCRKAAAQCKLIVSGGDAAYHGDAEA 128

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
            VY + L+  GV+  D+  E  S++T+QNAQF+S++++      ++LVSS  HLKRS LY
Sbjct: 129 NVYRDPLVALGVDAADVLPEPGSMNTWQNAQFTSAVLRRYDADRVVLVSSGIHLKRSALY 188

Query: 192 FQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           F HFG+      +DYL+A +S++PLS NF + + AL EY+GI+
Sbjct: 189 FAHFGVAATPVRADYLHARWSVVPLSYNFAVADFALHEYLGIV 231


>gi|33595083|ref|NP_882726.1| hypothetical protein BPP0372 [Bordetella parapertussis 12822]
 gi|33565160|emb|CAE35956.1| putative exported protein [Bordetella parapertussis]
          Length = 251

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 134/223 (60%), Gaps = 10/223 (4%)

Query: 13  WHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVL 71
           W    ++ R ++ +S  ++LF  +G G I   LL  LQ  YQ +P ++  W +  N IVL
Sbjct: 18  WRQWRRASRMLYGLS--LVLFLALGCGPIAAWLLDGLQSDYQAKPPIA--WGQR-NAIVL 72

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
           LG GT       A RIEP   SY+RI E  R Y  C++ +  C +I SGGD   HG AE+
Sbjct: 73  LGAGTEQA----AGRIEPGIFSYARIVEAARRYHDCRKAAAQCKLIASGGDAAYHGDAEA 128

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
            VY + L+  GV+  D+  E  S++T+QNAQF+S++++      ++LVSS  HLKRS LY
Sbjct: 129 NVYRDPLVALGVDAADVLPEPGSMNTWQNAQFTSAVLRRYDADRVVLVSSGIHLKRSALY 188

Query: 192 FQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           F +FG+      +DYL+A  S++PLS NF + + AL EY+GI+
Sbjct: 189 FAYFGVAATPVRADYLHARRSVVPLSYNFAVADFALHEYLGIV 231


>gi|148975915|ref|ZP_01812704.1| hypothetical protein VSWAT3_06376 [Vibrionales bacterium SWAT-3]
 gi|145964660|gb|EDK29913.1| hypothetical protein VSWAT3_06376 [Vibrionales bacterium SWAT-3]
          Length = 253

 Score =  165 bits (418), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 122/200 (61%), Gaps = 4/200 (2%)

Query: 33  FSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQ 92
           F  IG G IP  LL  LQ +Y+    + QW  D N IVLLG GT +I +      EP+F 
Sbjct: 36  FVLIGSGFIPRYLLDDLQANYESKSEN-QWS-DNNAIVLLGAGTQLIKSTQ--EFEPAFF 91

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLET 152
           SY RI ET   YK C +    C +IISGGD Q +G+ E+ +Y  +LL  GV + DI  E 
Sbjct: 92  SYGRISETASQYKDCAKSDTKCKVIISGGDAQGNGVTEAEIYEQQLLRLGVPKADIIQEP 151

Query: 153 QSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYS 212
            S++T++NAQ +S ++K+ Q  NIILVSS  H++RS+LYF HFG+      SDY+ A  S
Sbjct: 152 NSVNTWKNAQLTSDLMKHHQFDNIILVSSGLHIRRSELYFNHFGLEVIPVRSDYMAAQIS 211

Query: 213 IIPLSANFYLTELALKEYIG 232
            +PL  NF +T+ AL E IG
Sbjct: 212 WLPLWYNFAVTDFALHEQIG 231


>gi|218709695|ref|YP_002417316.1| hypothetical protein VS_1706 [Vibrio splendidus LGP32]
 gi|218322714|emb|CAV18890.1| conserved hypothetical protein [Vibrio splendidus LGP32]
          Length = 253

 Score =  165 bits (418), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 92/202 (45%), Positives = 127/202 (62%), Gaps = 6/202 (2%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQR-PLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPS 90
           LF  IG G+IP  LL  LQ +Y+R P +  QW    N IVLLG GT +I +      EP+
Sbjct: 35  LFVLIGSGLIPRYLLNDLQANYERKPDI--QWTSH-NAIVLLGAGTQLIASTQ--EFEPT 89

Query: 91  FQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL 150
           F S+ RI ET   YK+C +    C +I+SGGD Q +G+ E+ VY  +LL  GV R DI  
Sbjct: 90  FFSFGRINETASQYKNCAKAQTICKVIVSGGDAQNNGVTEAEVYQQQLLRLGVPRADIIQ 149

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E  S++T++NAQ +S ++K+ Q  NI+LVSS  H++RS+LYF HFG+N     +DY+ A 
Sbjct: 150 EPNSVNTWKNAQLTSDLMKHHQFDNIVLVSSGLHIRRSELYFNHFGLNVIPLRADYMAAQ 209

Query: 211 YSIIPLSANFYLTELALKEYIG 232
            S +PL  NF +T+ AL E +G
Sbjct: 210 ISWLPLWYNFAVTDFALHEQLG 231


>gi|149909508|ref|ZP_01898162.1| hypothetical protein PE36_16920 [Moritella sp. PE36]
 gi|149807413|gb|EDM67364.1| hypothetical protein PE36_16920 [Moritella sp. PE36]
          Length = 257

 Score =  165 bits (418), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/222 (43%), Positives = 127/222 (57%), Gaps = 18/222 (8%)

Query: 15  LLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSY--QRPLLSPQWKKDGNIIVLL 72
           LLC +I          LL   I  G+IP  LL  LQ  Y  Q P+    W+ D N I+LL
Sbjct: 28  LLCSTI----------LLTVLISIGVIPKYLLDKLQQDYVAQAPI---HWQ-DNNAIILL 73

Query: 73  GNG-TTIIPTIPAIR-IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAE 130
           G G   +  TI  +  IEP F ++SRI+   RLY  C      C II+SGGD QK G  E
Sbjct: 74  GAGLEKVGDTINNVDSIEPPFHAFSRIYAAARLYNECIGTEQQCKIIVSGGDTQKLGDTE 133

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQL 190
           + VY N+L+  G+   DI  E  SL+T+QNAQF+S ++      N +L+SS  H+KRSQL
Sbjct: 134 AAVYKNRLVSIGINAADIITEPNSLNTWQNAQFTSDILSKGDFDNSVLISSGLHIKRSQL 193

Query: 191 YFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIG 232
           YF+HFG+      +DY++A  S IPL  NF LT+ AL E+IG
Sbjct: 194 YFEHFGVRATPIRADYMSATVSFIPLGYNFALTDFALHEWIG 235


>gi|84387309|ref|ZP_00990329.1| hypothetical protein V12B01_04678 [Vibrio splendidus 12B01]
 gi|84377758|gb|EAP94621.1| hypothetical protein V12B01_04678 [Vibrio splendidus 12B01]
          Length = 253

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 94/224 (41%), Positives = 131/224 (58%), Gaps = 6/224 (2%)

Query: 10  VSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNI 68
           V +  LL      +F     +  F  IG G+IP  LL  LQ  Y+ +P +  QW  D N 
Sbjct: 13  VGFTRLLQWRKTSLFLSLVLISSFVLIGSGLIPRYLLNDLQADYESKPDI--QWS-DNNA 69

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           IVLLG GT +I +      EP+F S+ RI ET   YK C +    C +IISGGD Q +G+
Sbjct: 70  IVLLGAGTQLIKSTQ--EFEPAFFSFGRISETASQYKDCAKAQTTCKVIISGGDAQNNGV 127

Query: 129 AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS 188
            E+ +Y  +LL   V  DDI  E  S++T++NAQ +S ++K+ +  NI+LVSS  H++RS
Sbjct: 128 TEAEIYQQQLLRLDVPMDDIIQEPNSVNTWKNAQLTSDLMKHHKFDNIVLVSSGLHIRRS 187

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIG 232
           +LYF HFG+N     +DY+ A  S +PL  NF +T+ AL E IG
Sbjct: 188 ELYFNHFGLNVIPVRADYMAAQISWLPLWYNFAVTDFALHEQIG 231


>gi|21242461|ref|NP_642043.1| hypothetical protein XAC1712 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21107907|gb|AAM36579.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 253

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/212 (40%), Positives = 133/212 (62%), Gaps = 5/212 (2%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT 81
           ++  ++  +L+F+ +G G +P+ +L+HLQ +      +  W    N+IVLLG GT + P 
Sbjct: 26  RVLGLASLLLVFA-VGCGPLPSWMLQHLQRTGVNDFNA--WGAR-NVIVLLGAGT-VRPE 80

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
                 E +  +Y RI E+ RLY  C+     C I ISGGD +  GL+E++VY   LL  
Sbjct: 81  GRDAVAEANLFAYGRIVESARLYWQCRHSGGDCKIEISGGDARGLGLSEAVVYQRVLLGL 140

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+ R D+ +E  S++T+QNAQFS  ++++ +   I LVSSA HL+R++LYF+HFGI+   
Sbjct: 141 GIPRADLIMEPSSMNTWQNAQFSQPLLRDYRPDRIALVSSATHLRRAELYFRHFGIDATP 200

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
             +D+L A +SI+P S NF L ++AL EY+GI
Sbjct: 201 VRADWLTATWSILPQSYNFTLADVALHEYLGI 232


>gi|294626655|ref|ZP_06705252.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665846|ref|ZP_06731114.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292599075|gb|EFF43215.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604356|gb|EFF47739.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 252

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/212 (40%), Positives = 133/212 (62%), Gaps = 5/212 (2%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT 81
           ++  ++  +L+F+ +G G +P+ +L+HLQ +      +  W    N+IVLLG GT + P 
Sbjct: 25  RVLGLASLLLVFA-VGCGPLPSWMLQHLQRTGVNDFNA--WGAR-NVIVLLGAGT-VRPE 79

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
                 E +  +Y RI E+ RLY  C+     C I ISGGD +  GL+E++VY   LL  
Sbjct: 80  GRDAVAEANLFAYGRIVESARLYWQCRHSGGDCKIEISGGDARGLGLSEAVVYQRVLLGL 139

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+ R D+ +E  S++T+QNAQFS  ++++ +   I LVSSA HL+R++LYF+HFGI+   
Sbjct: 140 GIPRADLIMEPSSMNTWQNAQFSQPLLRDYRPDRIALVSSATHLRRAELYFRHFGIDATP 199

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
             +D+L A +SI+P S NF L ++AL EY+GI
Sbjct: 200 VRADWLTATWSILPQSYNFTLADVALHEYLGI 231


>gi|325924933|ref|ZP_08186362.1| hypothetical protein XPE_0280 [Xanthomonas perforans 91-118]
 gi|325544656|gb|EGD16010.1| hypothetical protein XPE_0280 [Xanthomonas perforans 91-118]
          Length = 253

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 86/212 (40%), Positives = 132/212 (62%), Gaps = 5/212 (2%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT 81
           ++  ++  +L+F+ +G G +P+ +L+HLQ +      +  W    N+IVLLG GT + P 
Sbjct: 26  RVLGLASLLLVFA-VGCGPLPSWMLQHLQRTGVNDFNA--WGAR-NVIVLLGAGT-VRPE 80

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
                 E +  +Y RI E+ RLY  C+     C I ISGGD +  GL+E++VY   LL  
Sbjct: 81  GRDAVAEANLFAYGRIVESARLYWQCRHSGGDCKIEISGGDARGLGLSEAVVYQRVLLGL 140

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+ R D+ +E  S++T+QNAQFS  +++  +   I LVSSA HL+R++LYF+HFGI+   
Sbjct: 141 GIPRADLIMEPSSMNTWQNAQFSQPLLRAYRPDRIALVSSATHLRRAELYFRHFGIDATP 200

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
             +D+L A +SI+P S NF L ++AL EY+GI
Sbjct: 201 VRADWLTATWSILPQSYNFTLADVALHEYLGI 232


>gi|78047302|ref|YP_363477.1| hypothetical protein XCV1746 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78035732|emb|CAJ23423.1| putative membrane protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 252

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 86/212 (40%), Positives = 132/212 (62%), Gaps = 5/212 (2%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT 81
           ++  ++  +L+F+ +G G +P+ +L+HLQ +      +  W    N+IVLLG GT + P 
Sbjct: 25  RVLGLASLLLVFA-VGCGPLPSWMLQHLQRTGVNDFNA--WGAR-NVIVLLGAGT-VRPE 79

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
                 E +  +Y RI E+ RLY  C+     C I ISGGD +  GL+E++VY   LL  
Sbjct: 80  GRDAVAEANLFAYGRIVESARLYWQCRHSGGDCKIEISGGDARGLGLSEAVVYQRVLLGL 139

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+ R D+ +E  S++T+QNAQFS  +++  +   I LVSSA HL+R++LYF+HFGI+   
Sbjct: 140 GIPRADLIMEPSSMNTWQNAQFSQPLLRAYRPDRIALVSSATHLRRAELYFRHFGIDATP 199

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
             +D+L A +SI+P S NF L ++AL EY+GI
Sbjct: 200 VRADWLTATWSILPQSYNFTLADVALHEYLGI 231


>gi|188575890|ref|YP_001912819.1| transmembrane [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188520342|gb|ACD58287.1| transmembrane [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 253

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 135/218 (61%), Gaps = 7/218 (3%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT 81
           ++  ++  +L+F+ +G G +P+ +L HLQ +      +  W    N+IVLLG GT + P 
Sbjct: 26  RVLGLTSVLLVFA-VGCGPLPSWMLHHLQHTGVNDFNA--WGAR-NVIVLLGAGT-VRPE 80

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
                 E +  +Y RI E+ RLY+ C+     C I ISGGDP+  GL+E++VY   L++ 
Sbjct: 81  GRDAVAEANMFAYGRIVESARLYQQCRHSGGDCKIEISGGDPRGLGLSEAVVYRRVLVDL 140

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
            + + D+ +E  S++T QNAQFS  +++  +   I+LVSSA HL R++LYF+HFGI+   
Sbjct: 141 AIPQADVIMEPSSMNTLQNAQFSQPLLRAYRPDRIVLVSSATHLCRAELYFRHFGIDATP 200

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
             +D+L A +SI+P S NF L ++AL EY+G  +A YR
Sbjct: 201 VRADWLTATWSILPQSYNFTLADVALHEYLG--MARYR 236


>gi|325916062|ref|ZP_08178352.1| hypothetical protein XVE_2286 [Xanthomonas vesicatoria ATCC 35937]
 gi|325537738|gb|EGD09444.1| hypothetical protein XVE_2286 [Xanthomonas vesicatoria ATCC 35937]
          Length = 253

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 89/236 (37%), Positives = 142/236 (60%), Gaps = 7/236 (2%)

Query: 1   MLLSWIFLIVSY-WHLLCQSIRKI--FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPL 57
           M+L+ + ++  + W L  + +R+         +LL   IG G +P+ +L++LQ +     
Sbjct: 1   MMLALVCVLFGFAWLLDRRGLRRFSRVLAGASLLLVLAIGCGPLPSWMLQNLQRTGVNDF 60

Query: 58  LSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTII 117
               W    N+IVLLG GT + P       E +  +Y RI E+ RLY+ C+     C I 
Sbjct: 61  --NGWGAR-NVIVLLGAGT-VRPEGRDAVAEANMFAYGRIVESARLYRQCRHSGGDCKIE 116

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ISGGD +  GL+E++VY   L+  G++R D+ +E  S++T+QNAQFS  +++  +   ++
Sbjct: 117 ISGGDARGLGLSEAVVYQRVLIGLGIDRADLIMEPSSMNTWQNAQFSQPLLRAHRPDRVV 176

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           LVSSA HL+R++LYF+HFGI+     +D+L A +SI+P S NF L ++AL EY+GI
Sbjct: 177 LVSSATHLRRAELYFRHFGIDAIPVRADWLTASWSILPQSYNFTLADVALHEYLGI 232


>gi|166712483|ref|ZP_02243690.1| hypothetical protein Xoryp_13775 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 253

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 133/212 (62%), Gaps = 5/212 (2%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT 81
           ++  ++  +L+F+ +G G +P+ +L HLQ +      +  W    N+IVLLG GT + P 
Sbjct: 26  RVLGLTSVLLVFA-VGCGPLPSWMLHHLQHTGVSDFNA--WGAR-NVIVLLGAGT-VRPE 80

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
              +  E +  +Y RI E+ RLY+ C+     C I ISGGDP+  GL+E++VY   L+  
Sbjct: 81  GRDVVAEANMFAYGRIVESARLYQQCRHSGGDCKIEISGGDPRGLGLSEAVVYRRVLVGL 140

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
            + + D+ +E  S++T+QNAQFS  +++  +   I+LVSSA HL R++LYF+HFGI+   
Sbjct: 141 AIPQADVIIEPSSMNTWQNAQFSQPLLRAYRPDRIVLVSSATHLCRAELYFRHFGIDATP 200

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
             +D+L A +SI+P S NF L ++AL EY+G+
Sbjct: 201 VRADWLTATWSILPQSYNFTLADVALHEYLGM 232


>gi|84624480|ref|YP_451852.1| hypothetical protein XOO_2823 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|84368420|dbj|BAE69578.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 253

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 134/218 (61%), Gaps = 7/218 (3%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT 81
           ++  ++  +L+F+ +G G +P+ +L HLQ +      +  W    N+IVLLG GT + P 
Sbjct: 26  RVLGLTSVLLVFA-VGCGPLPSWMLHHLQHTGVNDFNA--WGAR-NVIVLLGAGT-VRPE 80

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
                 E +  +Y RI E+ RLY+ C+     C I ISGGDP+  GL+E++VY   L++ 
Sbjct: 81  GRDAVAEANMFAYGRIVESARLYQQCRHSGGDCKIEISGGDPRGLGLSEAVVYRRVLVDL 140

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
            + + D+ +E  S++T QNAQFS  +++      I+LVSSA HL R++LYF+HFGI+   
Sbjct: 141 AIPQADVIMEPSSMNTLQNAQFSQPLLRAYGPDRIVLVSSATHLCRAELYFRHFGIDATP 200

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
             +D+L A +SI+P S NF L ++AL EY+G  +A YR
Sbjct: 201 VRADWLTATWSILPQSYNFTLADVALHEYLG--MARYR 236


>gi|160872133|ref|ZP_02062265.1| transmembrane [Rickettsiella grylli]
 gi|159120932|gb|EDP46270.1| transmembrane [Rickettsiella grylli]
          Length = 282

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 127/211 (60%), Gaps = 4/211 (1%)

Query: 27  SCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIR 86
           S  +L + FIG G+IP  LL +LQ +Y   L +P   K  N I+LLG GT+  P    IR
Sbjct: 61  SIVILSYFFIGNGVIPAYLLHNLQSAYN--LSTPIHWKQKNTIILLGAGTSKDPKSNKIR 118

Query: 87  IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERD 146
             PS  ++SRI +T+ LY  CK+ +  CTI+ISGGDP  +G  E+ +Y   LL  G+   
Sbjct: 119 --PSLFAFSRIIQTVLLYHKCKKANTICTILISGGDPLNNGNTEATIYQEALLSLGINAK 176

Query: 147 DIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
           DI+LETQS +T+QNA+FSS ++K      ++LV+SA+ LKRS LYF  F I      SD+
Sbjct: 177 DIQLETQSNNTYQNAKFSSFLLKKQDSSQLLLVNSAFTLKRSLLYFSFFNIYPTPIASDF 236

Query: 207 LNAYYSIIPLSANFYLTELALKEYIGILIAY 237
           +   ++  P+  NF + +  + EY+GI   Y
Sbjct: 237 ITIPFTRYPIGYNFAMNDFVIHEYVGIFRFY 267


>gi|325923915|ref|ZP_08185510.1| hypothetical protein XGA_4563 [Xanthomonas gardneri ATCC 19865]
 gi|325545597|gb|EGD16856.1| hypothetical protein XGA_4563 [Xanthomonas gardneri ATCC 19865]
          Length = 253

 Score =  158 bits (399), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 114/173 (65%), Gaps = 3/173 (1%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           N+IVLLG GT + P  P    E +  +Y RI E+ RLY+ C+ H   C I ISGGD +  
Sbjct: 67  NMIVLLGAGT-VRPDGPDATAEANMFAYGRIVESARLYRQCRAHGGDCKIEISGGDARGL 125

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLK 186
           GL+E++VY   L+  G+++ D+ +E  S++T+QNAQFS  +++  +   ++LVSSA HL+
Sbjct: 126 GLSEAVVYRKVLIGIGIDQADLIMEPSSMNTWQNAQFSQPLLRKYRADRVVLVSSATHLR 185

Query: 187 RSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           R++LYF+HFGI      SD+L A ++ +P S NF + ++AL EY+G  IA YR
Sbjct: 186 RAELYFRHFGIEATPVRSDWLTASWAWLPQSYNFTVADVALHEYLG--IARYR 236


>gi|53716341|ref|YP_106250.1| hypothetical protein BMAA1685 [Burkholderia mallei ATCC 23344]
 gi|53722689|ref|YP_111674.1| hypothetical protein BPSS1669 [Burkholderia pseudomallei K96243]
 gi|67640781|ref|ZP_00439576.1| putative membrane protein [Burkholderia mallei GB8 horse 4]
 gi|76818145|ref|YP_335892.1| hypothetical protein BURPS1710b_A0733 [Burkholderia pseudomallei
           1710b]
 gi|121597067|ref|YP_991282.1| hypothetical protein BMASAVP1_1688 [Burkholderia mallei SAVP1]
 gi|124381902|ref|YP_001025692.1| hypothetical protein BMA10229_1895 [Burkholderia mallei NCTC 10229]
 gi|126442720|ref|YP_001063394.1| hypothetical protein BURPS668_A2400 [Burkholderia pseudomallei 668]
 gi|126446879|ref|YP_001077768.1| hypothetical protein BMA10247_A0567 [Burkholderia mallei NCTC
           10247]
 gi|126458095|ref|YP_001076296.1| hypothetical protein BURPS1106A_A2263 [Burkholderia pseudomallei
           1106a]
 gi|166999439|ref|ZP_02265278.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|167743403|ref|ZP_02416177.1| hypothetical protein Bpse14_35344 [Burkholderia pseudomallei 14]
 gi|167820589|ref|ZP_02452269.1| hypothetical protein Bpse9_36024 [Burkholderia pseudomallei 91]
 gi|167828952|ref|ZP_02460423.1| hypothetical protein Bpseu9_35016 [Burkholderia pseudomallei 9]
 gi|167850424|ref|ZP_02475932.1| hypothetical protein BpseB_34607 [Burkholderia pseudomallei B7210]
 gi|167908429|ref|ZP_02495634.1| hypothetical protein BpseN_39774 [Burkholderia pseudomallei NCTC
           13177]
 gi|167915704|ref|ZP_02502795.1| hypothetical protein Bpse112_34808 [Burkholderia pseudomallei 112]
 gi|167923545|ref|ZP_02510636.1| hypothetical protein BpseBC_33634 [Burkholderia pseudomallei
           BCC215]
 gi|237508202|ref|ZP_04520917.1| putative membrane protein [Burkholderia pseudomallei MSHR346]
 gi|254175884|ref|ZP_04882542.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254205102|ref|ZP_04911455.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|52213103|emb|CAH39142.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|52422311|gb|AAU45881.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
 gi|76582618|gb|ABA52092.1| Uncharacterized ACR, COG1434 family [Burkholderia pseudomallei
           1710b]
 gi|121224865|gb|ABM48396.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|126222211|gb|ABN85716.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|126231863|gb|ABN95276.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|126239733|gb|ABO02845.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|147754688|gb|EDK61752.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|160696926|gb|EDP86896.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|235000407|gb|EEP49831.1| putative membrane protein [Burkholderia pseudomallei MSHR346]
 gi|238521564|gb|EEP85015.1| putative membrane protein [Burkholderia mallei GB8 horse 4]
 gi|243064501|gb|EES46687.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|261826553|gb|ABM99690.2| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
          Length = 255

 Score =  158 bits (399), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 132/221 (59%), Gaps = 11/221 (4%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIP 80
           +  F++     F+ IG G++P  LL+ LQ  Y  RP +  +W +  N IV+LG GT  I 
Sbjct: 26  RALFVATVAAFFA-IGCGLVPAWLLRALQAPYAARPAI--EWGER-NAIVMLGLGTEKIA 81

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQH--SMHCTIIISGGDPQKHGLAESIVYNNKL 138
              A+  EP   SYSR+ E   LY+ C++      C I++SGGD +++G+ E+ VY + L
Sbjct: 82  ATGAV--EPGTFSYSRVVEAASLYRDCRRARADADCKILVSGGDARRNGVPEASVYRDAL 139

Query: 139 LESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           +  G++  D+  E +S++T+QNAQF+   +   +   ++LV+S  HL+RS LYF HFG+ 
Sbjct: 140 VGVGIDAADVLSEPRSMNTWQNAQFTRVALDGYRADRVLLVTSGIHLRRSMLYFAHFGVA 199

Query: 199 TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
             A  ++YL A    +PL+ NF + +LAL EY+G  IA YR
Sbjct: 200 AIAVRAEYLQAVTFPLPLAYNFAIADLALHEYLG--IARYR 238


>gi|134278721|ref|ZP_01765435.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|134250505|gb|EBA50585.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
          Length = 255

 Score =  158 bits (399), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 132/221 (59%), Gaps = 11/221 (4%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIP 80
           +  F++     F+ IG G++P  LL+ LQ  Y  RP +  +W +  N IV+LG GT  I 
Sbjct: 26  RALFVATVAAFFA-IGCGLVPAWLLRALQAPYAARPAI--EWGER-NAIVMLGLGTEKIA 81

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQH--SMHCTIIISGGDPQKHGLAESIVYNNKL 138
              A+  EP   SYSR+ E   LY+ C++      C I++SGGD +++G+ E+ VY + L
Sbjct: 82  ATGAV--EPGTFSYSRVVEAASLYRDCRRARADADCKILVSGGDARRNGVPEASVYRDAL 139

Query: 139 LESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           +  G++  D+  E +S++T+QNAQF+   +   +   ++LV+S  HL+RS LYF HFG+ 
Sbjct: 140 VGVGIDAADVLSEPRSMNTWQNAQFTRVALDGYRADRVLLVTSGIHLRRSMLYFAHFGVA 199

Query: 199 TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
             A  ++YL A    +PL+ NF + +LAL EY+G  IA YR
Sbjct: 200 AIAVRAEYLQAVTFPLPLAYNFAIADLALHEYLG--IARYR 238


>gi|309780144|ref|ZP_07674895.1| membrane protein [Ralstonia sp. 5_7_47FAA]
 gi|308920847|gb|EFP66493.1| membrane protein [Ralstonia sp. 5_7_47FAA]
          Length = 262

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/204 (41%), Positives = 123/204 (60%), Gaps = 8/204 (3%)

Query: 31  LLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEP 89
           +L   IG G +P  LL  L+  ++  P +  QW    N IVLLG GT  +       +EP
Sbjct: 45  VLVIAIGCGPVPAWLLDSLEKPFENEPHV--QWGAR-NAIVLLGAGTFRV----GDSVEP 97

Query: 90  SFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIK 149
              SY R+ ET +LY++C++    C I++SGGD + HG  E+ VY  +L+  GV +DD+ 
Sbjct: 98  GLFSYPRLVETTQLYQACRKSDGDCKILVSGGDARHHGSPEATVYQRELVRLGVAKDDVL 157

Query: 150 LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA 209
           +E QS++T+QNAQFS +++        +LVSSA HL+RS LYF HFG+      +D L A
Sbjct: 158 IEPQSMNTWQNAQFSRTVLAQYGADRTVLVSSAIHLRRSLLYFTHFGMAPVPVRADDLQA 217

Query: 210 YYSIIPLSANFYLTELALKEYIGI 233
             S +P++ NF LT+ AL E+IGI
Sbjct: 218 AASPLPMAYNFALTDFALHEWIGI 241


>gi|187927155|ref|YP_001897642.1| hypothetical protein Rpic_0045 [Ralstonia pickettii 12J]
 gi|187724045|gb|ACD25210.1| protein of unknown function DUF218 [Ralstonia pickettii 12J]
          Length = 266

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/204 (41%), Positives = 123/204 (60%), Gaps = 8/204 (3%)

Query: 31  LLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEP 89
           +L   IG G +P  LL  L+  ++  P +  QW    N IVLLG GT  +       +EP
Sbjct: 49  VLVIAIGCGPVPAWLLDSLEKPFENEPHV--QWGAR-NAIVLLGAGTFRV----GDSVEP 101

Query: 90  SFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIK 149
              SY R+ ET +LY++C++    C I++SGGD + HG  E+ VY  +L+  GV +DD+ 
Sbjct: 102 GLFSYPRLVETTQLYQACRKSDGDCKILVSGGDARHHGSPEATVYQRELVRLGVAKDDVL 161

Query: 150 LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA 209
           +E QS++T+QNAQFS +++        +LVSSA HL+RS LYF HFG+      +D L A
Sbjct: 162 IEPQSMNTWQNAQFSRTVLAQYGADRTVLVSSAIHLRRSLLYFTHFGMAPVPVRADDLQA 221

Query: 210 YYSIIPLSANFYLTELALKEYIGI 233
             S +P++ NF LT+ AL E+IGI
Sbjct: 222 AASPLPMAYNFALTDFALHEWIGI 245


>gi|167899018|ref|ZP_02486419.1| hypothetical protein Bpse7_35118 [Burkholderia pseudomallei 7894]
          Length = 255

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 129/215 (60%), Gaps = 9/215 (4%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIP 80
           +  F++     F+ IG G++P  LL+ LQ  Y  RP +  +W +  N IV+LG GT  I 
Sbjct: 26  RALFVATVAAFFA-IGCGLVPAWLLRALQAPYAARPAI--EWGER-NAIVMLGLGTEKIA 81

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQH--SMHCTIIISGGDPQKHGLAESIVYNNKL 138
              A+  EP   SYSR+ E   LY+ C++      C I++SGGD +++G+ E+ VY + L
Sbjct: 82  ATGAV--EPGTFSYSRVVEAASLYRDCRRARADADCKILVSGGDARRNGVPEASVYRDAL 139

Query: 139 LESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           +  G++  D+  E +S++T+QNAQF+   +   +   ++LV+S  HL+RS LYF HFG+ 
Sbjct: 140 VGVGIDSADVLSEPRSMNTWQNAQFTRVALDGYRADRVLLVTSGIHLRRSMLYFAHFGVA 199

Query: 199 TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
             A  ++YL A    +PL+ NF + +LAL EY+GI
Sbjct: 200 AIAVRAEYLQAVTFPLPLAYNFAIADLALHEYLGI 234


>gi|289661763|ref|ZP_06483344.1| hypothetical protein XcampvN_01352 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 253

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 134/216 (62%), Gaps = 5/216 (2%)

Query: 18  QSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTT 77
           + + ++  ++  +L+F+ +G G +P+ +L+ LQ +      +  W    N+IVLLG GT 
Sbjct: 22  RRLSRVLGLTSLLLVFA-VGCGPLPSWMLQRLQHTGVNDFNA--WGGR-NVIVLLGAGT- 76

Query: 78  IIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNK 137
           + P       E +  +Y RI E+ RLY+ C+     C I ISGGD +  GL+E++VY   
Sbjct: 77  VRPEGRDAVAEANMFAYGRIVESARLYQQCRHSGGDCKIEISGGDARGLGLSEAVVYQRV 136

Query: 138 LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
           L+   + + D+ LE  S++T+QNAQFS  +++  +   I+LVSSA HL+R++LYF+HFGI
Sbjct: 137 LVGLAIPQADLILEPSSMNTWQNAQFSQPLLRAYRPDRIVLVSSATHLRRAELYFRHFGI 196

Query: 198 NTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           +     +D+L A +SI+P S NF L ++AL EY+GI
Sbjct: 197 DATPVRADWLTASWSILPQSYNFTLADVALHEYLGI 232


>gi|217422760|ref|ZP_03454263.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|226200064|ref|ZP_03795613.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|242312781|ref|ZP_04811798.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254186269|ref|ZP_04892787.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254194017|ref|ZP_04900449.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|254201133|ref|ZP_04907498.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254262741|ref|ZP_04953606.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|254301320|ref|ZP_04968764.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|254359227|ref|ZP_04975499.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|147748745|gb|EDK55820.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|148028414|gb|EDK86374.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|157811319|gb|EDO88489.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157933955|gb|EDO89625.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|169650768|gb|EDS83461.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|217394991|gb|EEC35010.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|225927916|gb|EEH23954.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|242136020|gb|EES22423.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254213743|gb|EET03128.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 298

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 132/221 (59%), Gaps = 11/221 (4%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIP 80
           +  F++     F+ IG G++P  LL+ LQ  Y  RP +  +W +  N IV+LG GT  I 
Sbjct: 69  RALFVATVAAFFA-IGCGLVPAWLLRALQAPYAARPAI--EWGER-NAIVMLGLGTEKIA 124

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQH--SMHCTIIISGGDPQKHGLAESIVYNNKL 138
              A+  EP   SYSR+ E   LY+ C++      C I++SGGD +++G+ E+ VY + L
Sbjct: 125 ATGAV--EPGTFSYSRVVEAASLYRDCRRARADADCKILVSGGDARRNGVPEASVYRDAL 182

Query: 139 LESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           +  G++  D+  E +S++T+QNAQF+   +   +   ++LV+S  HL+RS LYF HFG+ 
Sbjct: 183 VGVGIDAADVLSEPRSMNTWQNAQFTRVALDGYRADRVLLVTSGIHLRRSMLYFAHFGVA 242

Query: 199 TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
             A  ++YL A    +PL+ NF + +LAL EY+G  IA YR
Sbjct: 243 AIAVRAEYLQAVTFPLPLAYNFAIADLALHEYLG--IARYR 281


>gi|86146806|ref|ZP_01065126.1| hypothetical protein MED222_15709 [Vibrio sp. MED222]
 gi|85835456|gb|EAQ53594.1| hypothetical protein MED222_15709 [Vibrio sp. MED222]
          Length = 253

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 121/196 (61%), Gaps = 4/196 (2%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSR 96
           G G+IP  LL  LQ +Y+R     QW    N I LLG GT +I +      EP+F S+ R
Sbjct: 40  GSGLIPRYLLNDLQANYERKP-DIQWTSH-NAIFLLGAGTQLIASTQ--EFEPTFFSFGR 95

Query: 97  IFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
           I ET   YK+C +    C +I+SGGD Q +G+ E+ VY  +LL  GV   DI  E+ S++
Sbjct: 96  INETASQYKNCAKAQTICKVIVSGGDAQNNGVTEAEVYQQQLLRLGVPLADIIQESNSVN 155

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPL 216
           T++NAQ +S ++K+ Q  NI+LVSS  H++RS+LYF HFG+N     +DY+ A  S +PL
Sbjct: 156 TWKNAQLTSDLMKHHQFDNIVLVSSGLHIRRSELYFNHFGLNVIPVRADYMAAQISWLPL 215

Query: 217 SANFYLTELALKEYIG 232
             NF +T+ AL E +G
Sbjct: 216 WYNFAVTDFALHEQLG 231


>gi|254185037|ref|ZP_04891626.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|184215629|gb|EDU12610.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
          Length = 298

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 132/221 (59%), Gaps = 11/221 (4%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIP 80
           +  F++     F+ IG G++P  LL+ LQ  Y  RP +  +W +  N IV+LG GT  I 
Sbjct: 69  RALFVATVAAFFA-IGCGLVPAWLLRALQAPYAARPAI--EWGER-NAIVMLGLGTEKIA 124

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQH--SMHCTIIISGGDPQKHGLAESIVYNNKL 138
              A+  EP   SYSR+ E   LY+ C++      C I++SGGD +++G+ E+ VY + L
Sbjct: 125 ATGAV--EPGTFSYSRVVEAASLYRDCRRARADADCKILVSGGDARRNGVPEASVYRDAL 182

Query: 139 LESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           +  G++  D+  E +S++T+QNAQF+   +   +   ++LV+S  HL+RS LYF HFG+ 
Sbjct: 183 VGVGIDSADVLSEPRSMNTWQNAQFTRVALDGYRADRVLLVTSGIHLRRSMLYFAHFGVA 242

Query: 199 TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
             A  ++YL A    +PL+ NF + +LAL EY+G  IA YR
Sbjct: 243 AIAVRAEYLQAVTFPLPLAYNFAIADLALHEYLG--IARYR 281


>gi|289668714|ref|ZP_06489789.1| hypothetical protein XcampmN_09524 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 253

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 132/212 (62%), Gaps = 5/212 (2%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT 81
           ++  ++  +L+F+ +G G +P+ +L+ LQ +      +  W    N+IVLLG GT + P 
Sbjct: 26  RVLGLTSLLLVFA-VGCGPLPSWMLQRLQHTGVNDFNA--WGGR-NVIVLLGAGT-VRPE 80

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
                 E +  +Y RI E+ RLY+ C+     C I ISGGD +  GL+E++VY   L+  
Sbjct: 81  GRDAVAEANMFAYGRIVESARLYQQCRHSGGDCKIEISGGDARGLGLSEAVVYQRVLVGL 140

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
            + + D+ LE  S++T+QNAQFS  +++  +   I+LVSSA HL+R++LYF+HFGI+   
Sbjct: 141 AIPQADLILEPSSMNTWQNAQFSQPLLRAYRPDRIVLVSSATHLRRAELYFRHFGIDATP 200

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
             +D+L A +SI+P S NF L ++AL EY+GI
Sbjct: 201 VRADWLTASWSILPQSYNFTLADVALHEYLGI 232


>gi|241661663|ref|YP_002980023.1| hypothetical protein Rpic12D_0039 [Ralstonia pickettii 12D]
 gi|240863690|gb|ACS61351.1| protein of unknown function DUF218 [Ralstonia pickettii 12D]
          Length = 251

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/207 (41%), Positives = 126/207 (60%), Gaps = 9/207 (4%)

Query: 28  CFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIR 86
           C +L+ + IG G +P  LL  L+  ++  P +  QW    N IVLLG GT  +       
Sbjct: 32  CGVLVIA-IGCGPMPAWLLDSLEKPFENEPHI--QWGTR-NAIVLLGAGTFRV----GDS 83

Query: 87  IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERD 146
           +EP   SY R+ ET +LY++C++    C I++SGGD + HG  E+ VY  +L+  GV +D
Sbjct: 84  VEPGLFSYPRLVETTQLYQACRKSDGDCKILVSGGDARHHGSPEATVYQRELVRLGVAKD 143

Query: 147 DIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
           D+ +E QS++T+QNAQFS +++        +LVSSA HL+RS LYF HFG+      +D 
Sbjct: 144 DVLIEPQSMNTWQNAQFSRTVLAQYAPDRTVLVSSAIHLRRSLLYFTHFGMAPIPVRADD 203

Query: 207 LNAYYSIIPLSANFYLTELALKEYIGI 233
           L A  S +P++ NF LT+ AL E+IGI
Sbjct: 204 LQAAASPLPMAYNFALTDFALHEWIGI 230


>gi|167566356|ref|ZP_02359272.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           oklahomensis EO147]
          Length = 255

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 128/212 (60%), Gaps = 10/212 (4%)

Query: 31  LLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEP 89
           +LF  IG G +P  LL+HLQ  Y  RP +  +W +  N IV+LG GT  I    A+  EP
Sbjct: 34  VLFFAIGCGPVPAWLLRHLQAPYAARPAI--EWGER-NAIVMLGLGTEKIAATGAV--EP 88

Query: 90  SFQSYSRIFETMRLYKSCKQHSMH--CTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
              SYSR+ E   LY  C++   +  C I++SGGD +++G+ E+ VY + L+  G++  D
Sbjct: 89  GTFSYSRVVEAASLYHGCRKARANAGCKIVVSGGDARRNGVPEATVYRDALIGLGIDAAD 148

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL 207
           +  E +S++T+QNAQF+  ++   +   ++LV+S  HL+RS LYF HFG+      ++YL
Sbjct: 149 VLSEPRSMNTWQNAQFTRVVLAGYRADRVLLVTSGVHLRRSMLYFAHFGVAAIPVRAEYL 208

Query: 208 NAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
            A    +PL+ NF   +LAL EY+G  IA YR
Sbjct: 209 QAMLFPLPLAYNFSAADLALHEYLG--IARYR 238


>gi|167573468|ref|ZP_02366342.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           oklahomensis C6786]
          Length = 255

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 132/221 (59%), Gaps = 11/221 (4%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIP 80
           +  F +  +L F+ IG G +P  LL+HLQ  Y  RP +  +W +  N IV+LG GT  I 
Sbjct: 26  RASFAASAVLFFA-IGCGPVPAWLLRHLQAPYAARPAI--EWGER-NAIVMLGLGTEKIA 81

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISGGDPQKHGLAESIVYNNKL 138
              A+  EP   SYSR+ E   LY  C++   +  C I++SGGD +++G+ E+ VY + L
Sbjct: 82  ATGAV--EPGTFSYSRVVEAASLYHGCRKARANAGCKIVVSGGDARRNGVPEATVYRDAL 139

Query: 139 LESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           +  G++  D+  E +S++T+QNAQF+  ++   +   ++LV+S  HL+RS LYF HFG+ 
Sbjct: 140 IGLGIDAADVLSEPRSMNTWQNAQFTRVVLAGYRADRVLLVTSGVHLRRSVLYFAHFGVA 199

Query: 199 TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
                ++YL A    +PL+ NF   +LAL EY+G  IA YR
Sbjct: 200 AIPVRAEYLQAMLFPLPLAYNFSAADLALHEYLG--IARYR 238


>gi|207727627|ref|YP_002256021.1| lipoprotein [Ralstonia solanacearum MolK2]
 gi|206590866|emb|CAQ56478.1| lipoprotein [Ralstonia solanacearum MolK2]
          Length = 251

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 120/205 (58%), Gaps = 8/205 (3%)

Query: 30  MLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIE 88
           + LF  IG G +P  LL  L+  ++ RP ++  W K  N IVLLG GT  +       +E
Sbjct: 33  LALFVAIGCGPVPAWLLDSLEGPFEARPAVA--WGKR-NAIVLLGAGTRRVDG----GVE 85

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           P   SY R+ E  + Y++C++    C I++SGGD + HG  E+ VY   L   G++  D+
Sbjct: 86  PGVFSYPRLMEAAQQYQACRKTDADCKILVSGGDARHHGDPEAAVYRRALQAIGIDAGDV 145

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
            LE  S++T+QNAQFS + +     +  +LVSSA HL+RS LYF HFG+      +D L 
Sbjct: 146 LLEPNSMNTWQNAQFSRAALAAYAPERTVLVSSAIHLRRSLLYFTHFGMTPTPVRADDLQ 205

Query: 209 AYYSIIPLSANFYLTELALKEYIGI 233
           A  S +PL+ NF +T+ AL E+IGI
Sbjct: 206 ATPSPLPLAINFAMTDYALHEWIGI 230


>gi|207742020|ref|YP_002258412.1| lipoprotein [Ralstonia solanacearum IPO1609]
 gi|206593406|emb|CAQ60333.1| lipoprotein [Ralstonia solanacearum IPO1609]
          Length = 251

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 120/205 (58%), Gaps = 8/205 (3%)

Query: 30  MLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIE 88
           + LF  IG G +P  LL  L+  ++ RP ++  W K  N IVLLG GT  +       +E
Sbjct: 33  LALFVAIGCGPVPAWLLDSLEGPFEARPAVA--WGKR-NAIVLLGAGTRRVDG----GVE 85

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           P   SY R+ E  + Y++C++    C I++SGGD + HG  E+ VY   L   G++  D+
Sbjct: 86  PGVFSYPRLMEAAQQYQACRKTDADCKILVSGGDARHHGDPEAAVYRRALQAIGIDAGDV 145

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
            LE  S++T+QNAQFS + +     +  +LVSSA HL+RS LYF HFG+      +D L 
Sbjct: 146 LLEPNSMNTWQNAQFSRAALAAYAPERTVLVSSAIHLRRSLLYFTHFGMTPTPVRADDLQ 205

Query: 209 AYYSIIPLSANFYLTELALKEYIGI 233
           A  S +PL+ NF +T+ AL E+IGI
Sbjct: 206 ATPSPLPLAINFAMTDYALHEWIGI 230


>gi|83745961|ref|ZP_00943017.1| Integral membrane protein [Ralstonia solanacearum UW551]
 gi|83727355|gb|EAP74477.1| Integral membrane protein [Ralstonia solanacearum UW551]
          Length = 265

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 120/205 (58%), Gaps = 8/205 (3%)

Query: 30  MLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIE 88
           + LF  IG G +P  LL  L+  ++ RP ++  W K  N IVLLG GT  +       +E
Sbjct: 47  LALFVAIGCGPVPAWLLDSLEGPFEARPAVA--WGKR-NAIVLLGAGTRRVDG----GVE 99

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           P   SY R+ E  + Y++C++    C I++SGGD + HG  E+ VY   L   G++  D+
Sbjct: 100 PGVFSYPRLMEAAQQYQACRKTDADCKILVSGGDARHHGDPEAAVYRRALQAIGIDAGDV 159

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
            LE  S++T+QNAQFS + +     +  +LVSSA HL+RS LYF HFG+      +D L 
Sbjct: 160 LLEPNSMNTWQNAQFSRAALAAYAPERTVLVSSAIHLRRSLLYFTHFGMTPTPVRADDLQ 219

Query: 209 AYYSIIPLSANFYLTELALKEYIGI 233
           A  S +PL+ NF +T+ AL E+IGI
Sbjct: 220 ATPSPLPLAINFAMTDYALHEWIGI 244


>gi|300692848|ref|YP_003753843.1| lipoprotein transmembrane [Ralstonia solanacearum PSI07]
 gi|299079908|emb|CBM10289.1| putative lipoprotein transmembrane [Ralstonia solanacearum PSI07]
          Length = 251

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 120/205 (58%), Gaps = 8/205 (3%)

Query: 30  MLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIE 88
           + LF  IG G +P  LL  L+  ++ RP ++  W K  N IVLLG GT  +       +E
Sbjct: 33  LALFIAIGCGPVPAWLLDSLEGPFEARPAVA--WGKR-NAIVLLGAGTRRVDG----GVE 85

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           P   SY R+ E  + Y++C++    C I++SGGD + HG  E+ VY   L   G+  DD+
Sbjct: 86  PGVFSYPRLMEAAQQYQACRKTGADCKILVSGGDARHHGDPEATVYQRALQAIGIGTDDV 145

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
            LE  S++T+QNAQFS + +     +  +LVSSA HL+RS LYF HFG+      +D L 
Sbjct: 146 LLEPNSMNTWQNAQFSRAALAAYAPERTVLVSSAIHLRRSLLYFTHFGMMPTPMRADDLQ 205

Query: 209 AYYSIIPLSANFYLTELALKEYIGI 233
           A  S +PL+ NF +T+ AL E+IGI
Sbjct: 206 ATPSPLPLAINFAMTDYALHEWIGI 230


>gi|300705462|ref|YP_003747065.1| lipoprotein [Ralstonia solanacearum CFBP2957]
 gi|299073126|emb|CBJ44484.1| putative lipoprotein transmembrane [Ralstonia solanacearum
           CFBP2957]
          Length = 251

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 120/205 (58%), Gaps = 8/205 (3%)

Query: 30  MLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIE 88
           + LF  IG G +P  LL  L+  ++ RP ++  W K  N IVLLG GT  +       +E
Sbjct: 33  LALFVAIGCGPVPAWLLDSLEGPFEARPAVA--WGKR-NAIVLLGAGTRRVDG----GVE 85

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           P   SY R+ E  + Y++C++    C I++SGGD + HG  E+ VY   L   G++  D+
Sbjct: 86  PGVFSYPRLMEAAQQYQACRKTDADCKILVSGGDARHHGDPEAAVYRRALQAIGIDAADV 145

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
            LE  S++T+QNAQFS + +     +  +LVSSA HL+RS LYF HFG+      +D L 
Sbjct: 146 LLEPNSMNTWQNAQFSRTALAAYAPERTVLVSSAIHLRRSLLYFTHFGMTPTPVRADDLQ 205

Query: 209 AYYSIIPLSANFYLTELALKEYIGI 233
           A  S +PL+ NF +T+ AL E+IGI
Sbjct: 206 ATPSPLPLAINFAMTDYALHEWIGI 230


>gi|299068290|emb|CBJ39511.1| putative lipoprotein transmembrane [Ralstonia solanacearum CMR15]
          Length = 251

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/230 (38%), Positives = 130/230 (56%), Gaps = 9/230 (3%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFML-LFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWK 63
           + +IV+    L Q  R    ++   L L   IG G +P  LL  L+  ++ RP+++  W 
Sbjct: 8   LLVIVTAICALRQRRRTARGLAAVSLALVIAIGCGPVPAWLLDSLEGPFEARPVVT--WG 65

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           K  N IVLLG GT  +       +EP   SY R+ E  + Y++C++    C I++SGGD 
Sbjct: 66  KR-NAIVLLGAGTRRVEG----GVEPGVFSYPRLMEAAQQYQACRKTGADCKILVSGGDA 120

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
           + HG  E+ VY   L   G+  DD+ LE  S++T+QNAQFS + +     +  +LVSSA 
Sbjct: 121 RHHGDPEAAVYQRALQAIGIGADDVLLEPNSMNTWQNAQFSRTALAAYAPERTVLVSSAI 180

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           HL+RS LYF HFG+      +D L A  S +PL+ NF +T+ AL E+IGI
Sbjct: 181 HLRRSLLYFAHFGMTPTPVRADDLQATPSPLPLAFNFAMTDYALHEWIGI 230


>gi|17544865|ref|NP_518267.1| lipoprotein transmembrane [Ralstonia solanacearum GMI1000]
 gi|17427154|emb|CAD13674.1| probable lipoprotein transmembrane [Ralstonia solanacearum GMI1000]
          Length = 251

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 117/199 (58%), Gaps = 8/199 (4%)

Query: 36  IGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSY 94
           IG G +P  LL  L+  ++ RP ++  W K  N IVLLG GT  +       +EP   SY
Sbjct: 39  IGCGPVPAWLLDSLEGPFEARPAVT--WGKR-NAIVLLGAGTRRVEG----GVEPGVFSY 91

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
            R+ E  + Y++C++    C I++SGGD + HG  E+ VY   LL  G+  DD+ LE  S
Sbjct: 92  PRLMEAAQQYQACRKTGADCKILVSGGDARHHGDPEATVYQRALLAIGIGADDVLLEPNS 151

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSII 214
           ++T+QNAQFS + +     +  +LVSSA HL+RS LYF HFG+      +D L A  S +
Sbjct: 152 MNTWQNAQFSRTALAAYAPERTVLVSSAIHLRRSLLYFAHFGMTPTPVRADDLQATPSPL 211

Query: 215 PLSANFYLTELALKEYIGI 233
           PL+ NF + + AL E+IGI
Sbjct: 212 PLAFNFAMADYALHEWIGI 230


>gi|58582596|ref|YP_201612.1| hypothetical protein XOO2973 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58427190|gb|AAW76227.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 210

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 123/199 (61%), Gaps = 6/199 (3%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P+ +L HLQ +      +  W    N+IVLLG GT + P       E +  +Y RI E+
Sbjct: 1   MPSWMLHHLQHTGVNDFNA--WGAR-NVIVLLGAGT-VRPEGRDAVAEANMFAYGRIVES 56

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            RLY+ C+     C I ISGGDP+  GL+E++VY   L++  + + D+ +E  S++T QN
Sbjct: 57  ARLYQQCRHSGGDCKIEISGGDPRGLGLSEAVVYRRVLVDLAIPQADVIMEPSSMNTLQN 116

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANF 220
           AQFS  +++  +   I+LVSSA HL R++LYF+HFGI+     +D+L A +SI+P S NF
Sbjct: 117 AQFSQPLLRAYRPDRIVLVSSATHLCRAELYFRHFGIDATPVRADWLTATWSILPQSYNF 176

Query: 221 YLTELALKEYIGILIAYYR 239
            L ++AL EY+G  +A YR
Sbjct: 177 TLADVALHEYLG--MARYR 193


>gi|21231145|ref|NP_637062.1| hypothetical protein XCC1692 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768847|ref|YP_243609.1| hypothetical protein XC_2539 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991962|ref|YP_001903972.1| hypothetical protein xccb100_2567 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21112782|gb|AAM40986.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574179|gb|AAY49589.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167733722|emb|CAP51927.1| Putative membrane protein [Xanthomonas campestris pv. campestris]
          Length = 253

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 119/201 (59%), Gaps = 6/201 (2%)

Query: 39  GIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIF 98
           G +P+ +L+ LQ +         W    N IVLLG GT +         E +  +Y RI 
Sbjct: 42  GPLPSWMLRDLQRTGANDF--TDWGAR-NAIVLLGAGT-VRSDRAGAPAEANVFAYGRIV 97

Query: 99  ETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTF 158
           E  RLY++C      C I ISGGD +  GL+E++VY   LL  GVE  D+ LE  S+ T+
Sbjct: 98  EAARLYRACAATGNDCKIEISGGDARGLGLSEAVVYRRVLLGLGVEAGDLILEPASMTTW 157

Query: 159 QNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSA 218
           QNAQFS  +++  + + I+LVSSA HL R++LYF HFG+ T    SD+L A +S++P S 
Sbjct: 158 QNAQFSQPLLRAYRPQRIVLVSSATHLHRAELYFLHFGMRTTPVRSDWLRASWSLLPQSY 217

Query: 219 NFYLTELALKEYIGILIAYYR 239
           NF L ++AL EY+G  IA YR
Sbjct: 218 NFTLADVALHEYLG--IARYR 236


>gi|83717478|ref|YP_438905.1| hypothetical protein BTH_II0706 [Burkholderia thailandensis E264]
 gi|167577281|ref|ZP_02370155.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           thailandensis TXDOH]
 gi|167615420|ref|ZP_02384055.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           thailandensis Bt4]
 gi|257141992|ref|ZP_05590254.1| hypothetical protein BthaA_22676 [Burkholderia thailandensis E264]
 gi|83651303|gb|ABC35367.1| Uncharacterized ACR, COG1434 family [Burkholderia thailandensis
           E264]
          Length = 255

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 124/207 (59%), Gaps = 10/207 (4%)

Query: 36  IGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSY 94
           IG G +P  LL+ LQ  Y  RP ++  W +  N IV+LG  T  I    A+  EP   SY
Sbjct: 39  IGCGPVPAWLLRELQAPYAARPAIA--WGER-NAIVMLGLATEKIAATGAV--EPGTFSY 93

Query: 95  SRIFETMRLYKSCKQHSMH--CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLET 152
           SR+ E   LY+ C++   +  C I++SGGD +++G  E+ +Y + L+  GV+  D+  E 
Sbjct: 94  SRVVEAASLYRDCRRARANAGCKILVSGGDARRNGAPEASIYRDALIGLGVDAADVLSEP 153

Query: 153 QSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYS 212
           +S++T+QNAQF+ +++   +   ++LV+S  HL+RS LYF HFG+      ++YL A   
Sbjct: 154 RSMNTWQNAQFTRAVLDGYRADRVLLVTSGVHLRRSALYFAHFGVAAIPVRAEYLQAVTF 213

Query: 213 IIPLSANFYLTELALKEYIGILIAYYR 239
            +PL+ NF + +LAL E +G  IA YR
Sbjct: 214 PLPLAYNFSVADLALHECLG--IARYR 238


>gi|167840324|ref|ZP_02467008.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           thailandensis MSMB43]
          Length = 204

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 115/187 (61%), Gaps = 9/187 (4%)

Query: 55  RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQH--SM 112
           RP +  +W    N IV+LG GT  I    A+  EP   SYSR+ E   LY+ C++   + 
Sbjct: 8   RPAI--EWGAR-NAIVMLGLGTEKIAATGAV--EPGTFSYSRVVEAASLYRDCRRARANA 62

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
            C +I+SGGD +++G+ E+ VY + L+  G++  D+  E +S++T+QNAQF+ +++   +
Sbjct: 63  DCKLIVSGGDARRNGVPEAAVYRDALIGLGIDAADVLSEPRSMNTWQNAQFTRAVLDGYR 122

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIG 232
              ++LV+S  HL+RS LYF HFG+      ++YL A    +PL+ NF + +LAL EY+G
Sbjct: 123 ADRVLLVTSGIHLRRSVLYFSHFGVAATPVRAEYLQAVTFPLPLAHNFSVADLALHEYLG 182

Query: 233 ILIAYYR 239
             IA YR
Sbjct: 183 --IARYR 187


>gi|167587349|ref|ZP_02379737.1| hypothetical protein BuboB_18529 [Burkholderia ubonensis Bu]
          Length = 224

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/220 (32%), Positives = 116/220 (52%), Gaps = 9/220 (4%)

Query: 15  LLCQSIRKIFFMSCFMLLFSF-IGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG 73
           +LC+  R+      F L +    GW   P I       +   P+  P       +++LLG
Sbjct: 1   MLCRKWRRTIAAVAFALFWLLATGWLAAPLIAWSQAGVT---PVEHPDMHGQ-TVLILLG 56

Query: 74  NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIV 133
            GT  I      R+EP    + RI +T  LY+ C+Q +  CT+I+SGGDP++HG  E+  
Sbjct: 57  TGTRRIDG----RLEPRTDGFPRIRKTAALYRDCRQRAERCTVIVSGGDPERHGATEAAT 112

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
           Y   L+  GV+  D+ LE  S  T++NA+F++ ++++      ILV+S+Y ++R+ L F+
Sbjct: 113 YAPYLVARGVDPRDLMLEANSRTTYENAKFTTPILRSRHVDATILVTSSYQMRRALLDFR 172

Query: 194 HFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           HFGI+ +   ++  +A    +P   N    E AL E IGI
Sbjct: 173 HFGIDAQPVYANRRDAQTGWLPRRQNLINAEHALHELIGI 212


>gi|161524938|ref|YP_001579950.1| hypothetical protein Bmul_1765 [Burkholderia multivorans ATCC
           17616]
 gi|160342367|gb|ABX15453.1| protein of unknown function DUF218 [Burkholderia multivorans ATCC
           17616]
          Length = 281

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 123/231 (53%), Gaps = 11/231 (4%)

Query: 4   SWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFI-GWGIIPTILLKHLQFSYQRPLLSPQW 62
           S++ L + +  LLC+  R+   ++   L +    GW   P I           P+  P  
Sbjct: 49  SFVLLFIGF--LLCRKQRRRIALAAVALFWLIASGWLAAPFIAWAEAGVE---PVEHPDM 103

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
                ++++LG GT          + P     +RI +   LY+SC++ +  CT+++SGGD
Sbjct: 104 HGQ-TVLIVLGAGTQRADDG----LRPPRDGAARIRKAAELYRSCRRQAERCTVVMSGGD 158

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA 182
           PQ HG  E+ VY   L+ +GV+  D+ LE +S  T++NAQF++S++++ +    IL++S+
Sbjct: 159 PQHHGDTEAAVYGRGLVAAGVDPGDLVLEPKSRTTYENAQFTTSILRSRRDDARILITSS 218

Query: 183 YHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           Y ++R+ L F+ FGI+ +   ++   A    +P  +N   TE AL E IGI
Sbjct: 219 YQMRRALLDFRRFGIDPQPVFANRREAQTGWLPRWSNVVATEFALHELIGI 269


>gi|189350313|ref|YP_001945941.1| hypothetical protein BMULJ_01475 [Burkholderia multivorans ATCC
           17616]
 gi|189334335|dbj|BAG43405.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
          Length = 238

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 123/231 (53%), Gaps = 11/231 (4%)

Query: 4   SWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFI-GWGIIPTILLKHLQFSYQRPLLSPQW 62
           S++ L + +  LLC+  R+   ++   L +    GW   P I           P+  P  
Sbjct: 6   SFVLLFIGF--LLCRKQRRRIALAAVALFWLIASGWLAAPFIAWAEAGVE---PVEHPDM 60

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
                ++++LG GT          + P     +RI +   LY+SC++ +  CT+++SGGD
Sbjct: 61  HGQ-TVLIVLGAGTQRADD----GLRPPRDGAARIRKAAELYRSCRRQAERCTVVMSGGD 115

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA 182
           PQ HG  E+ VY   L+ +GV+  D+ LE +S  T++NAQF++S++++ +    IL++S+
Sbjct: 116 PQHHGDTEAAVYGRGLVAAGVDPGDLVLEPKSRTTYENAQFTTSILRSRRDDARILITSS 175

Query: 183 YHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           Y ++R+ L F+ FGI+ +   ++   A    +P  +N   TE AL E IGI
Sbjct: 176 YQMRRALLDFRRFGIDPQPVFANRREAQTGWLPRWSNVVATEFALHELIGI 226


>gi|221197747|ref|ZP_03570793.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221204695|ref|ZP_03577712.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221214890|ref|ZP_03587858.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221165117|gb|EED97595.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|221175552|gb|EEE07982.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221181679|gb|EEE14080.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 238

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 124/231 (53%), Gaps = 11/231 (4%)

Query: 4   SWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFI-GWGIIPTILLKHLQFSYQRPLLSPQW 62
           S++ L + +  LLC+  R+   ++   L +    GW   P +           P+  P  
Sbjct: 6   SFVLLFIGF--LLCRKQRRRIALAAVALFWLIASGWLAAPFVAWAEAGVE---PVEHPDM 60

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
                ++++LG GT          + P     +RI +   LY++C++ +  CT+++SGGD
Sbjct: 61  HGQ-TVLIVLGAGTQRADD----GLRPPRDGAARIRKAAELYRTCRRQAERCTVVMSGGD 115

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA 182
           PQ HG  E+ VY   L+ +G++  D+ LE +S  T++NAQF++S++++ +    IL++S+
Sbjct: 116 PQHHGDTEAAVYGRGLVAAGIDPGDLVLEPKSRTTYENAQFTTSILRSRRDDARILITSS 175

Query: 183 YHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           Y ++R+ L F+ FGI+ +   ++   A+   +P  +N    ELAL E IGI
Sbjct: 176 YQMRRALLDFRRFGIDPQPVFANRREAHTGWLPRWSNVVAAELALHELIGI 226


>gi|171318455|ref|ZP_02907610.1| protein of unknown function DUF218 [Burkholderia ambifaria MEX-5]
 gi|171096369|gb|EDT41271.1| protein of unknown function DUF218 [Burkholderia ambifaria MEX-5]
          Length = 224

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 119/221 (53%), Gaps = 11/221 (4%)

Query: 15  LLCQSIRKIFFMSCFMLLFSF-IGWGIIPTILLKHLQFS-YQRPLLSPQWKKDGNIIVLL 72
           +LC+  R+   ++  +L +    GW   P I       +  +RP +  +       +++L
Sbjct: 1   MLCRKRRRQIAIAGVVLFWLLATGWLAAPLIAWTEAGVTPVERPDMHGR-----TTLIIL 55

Query: 73  GNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESI 132
           G GT    T   +R  P  ++  RI +T  LY++C Q +  CT+++SGGDPQ HG  E+ 
Sbjct: 56  GIGTRRGDT--GLRAPPDGEA--RIRKTAALYRTCLQQATRCTVVMSGGDPQHHGETEAA 111

Query: 133 VYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYF 192
           VY  +L+E GV   D+ LE  S  T++NA+F++S++++      ILV+S+Y ++R+ L F
Sbjct: 112 VYGRRLVEEGVAPGDLVLEPNSRTTYENAKFTASILRSQHDDTRILVASSYQMRRALLDF 171

Query: 193 QHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           +HFGI+ +   S+   A    +P   N      AL E +GI
Sbjct: 172 RHFGIDPQPVYSNRRRARMGWLPRRDNLENANRALHELVGI 212


>gi|254252544|ref|ZP_04945862.1| hypothetical protein BDAG_01779 [Burkholderia dolosa AUO158]
 gi|124895153|gb|EAY69033.1| hypothetical protein BDAG_01779 [Burkholderia dolosa AUO158]
          Length = 303

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 122/231 (52%), Gaps = 11/231 (4%)

Query: 4   SWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSF-IGWGIIPTILLKHLQFSYQRPLLSPQW 62
           S++ L + +  +LC+  R+   ++   L +    GW   P I       +   P+  P+ 
Sbjct: 71  SFVLLFICF--MLCRKQRRFIAIAAVALFWLLSAGWLAAPLIAWAEAGVT---PVERPEM 125

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           +     ++L+G GT    T     ++P     +RI +   LY++C+Q + HCT+++SGGD
Sbjct: 126 RGQ-TTLILIGAGTHRTGTG----LQPPPDGNARIVKIAALYRACRQRAAHCTVVMSGGD 180

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA 182
           PQ HG  E+ VY  +L+  G+   D+ LE  S  T++NA+F++S++++      ILV+S+
Sbjct: 181 PQHHGETEAAVYGRQLVAEGIAPADLVLEPNSRTTYENAKFTASILRSRHDDARILVTSS 240

Query: 183 YHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           Y ++R+ L F+ FGI+ +   ++        +P   N    + AL E IGI
Sbjct: 241 YQMRRALLDFRRFGIDPQPVYANRRTPRTGWLPRWRNLVNADQALHELIGI 291


>gi|170702081|ref|ZP_02892995.1| protein of unknown function DUF218 [Burkholderia ambifaria
           IOP40-10]
 gi|170133010|gb|EDT01424.1| protein of unknown function DUF218 [Burkholderia ambifaria
           IOP40-10]
          Length = 224

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 117/222 (52%), Gaps = 13/222 (5%)

Query: 15  LLCQSIRK---IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVL 71
           +LC+  R+   I  ++ F LL +  GW   P I       +   P+  P       +I L
Sbjct: 1   MLCRKRRRQIAIAGVAVFWLLAT--GWLAAPLIAWTEAGVT---PVEHPDMHGRTTLITL 55

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
            G GT    T   +R  P  ++  RI +T  LY++C Q +  CT+++SGGDPQ HG  E+
Sbjct: 56  -GIGTRRGET--GLRAPPDGEA--RIRKTAALYRTCLQQATRCTVVMSGGDPQHHGETEA 110

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
            VY  +L+  GV   D+ LE  S  T++NA+F++S++++      ILV+S+Y ++R+ L 
Sbjct: 111 AVYGRRLVAEGVAPGDLVLEPNSRTTYENAKFTASILRSQHDDTRILVASSYQMRRALLD 170

Query: 192 FQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           F+HFGI+ +   S+   A    +P   N      AL E +GI
Sbjct: 171 FRHFGIDPQPVYSNRRRAQLGWLPRWRNLEDANQALHELVGI 212


>gi|170696469|ref|ZP_02887595.1| protein of unknown function DUF218 [Burkholderia graminis C4D1M]
 gi|170138622|gb|EDT06824.1| protein of unknown function DUF218 [Burkholderia graminis C4D1M]
          Length = 239

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 121/233 (51%), Gaps = 12/233 (5%)

Query: 2   LLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPL-LSP 60
           LL+  F  ++ W    ++ R + F +  +      GW   P + L   Q     P   +P
Sbjct: 6   LLALFFAAIAIWK---RARRPLLFCTIAIFWLLSAGWLTAPLLSLAQPQAQTSTPARFAP 62

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           +       IVLLG GT  +     + + P  +  +RI  + + Y +CK+ +  C++I+SG
Sbjct: 63  R-----TAIVLLGGGT--VYNRDKVLVPPR-EVLARIAVSAKNYAACKRSATVCSVIVSG 114

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           G+PQ+H   E+  Y   LL   V R DI LE QSL T++NA+  S+++   +  ++ILV+
Sbjct: 115 GNPQRHAATEADTYLPYLLREQVPRSDIVLENQSLTTYENARNVSAIVGQSRYDSLILVT 174

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           SAYH+ R+ L F+HFG+  +   S    A   ++P  +N    E+AL E IGI
Sbjct: 175 SAYHMPRAMLDFRHFGLEPQPLISSARRARLGVLPRYSNLANAEIALHELIGI 227


>gi|134295565|ref|YP_001119300.1| hypothetical protein Bcep1808_1457 [Burkholderia vietnamiensis G4]
 gi|134138722|gb|ABO54465.1| protein of unknown function DUF218 [Burkholderia vietnamiensis G4]
          Length = 224

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 119/222 (53%), Gaps = 13/222 (5%)

Query: 15  LLCQSIRK---IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVL 71
           +LC+  R+   I   + F LL +  GW   P I       +   P+  P       +IVL
Sbjct: 1   MLCRKQRRHIAIAGAAVFWLLAT--GWLAAPLIAWSEAGVA---PVEHPDMHGRTTLIVL 55

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
              GT    +   +R  P  ++  RI +T  LY+ C++ ++ CT+++SGGDPQ+HG  E+
Sbjct: 56  ---GTGTRRSDNGLRPPPDGEA--RIRKTAALYRVCREQTIRCTVVMSGGDPQRHGDTEA 110

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
            VY   LL  GV   D+ LE  S  T++NA+F++S++++    + ILV+S+Y ++R+ L 
Sbjct: 111 AVYGRLLLAQGVAPADLILEPDSRTTYENAKFTASILRSQHDDSRILVTSSYQMRRALLD 170

Query: 192 FQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           F+HFGI+ +   ++   A   ++P   N      A+ E IGI
Sbjct: 171 FRHFGIDPQPVYANRRLAQCGLLPRWRNLAAANQAVHELIGI 212


>gi|107022563|ref|YP_620890.1| hypothetical protein Bcen_1009 [Burkholderia cenocepacia AU 1054]
 gi|116689512|ref|YP_835135.1| hypothetical protein Bcen2424_1490 [Burkholderia cenocepacia
           HI2424]
 gi|105892752|gb|ABF75917.1| protein of unknown function DUF218 [Burkholderia cenocepacia AU
           1054]
 gi|116647601|gb|ABK08242.1| protein of unknown function DUF218 [Burkholderia cenocepacia
           HI2424]
          Length = 224

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 116/222 (52%), Gaps = 13/222 (5%)

Query: 15  LLCQSIRK---IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVL 71
           +LC+  R+   I   + F LL +  GW   P I       +   P+  P        ++L
Sbjct: 1   MLCRKQRRTISIVAAALFWLLAT--GWLAAPLIAWSEAGVT---PVEHPD-MHGRTTLIL 54

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
           +G GT    T     ++P     +RI +   LY++C+Q +  CT+++SGGDPQ HG  E+
Sbjct: 55  IGAGTHRTDT----GVQPPPDGVARIHKVAALYRTCRQQAERCTVVMSGGDPQHHGDTEA 110

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
            VY  +L+  GV   D+ LE  S  T++NA+F++S++++      +LV+S+Y ++R+ L 
Sbjct: 111 AVYGRQLVAEGVAPADLVLEPNSRTTYENAKFTASILRSQYDDARVLVTSSYQMRRALLD 170

Query: 192 FQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           F+ FGI+ +   ++   A    +P   N    E AL E +GI
Sbjct: 171 FRRFGIDPQPVYANLRRAQTGWLPRWRNVANAEQALHELVGI 212


>gi|172060464|ref|YP_001808116.1| hypothetical protein BamMC406_1412 [Burkholderia ambifaria MC40-6]
 gi|171992981|gb|ACB63900.1| protein of unknown function DUF218 [Burkholderia ambifaria MC40-6]
          Length = 224

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 115/222 (51%), Gaps = 13/222 (5%)

Query: 15  LLCQSIRK---IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVL 71
           +LC+  R+   I   + F LL +  GW   P I       +   P+  P       +I L
Sbjct: 1   MLCRKRRRQIAIAGAAVFWLLAT--GWLAAPLIAWTEAGVT---PVEHPDMHGRTTLITL 55

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
            G GT    T   ++  P  ++  RI  T  LY++C Q +  CT+++SGGDPQ HG  E+
Sbjct: 56  -GIGTRRGET--GLQAPPDGEA--RIRTTAALYRTCVQQATRCTVVMSGGDPQHHGETEA 110

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
            VY  +L+  GV   D+ LE  S  T++NA+F++S++++      ILV+S+Y ++R+ L 
Sbjct: 111 AVYGRRLVAEGVAPGDLVLEPNSRTTYENAKFTASILRSQHDDTRILVASSYQMRRALLD 170

Query: 192 FQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           F+HFGI+ +   S+   A    +P   N      AL E +GI
Sbjct: 171 FRHFGIDPQPVYSNRRRAQLGWLPRRDNLENANRALHELVGI 212


>gi|78066102|ref|YP_368871.1| hypothetical protein Bcep18194_A4631 [Burkholderia sp. 383]
 gi|77966847|gb|ABB08227.1| protein of unknown function DUF218 [Burkholderia sp. 383]
          Length = 224

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 115/220 (52%), Gaps = 9/220 (4%)

Query: 15  LLCQSIRKIFFMSCFMLLFSF-IGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG 73
           +LC+  R+I  ++   L +    GW   P I       +   P+  P+       ++L+G
Sbjct: 1   MLCRKRRRIISIAAIALFWLLATGWLAAPLIAWTESGVA---PVEHPE-MHGRTTLILIG 56

Query: 74  NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIV 133
            GT          ++P     +RI +   LY++C+Q +  CT+++SGGDPQ HG  E+ V
Sbjct: 57  AGTKRT----DFGLQPPPDGTARIHKVAALYRTCRQLAERCTVVMSGGDPQHHGETEAAV 112

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
           Y  +L+  G+   D+ LE  S  T++NA+F++S++++      ILV+S+Y ++R+ L F+
Sbjct: 113 YGRQLVAEGIAPTDLVLEPDSRTTYENAKFTASILRSQYDDARILVTSSYQMRRALLDFR 172

Query: 194 HFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
            FGI+ +   ++   A    +P   N    E AL E +GI
Sbjct: 173 RFGIDPQPVYANRRRAQTGWLPRWRNLTNAEQALHELVGI 212


>gi|115351425|ref|YP_773264.1| hypothetical protein Bamb_1372 [Burkholderia ambifaria AMMD]
 gi|115281413|gb|ABI86930.1| protein of unknown function DUF218 [Burkholderia ambifaria AMMD]
          Length = 224

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 115/222 (51%), Gaps = 13/222 (5%)

Query: 15  LLCQSIRK---IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVL 71
           +LC+  R+   I   + F LL +  GW   P I       +   P+  P       +I L
Sbjct: 1   MLCRKRRRQIAIAGAAVFWLLAT--GWLAAPLIAWTEAGVT---PVEHPAMHGRTTLITL 55

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
            G GT    T   ++  P  ++  RI  T  LY++C Q +  CT+++SGGDPQ HG  E+
Sbjct: 56  -GIGTRRGET--GLQAPPDGEA--RIRTTAALYRTCVQQATRCTVVMSGGDPQHHGETEA 110

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
            VY  +L+  GV   D+ LE  S  T++NA+F++S++++      ILV+S+Y ++R+ L 
Sbjct: 111 AVYGRRLVAEGVAPGDLVLEPNSRTTYENAKFTASILRSQHDDTRILVASSYQMRRALLD 170

Query: 192 FQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           F+HFGI+ +   S+   A    +P   N      AL E +GI
Sbjct: 171 FRHFGIDPQPVYSNRRRAQLGWLPRRDNLENANRALHELVGI 212


>gi|170732816|ref|YP_001764763.1| hypothetical protein Bcenmc03_1466 [Burkholderia cenocepacia MC0-3]
 gi|169816058|gb|ACA90641.1| protein of unknown function DUF218 [Burkholderia cenocepacia MC0-3]
          Length = 260

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 122/233 (52%), Gaps = 15/233 (6%)

Query: 4   SWIFLIVSYWHLLCQSIRK---IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           S++ L + +  +LC+  R+   I   + F LL +  GW   P I       +   P+  P
Sbjct: 28  SFVLLFIGF--MLCRKQRRTISIVAAALFWLLAT--GWLAAPLIAWTEAGVT---PVEHP 80

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
                   ++L+G GT    +     ++P     +RI +   LY++C+Q +  CT+++SG
Sbjct: 81  D-MHGRTTLILIGAGTHRTDS----GLQPPPDGVARIHKVAALYRTCRQQAERCTVVMSG 135

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           GDPQ HG  E+ VY  +L+  GV   D+ LE  S  T++NA+F++S++++      +LV+
Sbjct: 136 GDPQHHGDTEAAVYGRQLVAQGVAPADLVLEPNSRTTYENAKFTASILRSQYDDARVLVT 195

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           S+Y ++R+ L F+ FGI+ +   ++   A    +P   N    E AL E IGI
Sbjct: 196 SSYQMRRALLDFRRFGIDPQPVYANLRRAQTGWLPRWRNVANAEQALHELIGI 248


>gi|167562950|ref|ZP_02355866.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           oklahomensis EO147]
          Length = 240

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 114/222 (51%), Gaps = 11/222 (4%)

Query: 15  LLCQSIR---KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVL 71
           LLC+  R    I      +L     GW   P + L     S  RP+  P    +   IV+
Sbjct: 15  LLCRKRRGAIAILVAGVALLWLIASGWLAAPLVTLAE---SGVRPVARPTMTGN-TAIVM 70

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
           LG G      + A    P+  + +RI +T  LY +C++ +  CT+++SGGDPQ  G+ E+
Sbjct: 71  LGAGIKRRDGVAA----PTHDALARIDKTAELYSACQRTAARCTVVVSGGDPQFRGITEA 126

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
             Y   LL  GV   D+  E +S  T++NA+F++++++     ++ILV+S+Y ++R+ L 
Sbjct: 127 DTYARYLLARGVANGDLIREQRSHTTYENARFTAAILRAQHYDDLILVTSSYQMRRALLD 186

Query: 192 FQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           F  FGI  +   ++   A +  +P + N    E AL E +GI
Sbjct: 187 FARFGIAPQPVYANRRVAQFGWLPRTGNLVNAEQALHEILGI 228


>gi|167582098|ref|ZP_02374972.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           thailandensis TXDOH]
 gi|257139318|ref|ZP_05587580.1| hypothetical protein BthaA_08969 [Burkholderia thailandensis E264]
          Length = 240

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 116/220 (52%), Gaps = 7/220 (3%)

Query: 15  LLCQSIRKIF-FMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG 73
           LLC+  R  F  ++  + L   I  G +   L+   Q   Q P+  P    +   IV+LG
Sbjct: 15  LLCRKRRGAFAILAAGIALLWLIASGWLAAPLVALAQAGVQ-PVTHPMMTGN-TAIVMLG 72

Query: 74  NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIV 133
            G      + A    P   + +RI +T  LY +C++ +  CT+++SGGDPQ  G+ E+  
Sbjct: 73  AGIKRRDGVAA----PPHDALARIDKTAELYSACQRTAKRCTVVVSGGDPQVRGITEADT 128

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
           Y   LL  GV   D+  E+ S  T++NA+F++ +++     ++ILV+S+Y +KR+ L F+
Sbjct: 129 YAPYLLARGVANADLIRESSSHTTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFR 188

Query: 194 HFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
            FGI  +   ++  +A    +P + N    ELAL E IG+
Sbjct: 189 RFGIVPQPVYANRRDARLGWLPRAVNLVNAELALHEIIGV 228


>gi|167620257|ref|ZP_02388888.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           thailandensis Bt4]
          Length = 240

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 116/220 (52%), Gaps = 7/220 (3%)

Query: 15  LLCQSIRKIF-FMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG 73
           LLC+  R  F  ++  + L   I  G +   L+   Q   Q P+  P    +   IV+LG
Sbjct: 15  LLCRKRRGAFAILTAGIALLWLIASGWLAAPLVALAQAGVQ-PVTHPMMTGN-TAIVMLG 72

Query: 74  NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIV 133
            G      + A    P   + +RI +T  LY +C++ +  CT+++SGGDPQ  G+ E+  
Sbjct: 73  AGIKRRDGVAA----PPHDALARIDKTAELYSACQRTAKRCTVVVSGGDPQVRGITEADT 128

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
           Y   LL  GV   D+  E+ S  T++NA+F++ +++     ++ILV+S+Y +KR+ L F+
Sbjct: 129 YAPYLLARGVANADLIRESSSHTTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFR 188

Query: 194 HFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
            FGI  +   ++  +A    +P + N    ELAL E IG+
Sbjct: 189 RFGIVPQPVYANRRDARLGWLPRAVNLVNAELALHEIIGV 228


>gi|307730038|ref|YP_003907262.1| hypothetical protein BC1003_2008 [Burkholderia sp. CCGE1003]
 gi|307584573|gb|ADN57971.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1003]
          Length = 225

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 116/219 (52%), Gaps = 6/219 (2%)

Query: 15  LLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGN 74
           ++C+  R+   + C +  F  +  G +   LL   Q   Q     P        I+LLG 
Sbjct: 1   MICKRARRPL-LYCTIAFFWLLSAGWLTAPLLSLAQPVAQ--TSPPASFAPRTAIILLGG 57

Query: 75  GTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVY 134
           GT        + + P  +  +RI  + R Y +CK+ +  CT+I+SGG+PQ+H  +E+  Y
Sbjct: 58  GTVY--NRDKVLVPPR-EVLARIDVSARNYAACKRTATVCTVIVSGGNPQRHPASEADTY 114

Query: 135 NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQH 194
              LL   V R DI LE QSL T++NA+  S+++   +  ++ILV+SAYH+ R+ L F+H
Sbjct: 115 LPYLLREQVPRSDIVLENQSLTTYENARNVSAIVGQSRYDSLILVTSAYHMPRALLDFRH 174

Query: 195 FGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           FG++ +   S    A   ++P  +N    E+AL E IGI
Sbjct: 175 FGLDPQPLISSARRARLGVLPRYSNLANAEIALHELIGI 213


>gi|206559863|ref|YP_002230627.1| hypothetical protein BCAL1497 [Burkholderia cenocepacia J2315]
 gi|198035904|emb|CAR51796.1| putative exported protein [Burkholderia cenocepacia J2315]
          Length = 238

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 121/233 (51%), Gaps = 15/233 (6%)

Query: 4   SWIFLIVSYWHLLCQSIRK---IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           S++ L + +  +LC+  R+   I   + F LL +  GW   P I       +   P+  P
Sbjct: 6   SFVLLFIGF--MLCRKRRRTISIVAAALFWLLAT--GWLAAPLIAWSEAGVT---PVEHP 58

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
                   ++L+G GT          ++P     +RI +   LY++C+Q +  CT+++SG
Sbjct: 59  D-MHGRTTLILIGAGTLRTDA----GLQPPPDGAARIRKIAALYRTCRQQAERCTVVMSG 113

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           GDPQ HG  E+ VY  +L+  GV   D+ LE  S  T++NA+F++S++++      ILV+
Sbjct: 114 GDPQHHGDTEAAVYGRQLVAQGVAPADLVLEPNSRTTYENAKFTASILRSQYDDARILVT 173

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           S+Y ++R+ L F+ FGI+ +   ++   A    +P   N    E AL E +GI
Sbjct: 174 SSYQMRRALLDFRRFGIDPQPVYANLRRAQTGWLPRWRNVANAEHALHELVGI 226


>gi|323525715|ref|YP_004227868.1| hypothetical protein BC1001_1372 [Burkholderia sp. CCGE1001]
 gi|323382717|gb|ADX54808.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1001]
          Length = 239

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 120/233 (51%), Gaps = 12/233 (5%)

Query: 2   LLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPL-LSP 60
           LL+  F  +  W    ++ R + F +  +      GW   P + L   Q     P   +P
Sbjct: 6   LLALFFAAILIWK---RARRPLVFCTVALFWLLSTGWLTAPLLSLAQPQAETSAPTRFAP 62

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           +       I+LLG GT  +     + + P  +  +RI  +   Y +CK+ +  C++I+SG
Sbjct: 63  R-----TAIILLGGGT--VYNRDKVLVPPR-EVMARIAVSAENYAACKRSATVCSVIVSG 114

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           G+PQ+H   E+  Y   LL   V R DI LE +SL T++NA+  S+++   +  ++ILV+
Sbjct: 115 GNPQRHPATEADTYLPYLLREQVPRSDIVLENRSLTTYENARNVSAIVGQSRYDSLILVT 174

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           SAYH+ R+ L F+HFG+  +   S    A+  ++P  +N    ELAL E +GI
Sbjct: 175 SAYHMPRALLDFRHFGLEPQPLISGARRAHLGLLPRYSNLANAELALHELVGI 227


>gi|83720198|ref|YP_443090.1| hypothetical protein BTH_I2573 [Burkholderia thailandensis E264]
 gi|83654023|gb|ABC38086.1| Uncharacterized ACR, COG1434 family [Burkholderia thailandensis
           E264]
          Length = 301

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 116/220 (52%), Gaps = 7/220 (3%)

Query: 15  LLCQSIRKIF-FMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG 73
           LLC+  R  F  ++  + L   I  G +   L+   Q   Q P+  P    +   IV+LG
Sbjct: 76  LLCRKRRGAFAILAAGIALLWLIASGWLAAPLVALAQAGVQ-PVTHPMMTGN-TAIVMLG 133

Query: 74  NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIV 133
            G      + A    P   + +RI +T  LY +C++ +  CT+++SGGDPQ  G+ E+  
Sbjct: 134 AGIKRRDGVAA----PPHDALARIDKTAELYSACQRTAKRCTVVVSGGDPQVRGITEADT 189

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
           Y   LL  GV   D+  E+ S  T++NA+F++ +++     ++ILV+S+Y +KR+ L F+
Sbjct: 190 YAPYLLARGVANADLIRESSSHTTYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFR 249

Query: 194 HFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
            FGI  +   ++  +A    +P + N    ELAL E IG+
Sbjct: 250 RFGIVPQPVYANRRDARLGWLPRAVNLVNAELALHEIIGV 289


>gi|167570139|ref|ZP_02363013.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           oklahomensis C6786]
          Length = 240

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 113/222 (50%), Gaps = 11/222 (4%)

Query: 15  LLCQSIR---KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVL 71
           LLC+  R    I      +L     GW   P + L     S  RP+  P    +   IV+
Sbjct: 15  LLCRKRRGAIAILVAGVALLWLIASGWLAAPLVALAE---SGVRPVARPTMTGN-TAIVM 70

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
           LG G      + A    P+  + +RI +T  LY +C++ +  CT+++SGGDPQ  G+ E+
Sbjct: 71  LGAGIKRRDGVAA----PTHDALARIDKTAELYSACQRTAARCTVVVSGGDPQFRGITEA 126

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
             Y   LL  GV   D+  E +S  T++NA+F++++++     ++ILV+S+Y ++R+ L 
Sbjct: 127 DTYARYLLARGVANGDLIREQRSHTTYENARFTAAILRAQHYDDLILVTSSYQMRRALLD 186

Query: 192 FQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           F  FGI  +   ++   A    +P + N    E AL E +GI
Sbjct: 187 FARFGIAPQPVYANRRVAQLGWLPRTGNLVNAEQALHEILGI 228


>gi|167836831|ref|ZP_02463714.1| Uncharacterized ACR, COG1434 family protein [Burkholderia
           thailandensis MSMB43]
          Length = 240

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 104/197 (52%), Gaps = 8/197 (4%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSR 96
           GW   P + L        RP+  P    D   IV+LG G   I       + P   + +R
Sbjct: 40  GWLAAPLVALAEAGV---RPVAHPAMTGD-TTIVMLGAG---IRRRDGAAVPPR-DALAR 91

Query: 97  IFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
           I +T  LY +C++ +  CT+++SGGDPQ  G+ E+  Y   LL  GV   D+  E  S  
Sbjct: 92  IDKTAELYSACQRTAKRCTVVVSGGDPQMRGITEADTYAPYLLARGVAHADLIRERSSHT 151

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPL 216
           T++NA+F+  +++     ++ILV+S+Y +KR+ L F+ FGI  +   ++  +A    +P 
Sbjct: 152 TYENARFTVPILRAQHYDDLILVTSSYQMKRALLDFERFGIVPQPVYANRRDAQLGWLPR 211

Query: 217 SANFYLTELALKEYIGI 233
           +AN    ELAL E +G+
Sbjct: 212 AANLVNAELALHEIVGV 228


>gi|312796171|ref|YP_004029093.1| integral membrane protein [Burkholderia rhizoxinica HKI 454]
 gi|312167946|emb|CBW74949.1| Integral membrane protein [Burkholderia rhizoxinica HKI 454]
          Length = 239

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 100/179 (55%), Gaps = 5/179 (2%)

Query: 56  PLLSPQWKKDGNI-IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC 114
           P  SP  +  GN+ IVLLG+GT       A R+ P F ++ RI      +  C+     C
Sbjct: 53  PAASPP-RYGGNVAIVLLGSGTEYDD---AHRLVPKFDAWRRIDAAAAQFILCRAQRAQC 108

Query: 115 TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK 174
           T+++SGG+PQKH  +E+  Y   L+  GV   +I LE  SL+T++NA+ + ++++     
Sbjct: 109 TLVVSGGNPQKHEHSEAANYQPHLVSHGVPAANIVLEPDSLNTYENARNTGAILRRHHYD 168

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
            I+L++SAYHL R+ L F HFGI+     S+Y     S  P  A+   T +A  E+IG+
Sbjct: 169 QIVLITSAYHLPRALLDFHHFGIDVVPLASNYRWRRPSWRPHPAHVINTSIAWHEWIGL 227


>gi|254245595|ref|ZP_04938916.1| hypothetical protein BCPG_00305 [Burkholderia cenocepacia PC184]
 gi|124870371|gb|EAY62087.1| hypothetical protein BCPG_00305 [Burkholderia cenocepacia PC184]
          Length = 179

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 95/165 (57%), Gaps = 4/165 (2%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           ++L+G GT    T      +P     +RI +   LY++C+Q +  CT+++SGGDPQ HG 
Sbjct: 7   LILIGAGTHRTDTG----AQPPPDGVARIHKVAALYRTCRQQAERCTVVMSGGDPQHHGD 62

Query: 129 AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS 188
            E+ VY  +L+  GV   D+ LE  S  T++NA+F++S++++      +LV+S+Y ++R+
Sbjct: 63  TEAAVYGRQLVAQGVAPADLVLEPNSRTTYENAKFTASILRSQYDDARVLVTSSYQMRRA 122

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
            L F+ FGI+ +   ++   A    +P   N    E AL E +GI
Sbjct: 123 LLDFRRFGIDPQPVYANLRRAQTGWLPRWRNVANAEQALHELVGI 167


>gi|182416277|ref|YP_001821343.1| hypothetical protein Oter_4472 [Opitutus terrae PB90-1]
 gi|177843491|gb|ACB77743.1| protein of unknown function DUF218 [Opitutus terrae PB90-1]
          Length = 263

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 102/191 (53%), Gaps = 4/191 (2%)

Query: 45  LLKHLQFSYQRPLL--SPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L + L  S Q P     PQ     ++IVLLG+G  + P   +    P + +YSRI     
Sbjct: 62  LARWLARSLQEPAFFRKPQDFGGVSVIVLLGDGNIVQPN--SGEALPGWLAYSRIERAGE 119

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
           LY+S       C +I++G D    G  +  VY  +L   GV   DI++E +  +T++ A+
Sbjct: 120 LYRSATASGAACRVIVTGDDSSDPGAVKEPVYVQRLRALGVPAGDIRVEGKGRNTYRQAE 179

Query: 163 FSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYL 222
            +S ++K  +   I +V+S  H+KR+  YF +FG++     SDY+    +++PL +NF +
Sbjct: 180 LTSEILKAERCDRIFMVTSGLHMKRALRYFLNFGVSAIPVASDYVTGNITLLPLGSNFAI 239

Query: 223 TELALKEYIGI 233
            ++AL +Y G+
Sbjct: 240 ADIALHQYAGL 250


>gi|186476497|ref|YP_001857967.1| hypothetical protein Bphy_1739 [Burkholderia phymatum STM815]
 gi|184192956|gb|ACC70921.1| protein of unknown function DUF218 [Burkholderia phymatum STM815]
          Length = 228

 Score =  112 bits (279), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 113/220 (51%), Gaps = 5/220 (2%)

Query: 15  LLCQSIRKIFFMSCFMLLFSF-IGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG 73
           +L ++ R +   +  +L ++   GW   P + L           ++P        IVLLG
Sbjct: 1   MLLRNARTLIGTTTIVLFWAVGAGWLAQPLLDLAQRGAPPGGQTVAPATYAAHTAIVLLG 60

Query: 74  NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIV 133
            GT         ++ P   + +RI  +  LY  CKQ S  C +I+SGG+PQ+H   E+  
Sbjct: 61  TGTVHRDG----KLVPPRDAIARIAMSADLYARCKQVSSVCHVIVSGGNPQEHEATEADT 116

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
           Y   LL   V R DI LE +S+ T++NA+  ++++ +    +++LV+SAY + R+ L F 
Sbjct: 117 YLPYLLREEVPRGDIILENRSMTTYENARNVAAILPDGYYGSLMLVTSAYQMPRALLNFH 176

Query: 194 HFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
            FG+N     S+  +A   ++P   NF+  E+AL E +GI
Sbjct: 177 RFGMNPLPVVSNTRHAKRGVLPRRENFFDAEIALHELVGI 216


>gi|167724440|ref|ZP_02407676.1| hypothetical protein BpseD_35802 [Burkholderia pseudomallei DM98]
          Length = 143

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 83/126 (65%), Gaps = 2/126 (1%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
           C I++SGGD +++G+ E+ VY + L+  G++  D+  E +S++T+QNAQF+   +   + 
Sbjct: 3   CKILVSGGDARRNGVPEASVYRDALVGVGIDAADVLSEPRSMNTWQNAQFTRVALDGYRA 62

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
             ++LV+S  HL+RS LYF HFG+   A  ++YL A    +PL+ NF + +LAL EY+G 
Sbjct: 63  DRVLLVTSGIHLRRSMLYFAHFGVAAIAVRAEYLQAVTFPLPLAYNFAIADLALHEYLG- 121

Query: 234 LIAYYR 239
            IA YR
Sbjct: 122 -IARYR 126


>gi|187923614|ref|YP_001895256.1| hypothetical protein Bphyt_1622 [Burkholderia phytofirmans PsJN]
 gi|187714808|gb|ACD16032.1| protein of unknown function DUF218 [Burkholderia phytofirmans PsJN]
          Length = 262

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 116/233 (49%), Gaps = 12/233 (5%)

Query: 2   LLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPL-LSP 60
           LL+  F  +  W    + +  IF ++ F LL +  GW   P + L    +  + P   +P
Sbjct: 29  LLALFFAAIVLWKGARRPL-AIFTVAFFWLLAA--GWLTAPLLRLAQPHWRTEAPATFAP 85

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           +       I++LG GT          + P     +RI  +   Y +CK+ +  C +I+SG
Sbjct: 86  R-----TAIIMLGGGTIYGA---GQVLMPPRDVLARIAASAEYYAACKRAADICHVIVSG 137

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           G+PQ+H   E+  Y   LL   V R DI LE +SL T++NA+  S ++   +  ++IL++
Sbjct: 138 GNPQRHRATEADTYLPYLLRRQVPRADIVLENRSLTTYENARNVSGIVHGSRYDSLILIT 197

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           SAY + R+ L F  FG+  +   S+ + A   ++P   N    E+AL E IGI
Sbjct: 198 SAYQMPRALLDFHRFGLTPQPMISNAIGARLGVLPRYDNLASAEIALHELIGI 250


>gi|76811194|ref|YP_333307.1| hypothetical protein BURPS1710b_1908 [Burkholderia pseudomallei
           1710b]
 gi|126441655|ref|YP_001058770.1| hypothetical protein BURPS668_1731 [Burkholderia pseudomallei 668]
 gi|167738833|ref|ZP_02411607.1| hypothetical protein Bpse14_12248 [Burkholderia pseudomallei 14]
 gi|167911178|ref|ZP_02498269.1| hypothetical protein Bpse112_11843 [Burkholderia pseudomallei 112]
 gi|167919203|ref|ZP_02506294.1| hypothetical protein BpseBC_11665 [Burkholderia pseudomallei
           BCC215]
 gi|217423472|ref|ZP_03454973.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|254259791|ref|ZP_04950845.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|76580647|gb|ABA50122.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b]
 gi|126221148|gb|ABN84654.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|217393330|gb|EEC33351.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|254218480|gb|EET07864.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 240

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 110/197 (55%), Gaps = 8/197 (4%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSR 96
           GW   P + L     +  +P+  P    D  +IV+LG G   I     + I P   + +R
Sbjct: 40  GWLAAPLVALAQ---AGMQPVAHPTMTGD-TVIVMLGAG---IERRDGVAIPPR-DALAR 91

Query: 97  IFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
           I +T  LY +C++ ++ CT+++SGGDPQ  G+AE+  Y   LL  GV   D+  E +S  
Sbjct: 92  IDKTAELYSACRRTALRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSHT 151

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPL 216
           T++NA+F++ +++     ++ILV+S+Y +KR+ L F+ FG   +   ++  +A    +P 
Sbjct: 152 TYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFGFAPQPVYANRRDARLGWLPR 211

Query: 217 SANFYLTELALKEYIGI 233
           +AN    ELAL E +G+
Sbjct: 212 AANLANAELALHEIVGV 228


>gi|167894539|ref|ZP_02481941.1| hypothetical protein Bpse7_12379 [Burkholderia pseudomallei 7894]
          Length = 240

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 110/197 (55%), Gaps = 8/197 (4%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSR 96
           GW   P + L     +  +P+  P    D  +IV+LG G   I     + I P   + +R
Sbjct: 40  GWLAAPLVALAQ---AGMQPVAHPTMTGD-TVIVMLGAG---IERRDGVAIPPR-DALAR 91

Query: 97  IFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
           I +T  LY +C++ ++ CT+++SGGDPQ  G+AE+  Y   LL  GV   D+  E +S  
Sbjct: 92  IDKTAELYSACRRTALRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSHT 151

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPL 216
           T++NA+F++ +++     ++ILV+S+Y +KR+ L F+ FG   +   ++  +A    +P 
Sbjct: 152 TYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFGFAPQPVYANRRDARLGWLPR 211

Query: 217 SANFYLTELALKEYIGI 233
           +AN    ELAL E +G+
Sbjct: 212 AANLANAELALHEIVGV 228


>gi|182413009|ref|YP_001818075.1| hypothetical protein Oter_1189 [Opitutus terrae PB90-1]
 gi|177840223|gb|ACB74475.1| protein of unknown function DUF218 [Opitutus terrae PB90-1]
          Length = 258

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 109/203 (53%), Gaps = 6/203 (2%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLL-SPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPS 90
           +F  +G G +  +L + LQ   +R     PQ     ++IVLLG+G  +     +    P 
Sbjct: 48  VFILVGNGFLTRLLARSLQ---ERAFFQKPQDFGGVSVIVLLGDGHIV--ERGSGEALPG 102

Query: 91  FQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL 150
           + +YSRI     LY+S       C +I++G D    G A+  VY  +L   GV   DI++
Sbjct: 103 WLAYSRIERACELYRSATATGAACRLIVTGDDISDLGTAKEPVYVQRLRALGVPVGDIRV 162

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E +  +T++ A+ +S ++K+ +   I +V+S  H+KR+  YF++FG+      SDY+   
Sbjct: 163 EGKGRNTYRQAELTSEILKSERYDRIFMVTSGLHMKRALRYFRNFGVRAIPVASDYVIGN 222

Query: 211 YSIIPLSANFYLTELALKEYIGI 233
            +++PL +N  + ++AL +Y G+
Sbjct: 223 ITLLPLGSNLAIADIALHQYAGL 245


>gi|296158762|ref|ZP_06841591.1| protein of unknown function DUF218 [Burkholderia sp. Ch1-1]
 gi|295890967|gb|EFG70756.1| protein of unknown function DUF218 [Burkholderia sp. Ch1-1]
          Length = 262

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 114/239 (47%), Gaps = 24/239 (10%)

Query: 2   LLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQ 61
           LL+  F  +  W    ++ R +   +  +      GW  +P   L HL          P+
Sbjct: 29  LLALFFAAIVLWK---RARRPLAVCTAALFWLLAAGWLTVP---LLHLA--------QPR 74

Query: 62  WKKDG-------NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC 114
           W+ D          I++LG GT        +   P     +RI  + + Y +CK+ +  C
Sbjct: 75  WQTDTPARFAPRTAIIMLGGGTVYDDDHVLV---PPRDVLARIMASAQNYAACKRAAAIC 131

Query: 115 TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK 174
            +I+SGG+PQ+H   E+  Y   LL   V R DI LE  S  T++NA+  S++++  +  
Sbjct: 132 HVIVSGGNPQRHRATEADTYLPYLLRQQVPRADIVLENSSRTTYENARNVSAVLEGSRYD 191

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           ++IL++SAY + R+ L F  FG+  +   S+   A+  ++P   N    E+AL E IGI
Sbjct: 192 SLILITSAYQMPRAMLDFHRFGLAPQPMISNARRAHLGVLPRYDNLVSAEIALHELIGI 250


>gi|295676250|ref|YP_003604774.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1002]
 gi|295436093|gb|ADG15263.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1002]
          Length = 262

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 106/216 (49%), Gaps = 25/216 (11%)

Query: 28  CFMLLFSFI--GWGIIPTILLKHLQF-SYQRPLLSPQWKKDGNIIVLLGNGT------TI 78
           C + LF  +  GW   P + L   Q  S +    +P+       I+LLG GT       +
Sbjct: 50  CMIALFWLLAAGWLTAPLLDLAQPQRQSAEAATFAPR-----TAIILLGGGTIYDHDHVL 104

Query: 79  IPTIPAI-RIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNK 137
           +P    + RIE S Q+Y+          +CK+ ++ C +I+SGG+PQ+H   E+  Y   
Sbjct: 105 VPPRDVLSRIEVSAQNYA----------ACKRTAIVCQVIVSGGNPQRHSATEADTYLPY 154

Query: 138 LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
           LL   V R DI LE  S  T++NA+  S ++       +ILV+SAYH+ R+ L FQ FG+
Sbjct: 155 LLRQQVPRSDIVLEKSSRTTYENARNVSVIVGQSHYDKLILVTSAYHMPRALLDFQRFGV 214

Query: 198 NTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
             +   S        ++P   N    E+AL E IG+
Sbjct: 215 EPQPQISSARRVRLGVLPRFGNLVAAEIALHELIGL 250


>gi|53724817|ref|YP_102769.1| hypothetical protein BMA1073 [Burkholderia mallei ATCC 23344]
 gi|67641348|ref|ZP_00440128.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|121599410|ref|YP_992846.1| hypothetical protein BMASAVP1_A1516 [Burkholderia mallei SAVP1]
 gi|124385403|ref|YP_001026188.1| hypothetical protein BMA10229_A0183 [Burkholderia mallei NCTC
           10229]
 gi|134282282|ref|ZP_01768987.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|167003067|ref|ZP_02268857.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|167719831|ref|ZP_02403067.1| hypothetical protein BpseD_12495 [Burkholderia pseudomallei DM98]
 gi|254178040|ref|ZP_04884695.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254188599|ref|ZP_04895110.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254199716|ref|ZP_04906082.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254206038|ref|ZP_04912390.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|254358413|ref|ZP_04974686.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|52428240|gb|AAU48833.1| conserved hypothetical protein [Burkholderia mallei ATCC 23344]
 gi|121228220|gb|ABM50738.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124293423|gb|ABN02692.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|134246320|gb|EBA46409.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|147749312|gb|EDK56386.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|147753481|gb|EDK60546.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|148027540|gb|EDK85561.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|157936278|gb|EDO91948.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|160699079|gb|EDP89049.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|238522267|gb|EEP85712.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|243061318|gb|EES43504.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
          Length = 240

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 109/197 (55%), Gaps = 8/197 (4%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSR 96
           GW   P + L     +  +P+  P    D  +IV+LG G   I     + I P   + +R
Sbjct: 40  GWLAAPLVALAQ---AGMQPVAHPTMTGD-TVIVMLGAG---IERRDGVAIPPR-DALAR 91

Query: 97  IFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
           I +T  LY +C++ +  CT+++SGGDPQ  G+AE+  Y   LL  GV   D+  E +S  
Sbjct: 92  IDKTAELYSACRRTAQRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSHT 151

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPL 216
           T++NA+F++ +++     ++ILV+S+Y +KR+ L F+ FG   +   ++  +A    +P 
Sbjct: 152 TYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFGFAPQPVYANRRDARLGWLPR 211

Query: 217 SANFYLTELALKEYIGI 233
           +AN    ELAL E +G+
Sbjct: 212 AANLANAELALHEIVGV 228


>gi|53719541|ref|YP_108527.1| hypothetical protein BPSL1927 [Burkholderia pseudomallei K96243]
 gi|126452373|ref|YP_001066022.1| hypothetical protein BURPS1106A_1753 [Burkholderia pseudomallei
           1106a]
 gi|167816053|ref|ZP_02447733.1| hypothetical protein Bpse9_12987 [Burkholderia pseudomallei 91]
 gi|167824429|ref|ZP_02455900.1| hypothetical protein Bpseu9_12213 [Burkholderia pseudomallei 9]
 gi|167845961|ref|ZP_02471469.1| hypothetical protein BpseB_11780 [Burkholderia pseudomallei B7210]
 gi|226199704|ref|ZP_03795257.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|242315371|ref|ZP_04814387.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|254179990|ref|ZP_04886589.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|254297823|ref|ZP_04965276.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|52209955|emb|CAH35927.1| putative exported protein [Burkholderia pseudomallei K96243]
 gi|126226015|gb|ABN89555.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|157807296|gb|EDO84466.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|184210530|gb|EDU07573.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|225928290|gb|EEH24324.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|242138610|gb|EES25012.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 240

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 109/197 (55%), Gaps = 8/197 (4%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSR 96
           GW   P + L     +  +P+  P    D  +IV+LG G   I     + I P   + +R
Sbjct: 40  GWLAAPLVALAQ---AGMQPVAHPTMTGD-TVIVMLGAG---IERRDGVAIPPR-DALAR 91

Query: 97  IFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
           I +T  LY +C++ +  CT+++SGGDPQ  G+AE+  Y   LL  GV   D+  E +S  
Sbjct: 92  IDKTAELYSACRRTAQRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSHT 151

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPL 216
           T++NA+F++ +++     ++ILV+S+Y +KR+ L F+ FG   +   ++  +A    +P 
Sbjct: 152 TYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFGFAPQPVYANRRDARLGWLPR 211

Query: 217 SANFYLTELALKEYIGI 233
           +AN    ELAL E +G+
Sbjct: 212 AANLANAELALHEIVGV 228


>gi|237812033|ref|YP_002896484.1| hypothetical protein GBP346_A1775 [Burkholderia pseudomallei
           MSHR346]
 gi|237506357|gb|ACQ98675.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
          Length = 240

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 109/197 (55%), Gaps = 8/197 (4%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSR 96
           GW   P + L     +  +P+  P    D  +IV+LG G   I     + I P   + +R
Sbjct: 40  GWLAAPLVALAQ---AGMQPVAHPTMTGD-TVIVMLGAG---IERRDGVAIPPR-DALAR 91

Query: 97  IFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
           I +T  LY +C++ +  CT+++SGGDPQ  G+AE+  Y   LL  GV   D+  E +S  
Sbjct: 92  IDKTAELYSACRRTAQRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSHT 151

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPL 216
           T++NA+F++ +++     ++ILV+S+Y +KR+ L F+ FG   +   ++  +A    +P 
Sbjct: 152 TYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFGFAPQPVYANRRDARPGWLPR 211

Query: 217 SANFYLTELALKEYIGI 233
           +AN    ELAL E +G+
Sbjct: 212 AANLANAELALHEIVGV 228


>gi|254197234|ref|ZP_04903656.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|169653975|gb|EDS86668.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
          Length = 240

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 109/197 (55%), Gaps = 8/197 (4%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSR 96
           GW   P + L     +  +P+  P    D  +IV+LG G   I     + I P   + +R
Sbjct: 40  GWLAAPLVALAQ---AGMQPVAHPTMTGD-TVIVMLGAG---IERRDGVAIPPR-DALAR 91

Query: 97  IFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
           I +T  LY +C++ +  CT+++SGGDPQ  G+AE+  Y   LL  GV   D+  E +S  
Sbjct: 92  IDKTAELYSACRRTAQRCTVVVSGGDPQVRGIAEADTYAPYLLARGVASADLIREKRSHT 151

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPL 216
           T++NA+F++ +++     ++ILV+S+Y +KR+ L F+ FG   +   ++  +A    +P 
Sbjct: 152 TYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFEWFGFAPQPVYANRRDARLGWLPR 211

Query: 217 SANFYLTELALKEYIGI 233
           +AN    ELAL E +G+
Sbjct: 212 AANLANAELALHEIVGV 228


>gi|167628013|ref|YP_001678513.1| hypothetical protein Fphi_1785 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167598014|gb|ABZ88012.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 231

 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 113/213 (53%), Gaps = 18/213 (8%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPT 81
           +F+    +++  +G G+I  IL K ++      L S   K+  N   I+LLG G      
Sbjct: 28  YFVIIVTIIYYLVGNGVIGNILAKPIR------LESTDIKQCANTKAIILLGAGINQAFD 81

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
               ++EPS  +Y RI +T  +Y    Q      IIISGG P  + L+E+ VY + L + 
Sbjct: 82  ----KLEPSLSAYDRILKTAEVYNQYPQD-----IIISGGSPSGYKLSEAEVYADILYKL 132

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+ +  I+LE QS +T++NAQF+ +++ +       L++   H +R++L F  F INT  
Sbjct: 133 GIPKSKIRLEKQSKNTYENAQFTKNILSD-HNNTYCLITGGIHYQRAKLIFDSFNINTIN 191

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
             S  L    S +P + NFY+T+  + EY+GI+
Sbjct: 192 IASSKLAPEISFLPSAYNFYITQAIIHEYLGIV 224


>gi|238027594|ref|YP_002911825.1| hypothetical protein bglu_1g20120 [Burkholderia glumae BGR1]
 gi|237876788|gb|ACR29121.1| Hypothetical protein bglu_1g20120 [Burkholderia glumae BGR1]
          Length = 238

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 108/231 (46%), Gaps = 15/231 (6%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFI--GWGIIPTILLKHLQFSYQRPLLSPQWK 63
           +F   ++W       R+   ++  + L + I  GW   P + L     +   P   P + 
Sbjct: 10  LFAAAAFWR-----TRRATLITLGLALLAGIATGWLTAPLVALAESGVAPAEP---PVFA 61

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
               IIVL G G      +    + P     +RI     L+ +C++    CT+I++GGDP
Sbjct: 62  GRTAIIVL-GAGIKRHDGL----LVPPENGLARIARAAELHSACQRSGARCTVIVTGGDP 116

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
            +HG  E+ +Y   LLE GV   D+ LE +S  T++NAQ+++ ++        ILV+S+Y
Sbjct: 117 HRHGTTEADLYAPLLLERGVPPRDLTLERRSRTTYENAQYTAPILLAKHYDETILVTSSY 176

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
            ++R+ L F  FG+  +   ++   A     P   NF     AL E  GI+
Sbjct: 177 QMRRALLDFARFGVTPQPVFANRDRAICGWRPRWTNFVTASRALHEIAGII 227


>gi|167902941|ref|ZP_02490146.1| hypothetical protein BpseN_11835 [Burkholderia pseudomallei NCTC
           13177]
          Length = 240

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 108/197 (54%), Gaps = 8/197 (4%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSR 96
           GW   P + L     +  +P+  P    D  +IV+LG G   I     + I P   + +R
Sbjct: 40  GWLAAPLVALAQ---AGMQPVAHPTMTGD-TVIVMLGAG---IERRDGVAIPPR-DALAR 91

Query: 97  IFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
           I +T  LY +C++ +  CT+++SGGDPQ   +AE+  Y   LL  GV   D+  E +S  
Sbjct: 92  IDKTAELYSACRRTAQRCTVVVSGGDPQVRSIAEADTYAPYLLARGVASADLIREKRSHT 151

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPL 216
           T++NA+F++ +++     ++ILV+S+Y +KR+ L F+ FG   +   ++  +A    +P 
Sbjct: 152 TYENARFTAPILRAQHYDDLILVTSSYQMKRALLDFERFGFAPQPVYANRRDARPGWLPR 211

Query: 217 SANFYLTELALKEYIGI 233
           +AN    ELAL E +G+
Sbjct: 212 AANLANAELALHEIVGV 228


>gi|190576332|ref|YP_001974177.1| putative exported lipoprotein [Stenotrophomonas maltophilia K279a]
 gi|190014254|emb|CAQ47898.1| putative exported lipoprotein [Stenotrophomonas maltophilia K279a]
          Length = 258

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 82/147 (55%), Gaps = 1/147 (0%)

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
            P    YSR+    + Y +C++    C +++SGG       AE+ VY  +L+  GV  + 
Sbjct: 82  RPGLAGYSRLMAATQRYLACERTGESCVVLVSGGATAPDNAAEANVYARELIALGVPAEH 141

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL 207
           I  E  S++T+QNA  SS MI+      ++LV+S  HL+RS +YF+HFG+  +   SD L
Sbjct: 142 IIREHASVNTWQNASNSSRMIQR-DSVRVVLVTSGLHLRRSLIYFRHFGVVAEGLPSDRL 200

Query: 208 NAYYSIIPLSANFYLTELALKEYIGIL 234
            A    +P + N  L E+ L EYIG+L
Sbjct: 201 RASPGWLPSAYNLLLIEVMLHEYIGVL 227


>gi|209521954|ref|ZP_03270620.1| protein of unknown function DUF218 [Burkholderia sp. H160]
 gi|209497609|gb|EDZ97798.1| protein of unknown function DUF218 [Burkholderia sp. H160]
          Length = 212

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 102/210 (48%), Gaps = 11/210 (5%)

Query: 25  FMSCFMLLFSFIGWGIIPTILLKHLQF-SYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIP 83
            ++ F LL +  GW   P + L   Q  S      +P+       I+LLG GT       
Sbjct: 1   MIALFWLLAA--GWLTAPLLDLAQPQRQSAAAATFAPR-----TAIILLGGGTIYDDDNV 53

Query: 84  AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            +   P     SRI  + R Y +CK+ +  C +I+SGG+PQ+H   E+  Y   LL   V
Sbjct: 54  LV---PPHDVLSRIEVSARNYAACKRTANICQVIVSGGNPQRHSATEADTYLPYLLRQQV 110

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASC 203
            R DI LE  S  T++NA+  S+++       +ILV+SAYH+ R+ L FQ FG+  +   
Sbjct: 111 ARSDIVLEKTSRTTYENARNVSAIVGQSHYDTLILVTSAYHMPRALLDFQCFGVEPQPQI 170

Query: 204 SDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           S    A   ++P   N    E+AL E  G+
Sbjct: 171 SSARRARLGVLPRFENLLAAEIALHELAGL 200


>gi|91782979|ref|YP_558185.1| putative lipoprotein transmembrane [Burkholderia xenovorans LB400]
 gi|91686933|gb|ABE30133.1| Putative lipoprotein transmembrane [Burkholderia xenovorans LB400]
          Length = 225

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 106/219 (48%), Gaps = 6/219 (2%)

Query: 15  LLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGN 74
           +L + +R+   + C   LF  +  G +   LL   Q   Q    +P        I++LG 
Sbjct: 1   MLWKRVRRPLAV-CTAALFWLLAAGWLTAPLLHLAQPRSQTD--APARFAPRTAIIMLGG 57

Query: 75  GTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVY 134
           GT        +   P     +RI  + + Y +CK+    C +I+SGG+PQ+H   E+  Y
Sbjct: 58  GTVYDDNHVLV---PPRDVLARITASAQNYAACKRAEATCHVIVSGGNPQRHSATEADTY 114

Query: 135 NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQH 194
              LL   V R DI LE  S  T++NA+  S++++  +  ++ILV+SAY + R+ L F  
Sbjct: 115 LPYLLRQQVPRADIVLENSSRTTYENARNVSAILEGSRYDSLILVTSAYQMPRAMLDFHR 174

Query: 195 FGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           FG   +   S+   A   ++P   N    E+AL E IGI
Sbjct: 175 FGFAPQPMISNARRARLGVLPRYDNLVSAEIALHELIGI 213


>gi|254877103|ref|ZP_05249813.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843124|gb|EET21538.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 231

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 68/213 (31%), Positives = 112/213 (52%), Gaps = 18/213 (8%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPT 81
           +F+    +++  +G G+I  IL K ++      L S   K+  N   I+LLG G      
Sbjct: 28  YFVIIVTIIYYLVGNGLIANILAKPIR------LESTDIKQCANTKAIILLGAGINQAFD 81

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
               ++EPS  +Y RI +T  +Y    Q      IIISGG P  + L+E+ VY + L + 
Sbjct: 82  ----KLEPSLSAYDRILKTAEVYNQYPQD-----IIISGGSPSGYKLSEAEVYADILYKL 132

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+ +  I+LE QS +T++NAQF+  ++ +       L++   H +R++L F  F INT  
Sbjct: 133 GIPKSKIRLEKQSKNTYENAQFTKKILSD-HNNTYCLITGGIHYQRAKLIFDSFNINTIN 191

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
             S  L    S +P + +FY+T+  + EY+GI+
Sbjct: 192 IASSKLAPEISFLPSAYSFYITQAIIHEYLGII 224


>gi|241668569|ref|ZP_04756147.1| hypothetical protein FphipA2_07371 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 239

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/213 (31%), Positives = 112/213 (52%), Gaps = 18/213 (8%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPT 81
           +F+    +++  +G G+I  IL K ++      L S   K+  N   I+LLG G      
Sbjct: 36  YFVIIVTIIYYLVGNGLIANILAKPIR------LESTDIKQCANTKAIILLGAGINQAFD 89

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
               ++EPS  +Y RI +T  +Y    Q      IIISGG P  + L+E+ VY + L + 
Sbjct: 90  ----KLEPSLSAYDRILKTAEVYNQYPQD-----IIISGGSPSGYKLSEAEVYADILYKL 140

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+ +  I+LE QS +T++NAQF+  ++ +       L++   H +R++L F  F INT  
Sbjct: 141 GIPKSKIRLEKQSKNTYENAQFTKKILSD-HNNTYCLITGGIHYQRAKLIFDSFNINTIN 199

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
             S  L    S +P + +FY+T+  + EY+GI+
Sbjct: 200 IASSKLAPEISFLPSAYSFYITQAIIHEYLGII 232


>gi|330816685|ref|YP_004360390.1| hypothetical protein bgla_1g17890 [Burkholderia gladioli BSR3]
 gi|327369078|gb|AEA60434.1| hypothetical protein bgla_1g17890 [Burkholderia gladioli BSR3]
          Length = 238

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 97/200 (48%), Gaps = 12/200 (6%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIE--PSFQSY 94
           GW   P + L         P+ +P  +     IVLLG G      I   R E  P   + 
Sbjct: 38  GWLAAPLVALAEAGVE---PVEAPTMRGH-TAIVLLGGG------IERRRGELVPPHDAL 87

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SRI     L+  C+  +  C I+++GGDP  HG++E+ +Y   L E GV   D+ LET+S
Sbjct: 88  SRIVRAAELHSVCQAIASQCDIVVTGGDPHHHGISEAQLYAPLLREHGVAERDLILETRS 147

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSII 214
             T++NA++++ ++        ILV+S+Y ++R+ L F  F I  +   ++ L       
Sbjct: 148 RTTYENAKYTAPILLAQHYDATILVTSSYQMRRALLDFARFDIEPQPVYANQLRPILGWR 207

Query: 215 PLSANFYLTELALKEYIGIL 234
           P+  NF     AL E  GI+
Sbjct: 208 PVWHNFVAASRALHEIAGIM 227


>gi|208779215|ref|ZP_03246561.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|208745015|gb|EDZ91313.1| conserved hypothetical protein [Francisella novicida FTG]
          Length = 231

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 109/217 (50%), Gaps = 20/217 (9%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPT 81
           +F+    +++  IG G++ TIL   L+        S   K   N   I+LLG G      
Sbjct: 28  YFIVALTIVYYLIGNGVLGTILALPLKSE------STDIKACANTKGIILLGAGINDAFG 81

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
               ++EP+  +Y RI +T  +Y    Q      IIISGG P    L+E+ +Y + L + 
Sbjct: 82  ----KLEPALSAYDRILKTAEVYHQYPQQ-----IIISGGAPFGEKLSEAEIYADVLDKL 132

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI-ILVSSAYHLKRSQLYFQHFGINTK 200
           G+ +  I LE  S +T+QNA+F   ++  M  KN   LV+   H KR+++ F  F INT 
Sbjct: 133 GIPKSKIILEKNSKNTYQNAEFIKKIL--MNDKNTYCLVTGGIHYKRAKIIFDKFAINTI 190

Query: 201 ASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
           +  S        I+P S NFY+T+  + EY+GI+  Y
Sbjct: 191 SIASSKFVPNIKILPNSYNFYITQNIVHEYLGIIRIY 227


>gi|254372782|ref|ZP_04988271.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151570509|gb|EDN36163.1| conserved hypothetical protein [Francisella novicida GA99-3549]
          Length = 231

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 110/217 (50%), Gaps = 20/217 (9%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPT 81
           +F+    +++  IG G++ TIL   L+        S   K   N   I+LLG G      
Sbjct: 28  YFIVALTIVYYLIGNGVLGTILALPLKSE------STDIKACANTKGIILLGAGINDAFG 81

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
               ++EP+  +Y RI +T  +Y    QH     IIISGG P    L+E+ +Y + L + 
Sbjct: 82  ----KLEPALSAYDRILKTAEVYH---QHPQQ--IIISGGAPFGEKLSEAEIYADLLDKL 132

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI-ILVSSAYHLKRSQLYFQHFGINTK 200
           G+ +  I LE  S +T+QNA+F   ++  M  KN   LV+   H KR+++ F  F INT 
Sbjct: 133 GIPKSKIILEKNSKNTYQNAEFIKKIL--MNDKNTYCLVTGGIHYKRAKIIFDKFAINTI 190

Query: 201 ASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
           +  S        I+P + NFY+T+  + EY+GI+  Y
Sbjct: 191 SIASSKFVPNIKILPNAYNFYITQNIVHEYLGIIRIY 227


>gi|239830956|ref|ZP_04679285.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239823223|gb|EEQ94791.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 272

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 111/226 (49%), Gaps = 13/226 (5%)

Query: 15  LLCQSIRKI--FFMSCFMLLFSFIGWGIIPTILLKHLQFSY----QRPLLSPQWKKDGNI 68
           L C   RK     +   ++ +  I  G+ P  L+  LQ  Y    QRPL      +D   
Sbjct: 16  LFCFKWRKTGTVLIGLAVIFYGAIASGLAPDYLMNRLQSPYTSQLQRPL------EDNTA 69

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
            ++ G GT ++       +EP   SY+ +     + + C      C  I SG D    G+
Sbjct: 70  FIIFGTGTQVVDERGQKAVEPLAFSYAPLLAAAAMNRQCVDKGFSCKFIASGADVSGTGV 129

Query: 129 AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS 188
           +E+     +L + G++   I L+ +S +++QN++ ++++++ ++   ++L+ +A  L R 
Sbjct: 130 SEATAIAVQLEKVGIDPASILLDEKSRNSWQNSKNTAAILREIRPARVVLLQAAPMLTRD 189

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYL-TELALKEYIGI 233
            LY  HFG+  +   + +L   ++ +  +A ++L T++AL E IG+
Sbjct: 190 LLYLAHFGVKPEPVAAGFLTGSHTNMSSTALYFLVTDVALHEEIGL 235


>gi|118497421|ref|YP_898471.1| hypothetical protein FTN_0829 [Francisella tularensis subsp.
           novicida U112]
 gi|118423327|gb|ABK89717.1| conserved hypothetical membrane protein [Francisella novicida U112]
          Length = 239

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 108/216 (50%), Gaps = 18/216 (8%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPT 81
           +F+    +++  IG G++ TIL   L+        S   K   N   I+LLG G      
Sbjct: 36  YFIVALTIVYYLIGNGVLGTILALPLKSE------STDIKACANTKGIILLGAGINDAFG 89

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
               ++EP+  +Y RI +T  +Y    Q      IIISGG P    L+E+ +Y + L + 
Sbjct: 90  ----KLEPALSAYDRILKTAEVYHQYPQQ-----IIISGGAPFGEKLSEAEIYADVLDKL 140

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+ +  I LE  S +T+QNA+F   ++ N +     LV+   H KR+++ F  F INT +
Sbjct: 141 GIPKSKIILEKNSKNTYQNAEFIKKILINDK-NTYCLVTGGIHYKRAKIIFDKFAINTIS 199

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             S        I+P + NFY+T+  + EY+GI+  Y
Sbjct: 200 IASSKFVPNIKILPNAYNFYITQNIVHEYLGIIRIY 235


>gi|195536112|ref|ZP_03079119.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|194372589|gb|EDX27300.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
          Length = 241

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 108/216 (50%), Gaps = 18/216 (8%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPT 81
           +F+    +++  IG G++ TIL   L+        S   K   N   I+LLG G      
Sbjct: 38  YFIVALTIVYYLIGNGVLGTILALPLKSE------STDIKACANTKGIILLGAGINDAFG 91

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
               ++EP+  +Y RI +T  +Y    Q      IIISGG P    L+E+ +Y + L + 
Sbjct: 92  ----KLEPALSAYDRILKTAEVYHQYPQQ-----IIISGGAPFGEKLSEAEIYADVLDKL 142

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+ +  I LE  S +T+QNA+F   ++ N +     LV+   H KR+++ F  F INT +
Sbjct: 143 GIPKSKIILEKNSKNTYQNAEFIKKILINDK-NTYCLVTGGIHYKRAKIIFDKFAINTIS 201

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             S        I+P + NFY+T+  + EY+GI+  Y
Sbjct: 202 IASSKFVPNIKILPNAYNFYITQNIVHEYLGIIRIY 237


>gi|328676916|gb|AEB27786.1| putative exported protein [Francisella cf. novicida Fx1]
          Length = 231

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 110/215 (51%), Gaps = 16/215 (7%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIP 83
           +F+    +++  I  G++ TIL   L+ S    + + +  K    I+LLG G        
Sbjct: 28  YFIVALTIVYYLIANGVLGTILALPLK-SESTNIKACENTKG---IILLGAGINDAFG-- 81

Query: 84  AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
             ++EP+  +Y RI +T  +Y    Q      IIISGG P    L+E+ +Y + L + G+
Sbjct: 82  --KLEPALSAYDRILKTAEVYHQYPQQ-----IIISGGAPFGEKLSEAEIYADVLDKLGI 134

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI-ILVSSAYHLKRSQLYFQHFGINTKAS 202
            +  I LE  S +T+QNA+F   ++  M  KN   LV+   H KR+++ F  F INT + 
Sbjct: 135 PKSKIILEKNSKNTYQNAEFIKKIL--MNDKNTYCLVTGGIHYKRAKIIFDKFAINTISI 192

Query: 203 CSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            S        I+P S NFY+T+  + EY+GI+  Y
Sbjct: 193 ASSKFVPNIKILPNSYNFYITQNIVHEYLGIIRIY 227


>gi|153007464|ref|YP_001368679.1| hypothetical protein Oant_0119 [Ochrobactrum anthropi ATCC 49188]
 gi|151559352|gb|ABS12850.1| protein of unknown function DUF218 [Ochrobactrum anthropi ATCC
           49188]
          Length = 277

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 105/212 (49%), Gaps = 3/212 (1%)

Query: 23  IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTI 82
           I  +    + +  I   I+P  L+  LQ +Y   L +    +D    ++ G GT  +   
Sbjct: 26  IVLIGLAAIFYGAIASAILPDTLMSRLQSAYSSQLQT--QLEDNTAFIVFGMGTQTVDGD 83

Query: 83  PAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESG 142
               +EP   SY  I   + + + C +    C  I SG D    G++E+     +L ++G
Sbjct: 84  GQKVVEPLAFSYGPILAAVAMNRQCVEKGFRCKFIASGADVAGTGVSEAASIATQLEKAG 143

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
           V+   + L+ +S +++QN++  +++++ ++   ++L+ +A  +KR  LY  HFG+  +  
Sbjct: 144 VDPASVLLDEKSRNSWQNSRNVAAILREIRPAKVVLLQAAPMMKRDLLYLAHFGVKPEPV 203

Query: 203 CSDYLNAYYSIIPLSANFYL-TELALKEYIGI 233
            + YL   ++ +     ++L T+LAL E IG+
Sbjct: 204 AAGYLTGSHTNMSSPGLYFLMTDLALHEEIGV 235


>gi|300777919|ref|ZP_07087777.1| protein of hypothetical function DUF218 [Chryseobacterium gleum
           ATCC 35910]
 gi|300503429|gb|EFK34569.1| protein of hypothetical function DUF218 [Chryseobacterium gleum
           ATCC 35910]
          Length = 216

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 85/141 (60%), Gaps = 2/141 (1%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLET 152
           SYSR+    +LY + K ++  C I++SG    K  ++E+ ++     + GV   DI  E 
Sbjct: 65  SYSRMVTAYQLYHAYKTNNQSCKILVSG--KGKGSMSEAELFRENFKKMGVADADIIKED 122

Query: 153 QSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYS 212
           +S++T++NA++SS ++K M   +I LV+S +H+KRS   FQ FG++   + SD++    +
Sbjct: 123 KSMNTYENAKYSSRILKQMAPSSIDLVTSGFHMKRSVALFQTFGLHPVPNASDFITTEIT 182

Query: 213 IIPLSANFYLTELALKEYIGI 233
           +IP S N   T + LKE +GI
Sbjct: 183 LIPNSYNAAFTFVMLKEVLGI 203


>gi|330984301|gb|EGH82404.1| hypothetical protein PLA107_04649 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 244

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/170 (32%), Positives = 93/170 (54%), Gaps = 6/170 (3%)

Query: 65  DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
           D  +IV+LG G       P +   P++ +  R+ + + +Y+ C+  S  CT++ISGG   
Sbjct: 61  DKQLIVVLGLGVEFQDGKPVV---PTY-ALPRLLKAIEVYRDCQTVS-QCTLLISGGPTG 115

Query: 125 KHGLAESIVYNNKLLESGVE-RDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
           +  L E+ VY +++L S  +    I+LE +S +T++NA+FSSS  K        LV+S  
Sbjct: 116 ETTLTEAEVYQDRILHSAPDLAGHIELEAKSRNTWENARFSSSWAKAHGYGQARLVTSLL 175

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           H++RSQ YF HF   T    S+ +    S +P + N  + E+ + E IG+
Sbjct: 176 HMRRSQSYFAHFDFPTSPEYSEQVVGPTSWLPSAWNLAMVEVLIHEQIGL 225


>gi|332184005|gb|AEE26259.1| putative exported protein [Francisella cf. novicida 3523]
          Length = 228

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 108/216 (50%), Gaps = 18/216 (8%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPT 81
           +F+    +++  IG GI+ +IL   L+        S   K   N   I+LLG G      
Sbjct: 28  YFIVAITIIYYLIGNGILGSILAIPLKSE------STDIKACANTKGIILLGAGINQAFG 81

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
               +++P+  +Y RI +T  +Y    Q      IIISGG P     +E+ +Y + L + 
Sbjct: 82  ----KLQPALSAYDRILKTAEVYHQYPQQ-----IIISGGAPFGEKSSEAEIYADVLYKL 132

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+ +  I LE  S +T+QNA+F   M+ + +     LV+S  H KR+++ F  F INT +
Sbjct: 133 GIPKSKIILEKNSKNTYQNAEFIKKMLVDDK-ITYCLVTSGIHYKRAKIIFDKFAINTIS 191

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             S        I+P + NFY+T+  + EY+GI+  Y
Sbjct: 192 IASSKFVPNIKILPNAYNFYITQNIIHEYLGIVKIY 227


>gi|310643123|ref|YP_003947881.1| protein of hypothetical function duf218 [Paenibacillus polymyxa
           SC2]
 gi|309248073|gb|ADO57640.1| Protein of hypothetical function DUF218 [Paenibacillus polymyxa
           SC2]
          Length = 249

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 101/199 (50%), Gaps = 20/199 (10%)

Query: 44  ILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSF--QSYSRIFETM 101
           +L++ L+  Y +PL        GN+IV+LG G T     P I  + +    + +R+    
Sbjct: 58  VLIRSLEKQYPQPL-----TVQGNVIVVLGGGAT--EGTPDINGQGNLLGSAANRLLTAA 110

Query: 102 RLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNA 161
           RL+++         I+ SGG        E+ +   +LL  G+   DI +E +SL+T QNA
Sbjct: 111 RLHEAT-----GLPILFSGGQVFGDSGNEANIAQRQLLGLGIPAKDIFIENRSLNTQQNA 165

Query: 162 QFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA------YYSIIP 215
            ++S ++K  Q    ILV+SA+H+ R+ L FQ  G+ T A  +DYL +         + P
Sbjct: 166 VYTSKILKQHQLTKPILVTSAFHMPRAALEFQRAGMQTTAYPTDYLASEKLSLYAAKLSP 225

Query: 216 LSANFYLTELALKEYIGIL 234
            +     T  ALKEY+GIL
Sbjct: 226 SAGAISTTGTALKEYLGIL 244


>gi|254369442|ref|ZP_04985454.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122392|gb|EDO66532.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 158

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 84/153 (54%), Gaps = 8/153 (5%)

Query: 86  RIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVER 145
           ++EP+  +Y RI +T  +Y     H     IIISGG P    L+E+ +Y + L + G+ +
Sbjct: 9   KLEPTLSAYDRILKTAEVY-----HQHLQQIIISGGAPFGEKLSEAEIYADVLDKLGIPK 63

Query: 146 DDIKLETQSLDTFQNAQFSSSMIKNMQGKNI-ILVSSAYHLKRSQLYFQHFGINTKASCS 204
             I LE  S +T+QNA+F   ++  M  KN   LV+   H KR+++ F  F INT +  S
Sbjct: 64  SKIILEKNSKNTYQNAEFIKKIL--MNDKNTYCLVTGGIHYKRAKIIFDKFAINTISIAS 121

Query: 205 DYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
                   I+P + NFY+T+  + EY+GI+  Y
Sbjct: 122 SKFVPNIKILPNAYNFYITQNIVHEYLGIIRIY 154


>gi|254370529|ref|ZP_04986534.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|151568772|gb|EDN34426.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
          Length = 158

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 84/153 (54%), Gaps = 8/153 (5%)

Query: 86  RIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVER 145
           ++EP+  +Y RI +T  +Y     H     IIISGG P    L+E+ +Y + L + G+ +
Sbjct: 9   KLEPALSAYDRILKTAEVY-----HQHPQQIIISGGAPFGEKLSEAEIYADVLDKLGILK 63

Query: 146 DDIKLETQSLDTFQNAQFSSSMIKNMQGKNI-ILVSSAYHLKRSQLYFQHFGINTKASCS 204
             I LE  S +T+QNA+F   ++  M  KN   LV+   H KR+++ F  F INT +  S
Sbjct: 64  SKIILEKNSKNTYQNAEFIKKIL--MNDKNTYCLVTGGIHYKRAKIIFDKFAINTISIAS 121

Query: 205 DYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
                   I+P + NFY+T+  + EY+GI+  Y
Sbjct: 122 SKFVPNIKILPNAYNFYITQNIVHEYLGIIRIY 154


>gi|115315002|ref|YP_763725.1| hypothetical protein FTH_1231 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|167010037|ref|ZP_02274968.1| hypothetical protein Ftulh_04754 [Francisella tularensis subsp.
           holarctica FSC200]
 gi|115129901|gb|ABI83088.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
          Length = 158

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 84/153 (54%), Gaps = 8/153 (5%)

Query: 86  RIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVER 145
           ++EP+  +Y RI +T  +Y     H     IIISGG P    L+E+ +Y + L + G+ +
Sbjct: 9   KLEPALSAYDRILKTAEVY-----HQHLQQIIISGGAPFGEKLSEAEIYADVLDKLGIPK 63

Query: 146 DDIKLETQSLDTFQNAQFSSSMIKNMQGKNI-ILVSSAYHLKRSQLYFQHFGINTKASCS 204
             I LE  S +T+QNA+F   ++  M  KN   LV+   H KR+++ F  F INT +  S
Sbjct: 64  SKIILEKNSKNTYQNAEFIKKIL--MNDKNTYCLVTGGIHYKRAKIIFDKFTINTISIAS 121

Query: 205 DYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
                   I+P + NFY+T+  + EY+GI+  Y
Sbjct: 122 SKFVPNIKILPNAYNFYITQNIVHEYLGIIRIY 154


>gi|17988125|ref|NP_540759.1| hypothetical protein BMEI1842 [Brucella melitensis bv. 1 str. 16M]
 gi|256045898|ref|ZP_05448772.1| hypothetical protein Bmelb1R_15424 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112611|ref|ZP_05453532.1| hypothetical protein Bmelb3E_08010 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256264843|ref|ZP_05467375.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260563183|ref|ZP_05833669.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265992310|ref|ZP_06104867.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994051|ref|ZP_06106608.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17983881|gb|AAL53023.1| putative membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|260153199|gb|EEW88291.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|262765032|gb|EEZ10953.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003376|gb|EEZ15669.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095299|gb|EEZ18926.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|326408125|gb|ADZ65190.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326537837|gb|ADZ86052.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 263

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 90/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 44  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSYGSIFAA 101

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 102 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 161

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 162 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 221

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 222 FLAMDLALNEEIG 234


>gi|148560500|ref|YP_001258145.1| hypothetical protein BOV_0103 [Brucella ovis ATCC 25840]
 gi|254700918|ref|ZP_05162746.1| hypothetical protein Bsuib55_08674 [Brucella suis bv. 5 str. 513]
 gi|254709259|ref|ZP_05171070.1| hypothetical protein BpinB_03136 [Brucella pinnipedialis B2/94]
 gi|254716328|ref|ZP_05178139.1| hypothetical protein BcetM_07820 [Brucella ceti M13/05/1]
 gi|256158803|ref|ZP_05456664.1| hypothetical protein BcetM4_07968 [Brucella ceti M490/95/1]
 gi|261218109|ref|ZP_05932390.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221336|ref|ZP_05935617.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314677|ref|ZP_05953874.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316765|ref|ZP_05955962.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321044|ref|ZP_05960241.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261751433|ref|ZP_05995142.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261759222|ref|ZP_06002931.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265987836|ref|ZP_06100393.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265997296|ref|ZP_06109853.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294851511|ref|ZP_06792184.1| hypothetical protein BAZG_00416 [Brucella sp. NVSL 07-0026]
 gi|148371757|gb|ABQ61736.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|260919920|gb|EEX86573.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260923198|gb|EEX89766.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293734|gb|EEX97230.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295988|gb|EEX99484.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303703|gb|EEY07200.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261739206|gb|EEY27202.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261741186|gb|EEY29112.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|262551764|gb|EEZ07754.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264660033|gb|EEZ30294.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294820100|gb|EFG37099.1| hypothetical protein BAZG_00416 [Brucella sp. NVSL 07-0026]
          Length = 263

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 90/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 44  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSYGSIFAA 101

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 102 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 161

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 162 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 221

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 222 FLAMDLALNEEIG 234


>gi|225851646|ref|YP_002731879.1| hypothetical protein BMEA_A0113 [Brucella melitensis ATCC 23457]
 gi|225640011|gb|ACN99924.1| protein of unknown function DUF218 [Brucella melitensis ATCC 23457]
          Length = 272

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 90/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 53  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSYGSIFAA 110

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 111 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 170

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 171 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 230

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 231 FLAMDLALNEEIG 243


>gi|225626650|ref|ZP_03784689.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|254707196|ref|ZP_05169024.1| hypothetical protein BpinM_09538 [Brucella pinnipedialis
           M163/99/10]
 gi|254713318|ref|ZP_05175129.1| hypothetical protein BcetM6_08187 [Brucella ceti M644/93/1]
 gi|256030782|ref|ZP_05444396.1| hypothetical protein BpinM2_09053 [Brucella pinnipedialis
           M292/94/1]
 gi|256254188|ref|ZP_05459724.1| hypothetical protein BcetB_07825 [Brucella ceti B1/94]
 gi|256368571|ref|YP_003106077.1| hypothetical protein BMI_I109 [Brucella microti CCM 4915]
 gi|260169686|ref|ZP_05756497.1| hypothetical protein BruF5_15273 [Brucella sp. F5/99]
 gi|225618307|gb|EEH15350.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|255998729|gb|ACU47128.1| hypothetical protein BMI_I109 [Brucella microti CCM 4915]
          Length = 272

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 90/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 53  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSYGSIFAA 110

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 111 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 170

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 171 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 230

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 231 FLAMDLALNEEIG 243


>gi|261755996|ref|ZP_05999705.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261745749|gb|EEY33675.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 263

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 90/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 44  LPNFLMSRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSYGSIFAA 101

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 102 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 161

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 162 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 221

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 222 FLAMDLALNEEIG 234


>gi|254718327|ref|ZP_05180138.1| hypothetical protein Bru83_02063 [Brucella sp. 83/13]
 gi|265983286|ref|ZP_06096021.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306837219|ref|ZP_07470109.1| protein of unknown function DUF218 [Brucella sp. NF 2653]
 gi|264661878|gb|EEZ32139.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306407678|gb|EFM63867.1| protein of unknown function DUF218 [Brucella sp. NF 2653]
          Length = 263

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 90/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 44  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSYGSIFAA 101

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 102 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 161

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 162 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 221

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 222 FLAMDLALNEEIG 234


>gi|23501020|ref|NP_697147.1| hypothetical protein BR0106 [Brucella suis 1330]
 gi|163842380|ref|YP_001626784.1| hypothetical protein BSUIS_A0110 [Brucella suis ATCC 23445]
 gi|254705285|ref|ZP_05167113.1| hypothetical protein Bsuib36_15473 [Brucella suis bv. 3 str. 686]
 gi|23346882|gb|AAN29062.1| conserved hypothetical protein [Brucella suis 1330]
 gi|163673103|gb|ABY37214.1| protein of unknown function DUF218 [Brucella suis ATCC 23445]
          Length = 272

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 90/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 53  LPNFLMSRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSYGSIFAA 110

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 111 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 170

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 171 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 230

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 231 FLAMDLALNEEIG 243


>gi|304309671|ref|YP_003809269.1| hypothetical protein HDN1F_00190 [gamma proteobacterium HdN1]
 gi|301795404|emb|CBL43602.1| conserved hypothetical protein [gamma proteobacterium HdN1]
          Length = 256

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 116/224 (51%), Gaps = 22/224 (9%)

Query: 25  FMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPA 84
           F+   +L+F+ +   ++   L K L+  Y  P+L P  +   ++IV+LG G   +P  P 
Sbjct: 41  FLGLVVLVFASMP--LVAVGLWKSLEGRY--PILVPSEQPKADVIVVLGGGIA-LPEPP- 94

Query: 85  IRIEPSF-QSYSRIFETMRLYKSCKQHSMHCTIIISGGDP-QKHGLAESIVYNNKLLES- 141
            ++ P    +  R++    LY + K       +++SGG    + GL     Y+ KLLE  
Sbjct: 95  -QVVPDLNDAADRVWYAAELYHAGKAP----WVVVSGGQVFPRSGLESEAEYHRKLLERM 149

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN-TK 200
           GV  + I +E+ S DT  NA  ++++++  + +  +LV+SA H+ R+ L F+H G++   
Sbjct: 150 GVPAEAILVESASRDTAGNAMLTAALMRERKFQKALLVTSAAHMPRAVLLFEHAGVDVVP 209

Query: 201 ASCSDY-----LNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           ASC  +     +     ++P++  F  TE AL E++  +  YYR
Sbjct: 210 ASCDVHGVDMDVPLILKLLPVAWAFQDTERALHEWLAFV--YYR 251


>gi|299135177|ref|ZP_07028368.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
 gi|298590154|gb|EFI50358.1| protein of unknown function DUF218 [Afipia sp. 1NLS2]
          Length = 264

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 94/194 (48%), Gaps = 18/194 (9%)

Query: 60  PQWKKDG----NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCT 115
           P W++ G     IIVL   G  I P + A+R  P   S +   E M       +   +  
Sbjct: 70  PAWQESGRAPDGIIVL---GGAINPDLTAVRGAPEMNSSA---ERMTAAAVLARRFPNAK 123

Query: 116 IIISGGDPQK-HGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
           I++SGG+    H L+       K LE  GV  D I +E +S  T++NA+F+  +I  + G
Sbjct: 124 IVLSGGNANPFHPLSTEAEVGRKFLEDLGVADDRIVMEGRSRTTYENAEFTRPLIHPVAG 183

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD-----YLNAYYSIIPLSANFYLTELALK 228
           + ++LV+SAYH+ R+   F+  G N +A   D     +++A    + LS      + A+ 
Sbjct: 184 ERLLLVTSAYHMPRAMGVFRAAGFNVEAYPVDWRTRGWVDAERPFLTLSGGLGRLDTAVH 243

Query: 229 EYIGILIAYYRGNR 242
           E++G LI Y    R
Sbjct: 244 EWVG-LIGYRLAGR 256


>gi|260567250|ref|ZP_05837720.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260156768|gb|EEW91848.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 263

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 44  LPNFLMSRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSYGSIFAA 101

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
              Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 102 AHFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 161

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 162 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 221

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 222 FLAMDLALNEEIG 234


>gi|256060248|ref|ZP_05450424.1| hypothetical protein Bneo5_07795 [Brucella neotomae 5K33]
          Length = 272

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP    Y  IF  
Sbjct: 53  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFFYGSIFAA 110

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 111 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 170

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 171 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 230

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 231 FLAMDLALNEEIG 243


>gi|261324222|ref|ZP_05963419.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261300202|gb|EEY03699.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 263

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP    Y  IF  
Sbjct: 44  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFFYGSIFAA 101

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 102 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 161

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 162 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 221

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 222 FLAMDLALNEEIG 234


>gi|161618094|ref|YP_001591981.1| hypothetical protein BCAN_A0109 [Brucella canis ATCC 23365]
 gi|161334905|gb|ABX61210.1| protein of unknown function DUF218 [Brucella canis ATCC 23365]
          Length = 272

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 53  LPNFLMSRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSYGSIFAA 110

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
              Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 111 AHFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 170

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 171 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 230

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 231 FLAMDLALNEEIG 243


>gi|306842605|ref|ZP_07475254.1| protein of unknown function DUF218 [Brucella sp. BO2]
 gi|306287250|gb|EFM58738.1| protein of unknown function DUF218 [Brucella sp. BO2]
          Length = 263

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 90/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 44  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLAFSYGSIFAA 101

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 102 ARFYHECQSSGISCTFITTGADVAGTGVSEAASAAAELEKAGVDSQAIIQDDKPRNAWTT 161

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 162 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNASTHFSTSLS 221

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 222 FLAMDLALHEEIG 234


>gi|260881233|ref|ZP_05403953.2| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
 gi|260849348|gb|EEX69355.1| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
          Length = 266

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 105/212 (49%), Gaps = 20/212 (9%)

Query: 8   LIVSYWHLLCQSIRKIFFMSCFMLLFSF--IGWGIIPTILLKHLQFSYQRPLLSPQWKKD 65
           L V  W L  +   K      F L F+F  +  G++    +  L+ +YQ     P  +  
Sbjct: 36  LFVLAWWLWKKRGEKRAAAVLFALTFAFYLLCTGLVAEKTMGWLESAYQ-----PPERPA 90

Query: 66  GNIIVLLGNG----TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
           G++I++LG G    T  +     +   P+    SR+   +RL     Q  +   I++SGG
Sbjct: 91  GDVIIMLGGGAYSDTPDVDGTGTLCASPA----SRLLTAVRL-----QRQLDVPILLSGG 141

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
              +   AE+ +    L+  GV  D I  ET+S++T QNA+FS+ +++     + ILV+S
Sbjct: 142 QVYEDTGAEAKIAKRVLMSLGVPEDKILTETRSINTSQNARFSAEILRENGLSHPILVTS 201

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYLNAYYSI 213
           A+H+KRS L F   G+  +   +DY+ A++ +
Sbjct: 202 AFHMKRSVLNFAKQGVAVEPFPTDYMVAHHPV 233


>gi|306844381|ref|ZP_07476971.1| protein of unknown function DUF218 [Brucella sp. BO1]
 gi|306275194|gb|EFM56944.1| protein of unknown function DUF218 [Brucella sp. BO1]
          Length = 263

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 91/193 (47%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   SY  IF  
Sbjct: 44  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNIVEPLAFSYGSIFAA 101

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 102 ARFYHECQSSGISCTFITTGADVAGTGVSEAASAAAELEKAGVDSQAIIQDDKPRNAWTT 161

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++ + ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 162 ARNVAATLRELKPERVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNASTHFSTSLS 221

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 222 FLAMDLALHEEIG 234


>gi|62289087|ref|YP_220880.1| hypothetical protein BruAb1_0103 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699025|ref|YP_413599.1| hypothetical protein BAB1_0103 [Brucella melitensis biovar Abortus
           2308]
 gi|237814579|ref|ZP_04593577.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254696534|ref|ZP_05158362.1| hypothetical protein Babob28_02155 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|256258668|ref|ZP_05464204.1| hypothetical protein Babob9C_15246 [Brucella abortus bv. 9 str.
           C68]
 gi|297247504|ref|ZP_06931222.1| hypothetical protein BAYG_00411 [Brucella abortus bv. 5 str. B3196]
 gi|62195219|gb|AAX73519.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615126|emb|CAJ10059.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|237789416|gb|EEP63626.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|297174673|gb|EFH34020.1| hypothetical protein BAYG_00411 [Brucella abortus bv. 5 str. B3196]
          Length = 272

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   S   IF  
Sbjct: 53  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSDGSIFAA 110

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 111 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 170

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 171 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 230

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 231 FLAMDLALNEEIG 243


>gi|189023362|ref|YP_001934130.1| hypothetical protein BAbS19_I00980 [Brucella abortus S19]
 gi|254690416|ref|ZP_05153670.1| hypothetical protein Babob68_09644 [Brucella abortus bv. 6 str.
           870]
 gi|254694904|ref|ZP_05156732.1| hypothetical protein Babob3T_09632 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254731447|ref|ZP_05190025.1| hypothetical protein Babob42_09674 [Brucella abortus bv. 4 str.
           292]
 gi|260546384|ref|ZP_05822124.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260755963|ref|ZP_05868311.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759187|ref|ZP_05871535.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760911|ref|ZP_05873254.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884984|ref|ZP_05896598.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261215238|ref|ZP_05929519.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|189018934|gb|ACD71656.1| hypothetical protein BAbS19_I00980 [Brucella abortus S19]
 gi|260096491|gb|EEW80367.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260669505|gb|EEX56445.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671343|gb|EEX58164.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676071|gb|EEX62892.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874512|gb|EEX81581.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916845|gb|EEX83706.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
          Length = 263

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 89/193 (46%), Gaps = 3/193 (1%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           +P  L+  LQ  Y   L  P   +D  + V+ G GT  +       +EP   S   IF  
Sbjct: 44  LPNFLMNRLQEPYSSKLAEPL--EDNTVFVVFGLGTQTVNEQGHNTVEPLTFSDGSIFAA 101

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
            R Y  C+   + CT I +G D    G++E+     +L ++GV+   I  + +  + +  
Sbjct: 102 ARFYHECQSSGVSCTFITTGADVAGTGVSEAASTAAELEKAGVDSRAIIQDDRPHNAWTT 161

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-IPLSAN 219
           A+  ++ ++ ++   ++++  A  + R+ LY  HFGI  +   + YL    S     S +
Sbjct: 162 ARNVAATLRELKPARVVVLQPAPMMGRTLLYLAHFGIKPEPVATSYLTVNGSTHFSTSLS 221

Query: 220 FYLTELALKEYIG 232
           F   +LAL E IG
Sbjct: 222 FLAMDLALNEEIG 234


>gi|206889829|ref|YP_002248307.1| hypothetical protein THEYE_A0462 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741767|gb|ACI20824.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 235

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 107/220 (48%), Gaps = 24/220 (10%)

Query: 20  IRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTII 79
           IR + F S   LL   I    +  +LL  L+ SY     S   K D + IV+LG G    
Sbjct: 35  IRYLAFFSA--LLVYLISIEPVKDLLLYPLEKSY-----SVSEKLDADAIVILGGGVYSW 87

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL 139
            + P         S +R+F    +Y+  K       II+SGG  +   +++S      L 
Sbjct: 88  ASFPE-------DSSNRLFTGYLVYRKTK-----LPIIVSGGAVEGK-ISDSAAMAAMLK 134

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
           E GVE   I  E +S DT QNA + + + K    K +ILV+SAYH+KR+  +F+  G+  
Sbjct: 135 EFGVEDSKIIEENKSRDTAQNALYVAKICKEKSFKKVILVTSAYHMKRAVKFFKQAGLEV 194

Query: 200 KASCSDYL--NAY--YSIIPLSANFYLTELALKEYIGILI 235
               +D+   N Y  YS +P   NF L+  A++E+I +++
Sbjct: 195 LPYPADFKQSNHYNIYSFLPKFGNFALSSKAIREHIALIV 234


>gi|22299705|ref|NP_682952.1| hypothetical protein tlr2162 [Thermosynechococcus elongatus BP-1]
 gi|22295889|dbj|BAC09714.1| tlr2162 [Thermosynechococcus elongatus BP-1]
          Length = 263

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 115/252 (45%), Gaps = 31/252 (12%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKD 65
           +F IV +W    Q+   +      +LL    G   +   L+  L+  Y    L P     
Sbjct: 24  VFAIVRFWRAPKQAAIALVIALTILLLS---GNDYVAATLIASLERQY----LPPHPMPK 76

Query: 66  GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQK 125
              IV+LG G  +  T P   +E + +   RI     L++      +    I+SGG    
Sbjct: 77  AAAIVVLG-GAVVPQTAPRPWVEVT-EGGDRILYGAHLFRQGSDPYL----ILSGGRINW 130

Query: 126 HG----LAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK--NMQGKNIILV 179
            G     AE++         GV RD I LET SL+T+QNA    ++++   MQGK ++LV
Sbjct: 131 LGETFQQAEAVDMAEIATTCGVPRDKILLETSSLNTYQNAVNVKALLEKHQMQGK-LLLV 189

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYL-----------NAYYSIIPLSANFYLTELALK 228
           +SAYH+ R+   F+  G++   + +DY            N   S+IP   N  +T +AL+
Sbjct: 190 TSAYHMPRAVAIFRRLGMDVIPAPTDYRYPTIARSPTWQNLLLSLIPNPYNVDITTIALR 249

Query: 229 EYIGILIAYYRG 240
           EY G+LI   RG
Sbjct: 250 EYQGLLIYRLRG 261


>gi|253584074|ref|ZP_04861272.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
 gi|251834646|gb|EES63209.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
          Length = 252

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 101/193 (52%), Gaps = 17/193 (8%)

Query: 54  QRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH 113
           + PL+S    +D ++ +LLG G  IIP      + P+  + +RI +T + Y    +    
Sbjct: 67  EYPLISTVKLRDADVYILLGGG--IIPNSAGGNV-PAEGANTRIMKTAQFYNKYPKK--- 120

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             I +SGG P ++  +ES VY  +L+  GV  +DI +E +S +T +NA +   M++  + 
Sbjct: 121 --IYVSGGTPLQNKESESSVYKRELIGLGVPAEDIVIEEKSRNTKENAVYIKKMMEEAKE 178

Query: 174 KNIILVSSAYHLKRSQLYFQ--HFGINTKASCSDYL-----NAYYSIIPLSANFYLTELA 226
           K  +L++SA+H+ RS   F     G+    +  D++       ++  IP   NF    L 
Sbjct: 179 KKAVLITSAFHMPRSVKTFDKGEEGLIFYPAPCDFMAKSETENFFDYIPKYVNFKKLGLL 238

Query: 227 LKEYIGILIAYYR 239
           LKEYIG++  YY+
Sbjct: 239 LKEYIGMV--YYK 249


>gi|313672214|ref|YP_004050325.1| hypothetical protein Calni_0249 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312938970|gb|ADR18162.1| protein of unknown function DUF218 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 238

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 122/245 (49%), Gaps = 34/245 (13%)

Query: 5   WIFL---IVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQ 61
           WIF+   I+  + L       +FF +  + LFS      +  IL+  ++  Y        
Sbjct: 16  WIFIVGFILGGYFLKGFKRYLLFFFAVMLYLFSI---SPVKDILIYPIEKDYI------N 66

Query: 62  WKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
            K DG+IIV+LG G      +     E +F+   + FE        K       II+SGG
Sbjct: 67  LKCDGDIIVVLGGGVYGNGELS----EDAFKRVVKGFE--------KGRGGDKIIIVSGG 114

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI--KNMQGKNIILV 179
              +    E+ V  + L+  G+   +I ++  S DT +NA+F+  ++  K ++G ++IL+
Sbjct: 115 RVSESYPYEAEVMKDLLVTLGIREGNIIMDKDSKDTVENAKFTKKIVEEKGIKG-DVILI 173

Query: 180 SSAYHLKRSQLYFQHFGI-NTKASCSDY-LNAYYSI---IPLSANFYLTELALKEYIGIL 234
           +SAYH+KR  L F+ +G  N  A+ +D+  +  YSI   +P ++N      ALKEY+GIL
Sbjct: 174 TSAYHMKRGILIFKKYGFDNICAAATDFKFDGVYSIYDFLPSASNLNTVSKALKEYLGIL 233

Query: 235 IAYYR 239
             +YR
Sbjct: 234 --FYR 236


>gi|315122363|ref|YP_004062852.1| hypothetical protein CKC_03075 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
 gi|313495765|gb|ADR52364.1| hypothetical protein CKC_03075 [Candidatus Liberibacter
          solanacearum CLso-ZC1]
          Length = 85

 Score = 81.6 bits (200), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 38/53 (71%), Positives = 44/53 (83%)

Query: 36 IGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIE 88
          IG G+IP ILLK+LQF YQ PL SPQW+K+GNIIVLLGNGT  IPT+P + IE
Sbjct: 5  IGSGLIPAILLKNLQFPYQTPLSSPQWEKEGNIIVLLGNGTEKIPTLPTVGIE 57


>gi|239617397|ref|YP_002940719.1| protein of unknown function DUF218 [Kosmotoga olearia TBF 19.5.1]
 gi|239506228|gb|ACR79715.1| protein of unknown function DUF218 [Kosmotoga olearia TBF 19.5.1]
          Length = 254

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 118/235 (50%), Gaps = 29/235 (12%)

Query: 20  IRKIFFMSCFML-LFSFIGWGIIPTIL-LKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTT 77
           ++K+   S  ++ LFS++    I T L +K L+  Y  P  +         IV+LG G  
Sbjct: 37  LQKMLSFSILIIGLFSYLLMSGIGTYLYVKPLETEYSVP--NASLLDTAEAIVVLGGGMI 94

Query: 78  IIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ-KHGLAESIVYNN 136
           I P      +EP   +  R+++  +++++  +      II++GG P  +  L+ES V  N
Sbjct: 95  IAP----YELEPGDHTLKRLYKAFQIHRATGK-----PIIVTGGTPMGRDSLSESEVMLN 145

Query: 137 KLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG 196
            LL  G++ +D+ +E  + +T +NA   + + K  + K I+LV+SA H+KRS   F+  G
Sbjct: 146 TLLNWGIDENDVIVENSARNTNENAVRVAEICKEKKWKKIVLVTSAVHMKRSVESFEEQG 205

Query: 197 INTKASCSDYLNAYYSI-----IP----LSANFYLTELALKEYIGILIAYYRGNR 242
           +N     +DYL  Y  +     +P    L+AN       + E+IGI+  +Y   R
Sbjct: 206 LNVIPYPTDYLYDYTDLSWVDFLPGRDALTANLS----GIHEFIGII--WYNAKR 254


>gi|308070011|ref|YP_003871616.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
 gi|305859290|gb|ADM71078.1| DUF218 domain containing protein [Paenibacillus polymyxa E681]
          Length = 249

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 98/199 (49%), Gaps = 20/199 (10%)

Query: 44  ILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSF--QSYSRIFETM 101
           +L+  L+  Y +P         G++IV+LG G T     P I  + +    + +R+    
Sbjct: 58  LLISSLEKQYPQP-----RTVQGDVIVVLGGGAT--QGTPDINGQGNLLGSAANRLLTAA 110

Query: 102 RLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNA 161
           RL+++         I+ SGG        E+ +   +LL  G+   DI +E +SL+T QNA
Sbjct: 111 RLHEAT-----GLPILFSGGQVFGDSGNEANIAQRQLLGLGIPAKDILIENRSLNTQQNA 165

Query: 162 QFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYY------SIIP 215
            ++S +++  Q    +LV+SA+H+ R+ L FQ  G+   A  +DYL +         + P
Sbjct: 166 VYTSQILEKHQLTRPVLVTSAFHMPRAALEFQRAGVQAIAYPTDYLASEKLSLYAGKLSP 225

Query: 216 LSANFYLTELALKEYIGIL 234
            +     T  ALKEY+GIL
Sbjct: 226 SAGAMSTTGTALKEYLGIL 244


>gi|37523632|ref|NP_927009.1| hypothetical protein gll4063 [Gloeobacter violaceus PCC 7421]
 gi|35214637|dbj|BAC92004.1| gll4063 [Gloeobacter violaceus PCC 7421]
          Length = 260

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 80/159 (50%), Gaps = 14/159 (8%)

Query: 92  QSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL----ESGVERDD 147
           +S  R+    RL+K+ K       +++SGG+P  H   +      ++     E GV    
Sbjct: 104 ESSDRVLHAARLFKAGKA----PVVLMSGGNPPFHTRPDQPPEATQMAAFARELGVPAGA 159

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL 207
           I  E +S +TFQNA FS+ ++K  +   I+LV+SA H+ RS   F+  G    A+ +D  
Sbjct: 160 ILTEERSWNTFQNAAFSAEVLKARRMTRILLVTSASHMPRSVAIFERAGFAVIAASTDVR 219

Query: 208 NA------YYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           +         + +P +A    + LALKE++G+L+   RG
Sbjct: 220 SGTDLDDWLLAWLPSAAALESSTLALKEWVGLLVYRLRG 258


>gi|317064197|ref|ZP_07928682.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
 gi|313689873|gb|EFS26708.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
          Length = 241

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 123/244 (50%), Gaps = 25/244 (10%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIG--WGIIPTILLKHL-QFSYQRPLLSPQW 62
           IF+ +   ++L + I+     S F+L+F  +G   G     + + L +   +   +S   
Sbjct: 10  IFIYIGLKNILNRRIK-----SGFLLIFIGVGTYLGTSDFFVDRFLFKLESEYSTISTVK 64

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
            ++G++ +LLG G  I+P      + PS  + +RI +T + Y    +      I ISGG 
Sbjct: 65  LQEGDVYILLGGG--IVPNSAGGNV-PSEGANARIIKTAQFYNKYPKK-----IYISGGS 116

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA 182
           P ++  +ES VY  +L+  G+  ++I +E +S +T +NA +   M++  + K  +L++SA
Sbjct: 117 PLQNKESESSVYKRELVALGIPSENIVIEEKSRNTRENALYIRKMMEGSKEKKAVLITSA 176

Query: 183 YHLKRSQLYFQ--HFGINTKASCSDYL-----NAYYSIIPLSANFYLTELALKEYIGILI 235
           +H+ RS   F     G+    +  D++       ++  IP   NF    + LKEYIG+L 
Sbjct: 177 FHIPRSVKTFDDGEGGLIFYPAPCDFMAKKEAENFFDYIPEYTNFKKLGILLKEYIGML- 235

Query: 236 AYYR 239
            YYR
Sbjct: 236 -YYR 238


>gi|188996942|ref|YP_001931193.1| protein of unknown function DUF218 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932009|gb|ACD66639.1| protein of unknown function DUF218 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 242

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 113/241 (46%), Gaps = 25/241 (10%)

Query: 2   LLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQ 61
           L   IFLI++Y+    + +  I   S   +    I    +   LLK L+  +Q+P     
Sbjct: 17  LFVLIFLIIAYFSRNNKRVLTISLASAISIYL--ISIEPVKDFLLKPLEAKFQQP----- 69

Query: 62  WKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
               G++IV+LG G+        I  E S +   R+     L+K      ++  II+SGG
Sbjct: 70  KNISGDVIVVLGGGSYNT----GILTEDSLK---RVLTGFVLHKR-----LNVPIILSGG 117

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
               + L ES    + L E G+++  I  + QS DT +NA F+  + K    K +ILV+S
Sbjct: 118 SAITN-LPESEAMKSLLAELGIDKKMIFTDVQSRDTLENAFFTKKICKKYGYKTVILVTS 176

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYLN----AYYSIIPLSANFYLTELALKEYIGILIAY 237
           AYH+ RS + F+  G+N     +D+        YS  P       +  A++EYIG L AY
Sbjct: 177 AYHMPRSYMTFKQAGLNVIPYPTDFKMDKKYTVYSYFPKMNVLQDSTKAIREYIG-LFAY 235

Query: 238 Y 238
           Y
Sbjct: 236 Y 236


>gi|257469971|ref|ZP_05634063.1| hypothetical protein FulcA4_11568 [Fusobacterium ulcerans ATCC
           49185]
          Length = 252

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 97/183 (53%), Gaps = 17/183 (9%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           ++G++ +LLG G  I+P      + PS  + +RI +T + Y    +      I ISGG P
Sbjct: 77  QEGDVYILLGGG--IVPNSAGGNV-PSEGANARIIKTAQFYNKYPKK-----IYISGGSP 128

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
            ++  +ES VY  +L+  G+  ++I +E +S +T +NA +   M++  + K  +L++SA+
Sbjct: 129 LQNKESESSVYKRELVALGIPSENIVIEEKSRNTRENALYIRKMMEGSKEKKAVLITSAF 188

Query: 184 HLKRSQLYFQ--HFGINTKASCSDYL-----NAYYSIIPLSANFYLTELALKEYIGILIA 236
           H+ RS   F     G+    +  D++       ++  IP   NF    + LKEYIG+L  
Sbjct: 189 HIPRSVKTFDDGEGGLIFYPAPCDFMAKKEAENFFDYIPEYTNFKKLGILLKEYIGML-- 246

Query: 237 YYR 239
           YYR
Sbjct: 247 YYR 249


>gi|320161712|ref|YP_004174937.1| hypothetical protein ANT_23110 [Anaerolinea thermophila UNI-1]
 gi|319995566|dbj|BAJ64337.1| hypothetical protein ANT_23110 [Anaerolinea thermophila UNI-1]
          Length = 264

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 110/236 (46%), Gaps = 36/236 (15%)

Query: 26  MSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAI 85
           ++ F+LL S   W  + T L + L++ Y    L  +       +V+LG GT   P  P  
Sbjct: 42  LALFILLVSSNRW--VATTLARSLEWQY----LPNEPISSAPAMVVLGGGTE--PAFPP- 92

Query: 86  RIEPSFQSY-SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNN-----KLL 139
           R +P   S   R+     LY+  K       +I+SGG+    G   S   ++     K+L
Sbjct: 93  RSQPEVNSAGDRVLYAAALYQQGKA----PLVIVSGGNVAFRGEQSSTPASDMRHLLKML 148

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
             GV  + I  E QS +T++NA + + ++K    + +ILV+SA H+ RS   F+  GI  
Sbjct: 149 --GVPPEAILEEDQSQNTYENALYCAKLLKERHIQRVILVTSALHMPRSVKLFEKQGIEV 206

Query: 200 KASCSDYLNAY---------------YSIIPLSANFYLTELALKEYIGILIAYYRG 240
             + +D+   +                +++P S+N  LT   L EYIGIL+ + RG
Sbjct: 207 IPAPADFAVPFQEWEDLLHAPIPAQLVALLPSSSNLQLTTNVLHEYIGILVYWMRG 262


>gi|110633611|ref|YP_673819.1| hypothetical protein Meso_1258 [Mesorhizobium sp. BNC1]
 gi|110284595|gb|ABG62654.1| protein of unknown function DUF218 [Chelativorans sp. BNC1]
          Length = 268

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 110/229 (48%), Gaps = 19/229 (8%)

Query: 18  QSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGN-GT 76
           + +    F+    +L + IGW  + +  L  L+  + RP +S        I+VL G   T
Sbjct: 37  RKVAGTLFVGTAAILLAVIGWSPLGSAALLALENRFPRPAIS---GPIAGIVVLGGEIDT 93

Query: 77  TIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ---KHGLAESIV 133
            +      I +  + +  ++  E  RLY + +       I++SGG       H   E+ +
Sbjct: 94  DVSAERKTIALTDAAERLTKTAEFNRLYPNAR-------ILLSGGINDLLITHDRTEAAL 146

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
               L++ GV  D I+LE +S +T +NA  S ++     G+  +LV+SA+H+ R+   F+
Sbjct: 147 ARELLVKIGVPADRIELEERSRNTCENAIESKAVAAPKPGETWLLVTSAFHMPRAVGCFR 206

Query: 194 HFGINTKASCSDYL---NAYYSIIP-LSANFYLTELALKEYIGILIAYY 238
             G        DYL   +A  S+ P ++A  YLT++A  E++G L AYY
Sbjct: 207 AAGFPVLPYPVDYLARRSALSSLAPSVAAGLYLTDIAAHEWLG-LAAYY 254


>gi|94266695|ref|ZP_01290369.1| Protein of unknown function DUF218 [delta proteobacterium MLMS-1]
 gi|93452658|gb|EAT03218.1| Protein of unknown function DUF218 [delta proteobacterium MLMS-1]
          Length = 254

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 94/183 (51%), Gaps = 18/183 (9%)

Query: 66  GNIIVLLGNGTTIIPTIPAIRIEPSFQSYS-RIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
            + IVLLG G      +PA    P   + + R++   RLY + K       II+SGG  +
Sbjct: 80  ADFIVLLGGGVR---GVPADWPYPDLNAAADRVWHAPRLYHADKA----PLIIVSGGGKE 132

Query: 125 KHGL--AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA 182
            HG   +E+      LL  GV    I+LE +S  T +NA +++ ++     + ++LV+SA
Sbjct: 133 WHGERGSEAEAMRELLLAFGVPDGAIRLEDRSRSTRENALYTAPLVGE---RPVLLVTSA 189

Query: 183 YHLKRSQLYFQHFGINTKASCSDY---LNAYYS--IIPLSANFYLTELALKEYIGILIAY 237
            H+ RS   F+  GIN   + +D+       +S  ++P + + + +  ALKEY+G+L+  
Sbjct: 190 QHMPRSLATFRAVGINAVPAPTDFEVIPQPLHSLRLLPDAHSLHQSTSALKEYLGLLVYR 249

Query: 238 YRG 240
            RG
Sbjct: 250 LRG 252


>gi|257058358|ref|YP_003136246.1| hypothetical protein Cyan8802_0454 [Cyanothece sp. PCC 8802]
 gi|256588524|gb|ACU99410.1| protein of unknown function DUF218 [Cyanothece sp. PCC 8802]
          Length = 265

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 111/237 (46%), Gaps = 42/237 (17%)

Query: 27  SCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIR 86
           +  +LL S   W  + + L++ L+     P++ PQ      +IV+LG G T  P  P   
Sbjct: 46  ALVILLISSNAW--VSSALIQSLEQQISPPVIIPQ----AEVIVVLG-GATKSPVKPRPM 98

Query: 87  IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD--------PQKHGLAESIVYNNKL 138
           ++ + +   R+F   +LY   K       II SGG         P+   +A+       L
Sbjct: 99  VDVN-EHGDRLFYAAKLYLDQKA----PLIIASGGRISWSGNSRPESEDMAQ-------L 146

Query: 139 LES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
           L+  GV    I  E  SL+T++NA     ++ N+  K ++LV+SA+HL R++L F+  GI
Sbjct: 147 LQMLGVPSQAIIQEPNSLNTYENAINVKQILDNLGIKKVLLVTSAFHLPRARLIFEKLGI 206

Query: 198 NTKASCSDYL-------NAYYSI-------IPLSANFYLTELALKEYIGILIAYYRG 240
           N   + +DY        N   SI       +P +    LT LALKEYIG  I   +G
Sbjct: 207 NVIGAPTDYFVTEIDETNNQTSIEGFILGLLPDAHRLSLTTLALKEYIGTFIYRLKG 263


>gi|268678711|ref|YP_003303142.1| hypothetical protein Sdel_0069 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268616742|gb|ACZ11107.1| protein of unknown function DUF218 [Sulfurospirillum deleyianum DSM
           6946]
          Length = 261

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 121/256 (47%), Gaps = 36/256 (14%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKD 65
           IF+++ ++ +L     ++FF++   ++F  +    +   LLK L+  Y +PL        
Sbjct: 20  IFILLFFFAVLYAKKFRLFFLAN-AVVFYLLSNAYVADWLLKPLEEPYNQPL---HVTAV 75

Query: 66  GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQK 125
             +IVL G  T  +  +P      S  +Y R+   + + KS K       ++ SGG   K
Sbjct: 76  DAVIVLGGGHTQGVANLPL-----SSDAYKRMMWGLMVAKSHK-----LPLLFSGGGLYK 125

Query: 126 HGLAESIVYNNKLLESGVERD--------------DIKLETQSLDTFQNAQFSSSMIK-- 169
             L ES  + + L E     D               + +E +SLDT+QNAQFS +  +  
Sbjct: 126 EYL-ESDAFLDSLKELKSYLDIATPNSKSLATKEFSLHVEDKSLDTYQNAQFSKTAFEKA 184

Query: 170 NMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY-----YSIIPLSANFYLTE 224
            + G  I LV+SAYH+KRS + ++HFG N   + +++   +     +  +P +   Y + 
Sbjct: 185 GVMGPTIYLVTSAYHMKRSIMLYEHFGFNVIPAATNFKINHREKDGWDYLPSAHALYKSY 244

Query: 225 LALKEYIGILIAYYRG 240
           +AL EY G+L    RG
Sbjct: 245 IALHEYAGLLSLKLRG 260


>gi|218245322|ref|YP_002370693.1| hypothetical protein PCC8801_0441 [Cyanothece sp. PCC 8801]
 gi|218165800|gb|ACK64537.1| protein of unknown function DUF218 [Cyanothece sp. PCC 8801]
          Length = 265

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 111/237 (46%), Gaps = 42/237 (17%)

Query: 27  SCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIR 86
           +  +LL S   W  + + L++ L+     P++ PQ      +IV+LG G T  P  P   
Sbjct: 46  ALVILLISSNAW--VSSALIQSLEQQISPPVIIPQ----AEVIVVLG-GATKSPVKPRPM 98

Query: 87  IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD--------PQKHGLAESIVYNNKL 138
           ++ + +   R+F   +LY   K       II SGG         P+   +A+       L
Sbjct: 99  VDVN-EHGDRLFYAAKLYLDQKA----PLIIASGGRISWSGNSRPESEDMAQ-------L 146

Query: 139 LES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
           L+  GV    I  E  SL+T++NA     ++ N+  K ++LV+SA+HL R++L F+  GI
Sbjct: 147 LQMLGVPSQAIIQEPNSLNTYENAINVKQILDNLGIKKVLLVTSAFHLPRARLIFEKLGI 206

Query: 198 NTKASCSDYL-------NAYYSI-------IPLSANFYLTELALKEYIGILIAYYRG 240
           N   + +DY        N   SI       +P +    LT LALKEYIG  I   +G
Sbjct: 207 NVIGTPTDYFVTEIDETNNQTSIEGFILGLLPDAHRLSLTTLALKEYIGTFIYRLKG 263


>gi|163783486|ref|ZP_02178477.1| hypothetical protein HG1285_08734 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881250|gb|EDP74763.1| hypothetical protein HG1285_08734 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 239

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 101/190 (53%), Gaps = 18/190 (9%)

Query: 49  LQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK 108
           L +  + P  +P+ +  G++IV+LG G      + A        SY R+     L++   
Sbjct: 58  LFYPLESPFKTPK-RIRGDVIVVLGGGAYNSGYLKA-------SSYKRLIAGFLLHRRTG 109

Query: 109 QHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI 168
           +      +I+SGG      + E+ V    LLE GVE  DI  + +S DT++NA++  ++ 
Sbjct: 110 K-----PLILSGGA-AIGVIPEAKVMKELLLEFGVEEKDIYADLRSRDTYENAKYVRNIC 163

Query: 169 KNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSD--YLNAY--YSIIPLSANFYLTE 224
           + +  ++I LV+SA+H++R+ + F+  G+  +   +D  +   Y  YS  P  + FY + 
Sbjct: 164 EKIGCRSITLVTSAFHMRRALMVFKKTGLEVQPYPTDLKFEGRYNLYSAFPKYSVFYDSS 223

Query: 225 LALKEYIGIL 234
           +A++EY+G+L
Sbjct: 224 IAIREYVGLL 233


>gi|119512087|ref|ZP_01631180.1| hypothetical protein N9414_07364 [Nodularia spumigena CCY9414]
 gi|119463245|gb|EAW44189.1| hypothetical protein N9414_07364 [Nodularia spumigena CCY9414]
          Length = 263

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 101/213 (47%), Gaps = 28/213 (13%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGT-TIIPTIPAIRIEPSFQSYSRIFETMRL 103
           L++ L++ Y    L P    +   IV+LG  T +  P  P + +    ++  R+    +L
Sbjct: 60  LVRSLEWQY----LPPNPVPNAEAIVVLGGATKSAYPPRPTVDLS---ETGDRVIYAAQL 112

Query: 104 YKSCKQHSMHCTIIISGG--DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNA 161
           Y+  K       II+SGG  D +  G +ES    N L   G+  + I  E  SL+T+QNA
Sbjct: 113 YRQNKAP----IIILSGGRIDWRGGGESESADMANVLTSIGIPSEVIVQEPDSLNTYQNA 168

Query: 162 QFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL-------------- 207
                ++++     ++LV+SA H+ RS   FQ  GIN  A+ +D+L              
Sbjct: 169 VNVKKILESRGIGKVLLVTSAMHMPRSIQIFQRQGINAIAAPTDFLVSQGELQELSSTPK 228

Query: 208 NAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            A  +++P S N      ALKEYIG  +  +RG
Sbjct: 229 AAILNLLPDSNNLQQFTSALKEYIGSFVYSWRG 261


>gi|224373337|ref|YP_002607709.1| hypothetical protein NAMH_1317 [Nautilia profundicola AmH]
 gi|223588336|gb|ACM92072.1| conserved hypothetical protein [Nautilia profundicola AmH]
          Length = 240

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 118/245 (48%), Gaps = 23/245 (9%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +L   IF+I+ +   +     KI F S  +LL++ I    +   LL  L+  Y+   ++P
Sbjct: 12  LLPPGIFVIILFLAAIFAKKAKIVFFSAAVLLWA-ISTKFVANALLYPLEHGYKSDTITP 70

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
                 + +V+LG GT     + A+      + Y  +          KQ S+    I +G
Sbjct: 71  ------SAVVVLGGGTNSRDVLKAMPDAFKREVYGLLI--------AKQESL--PYIFTG 114

Query: 121 GDPQKHGLAESIVYNNKLLESGVERD-DIKLETQSLDTFQNAQFSSSMIKNMQ-GKNIIL 178
           G  Q    AE+I  +  ++      D +   E +SL+TFQNA++++ + + +   K I L
Sbjct: 115 GGIQNIKEAENIKKDIDMILKTCNCDIETFYENRSLNTFQNAKYTAKLFEKLNLSKKIYL 174

Query: 179 VSSAYHLKRSQLYFQHFG--INTKASCSDYLNAY--YSIIPLSANFYLTELALKEYIGIL 234
           V+SAYH+KR+ + F +FG  I  K     Y N Y  + I P + NFY +  A+ EY G++
Sbjct: 175 VTSAYHMKRAIMIFNNFGFQIIPKPVGFYYDNEYTFWDIFPNAGNFYHSYKAIHEYFGLI 234

Query: 235 IAYYR 239
             Y R
Sbjct: 235 KTYLR 239


>gi|310780398|ref|YP_003968730.1| protein of unknown function DUF218 [Ilyobacter polytropus DSM 2926]
 gi|309749721|gb|ADO84382.1| protein of unknown function DUF218 [Ilyobacter polytropus DSM 2926]
          Length = 252

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 99/205 (48%), Gaps = 15/205 (7%)

Query: 42  PTI-LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           PT+ L   L  +  +P  + + +K G   V+LG G  II   P   I PS  +  R+  T
Sbjct: 55  PTVDLTAKLVENRVQPAAAEEIEK-GEAYVVLGGG--IIEKTPVGNI-PSETASVRLMNT 110

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
             LY S  +     TI I+GG      ++ES VY   L+   +   DI  E +S  T +N
Sbjct: 111 AILYNSHPK-----TIYITGGKVTNQQVSESSVYKKILIGLNIPDSDILTEERSRTTMEN 165

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYS-----IIP 215
           A+++S ++K    KNI+LV+SA H+ RS++ F+  G N   +   Y+  Y +      IP
Sbjct: 166 ARYTSELLKKSNIKNIVLVTSASHMTRSKMTFEKQGFNVVPAPCGYIQNYKNYNMLDFIP 225

Query: 216 LSANFYLTELALKEYIGILIAYYRG 240
            S N       + E+ GI+    RG
Sbjct: 226 RSDNLSYFMRLIWEFAGIVYYGIRG 250


>gi|15606980|ref|NP_214362.1| hypothetical protein aq_1986 [Aquifex aeolicus VF5]
 gi|2984233|gb|AAC07762.1| hypothetical protein aq_1986 [Aquifex aeolicus VF5]
          Length = 241

 Score = 74.7 bits (182), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 102/205 (49%), Gaps = 23/205 (11%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           I  +L+  L+  Y++P +       G+ IV+LG G      + A        S+ R+   
Sbjct: 53  IKDLLIYPLENYYKKPEVL-----KGDAIVVLGGGVYNNGRLKA-------SSFKRLITG 100

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
             LYK  K+      II+SGG    + + E+ V    L   GV  +DI  + +S DTF+N
Sbjct: 101 FLLYKELKK-----PIILSGGA-SINVIPEAKVMKELLRSFGVPEEDIYTDVRSRDTFEN 154

Query: 161 AQFSSSMI-KNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSD--YLNAY--YSIIP 215
           A+F   M  K ++ K +ILV+S +H+ R+   F+  G+      +D  +   Y  YS+ P
Sbjct: 155 AKFVKEMCEKLLKCKEVILVTSGFHMPRAVGVFKKAGLEVIPYPTDLKFEGKYNVYSLFP 214

Query: 216 LSANFYLTELALKEYIGILIAYYRG 240
             + FY + +A++EYIG+L    +G
Sbjct: 215 KYSVFYDSSIAIREYIGLLFYKLKG 239


>gi|323142298|ref|ZP_08077130.1| hypothetical protein HMPREF9443_01929 [Phascolarctobacterium sp.
           YIT 12067]
 gi|322413182|gb|EFY04069.1| hypothetical protein HMPREF9443_01929 [Phascolarctobacterium sp.
           YIT 12067]
          Length = 258

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 117/247 (47%), Gaps = 21/247 (8%)

Query: 2   LLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKH-LQFSYQRPLLSP 60
           +L  I L V  W       R  F +S F+ L  +    ++   LL   L+  Y +     
Sbjct: 19  VLLGIILSVYLWRRRQNIGRFAFSLSAFLTLLLYFSSTLLGAKLLGQPLENRYIQ----- 73

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           Q      +IV+LG G+         R        +R+    RL    KQHS+   ++ISG
Sbjct: 74  QQPDAAQVIVVLGGGSVGSAPDGTERGGLMSAGAARLLTAARL---AKQHSL--PVLISG 128

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           G   + G++E++V    LL+ G+ ++ I +ETQ+  T +NA +++   +    ++++L++
Sbjct: 129 GQVFRDGVSEALVAERILLQLGLPQEQIIVETQARTTKENAAYTAMHCRERGYQSVLLLT 188

Query: 181 SAYHLKRSQLYFQHF----GINTKASCSDY-LNAYYS-----IIPLSANFYLTELALKEY 230
           SA H+ RS  +F+ +    G+   A   DY LN         ++P    F +T +AL EY
Sbjct: 189 SALHMPRSMQFFERYLGEQGVKVAAYPCDYTLNPQGKFNPRWLVPQLQAFDVTCMALHEY 248

Query: 231 IGILIAY 237
           +G+  A+
Sbjct: 249 VGMAGAF 255


>gi|327398427|ref|YP_004339296.1| hypothetical protein Hipma_0260 [Hippea maritima DSM 10411]
 gi|327181056|gb|AEA33237.1| protein of unknown function DUF218 [Hippea maritima DSM 10411]
          Length = 258

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 117/241 (48%), Gaps = 29/241 (12%)

Query: 8   LIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGN 67
           LI+     L +  R  F +S F+L F       I T   K+L  SY   + +       +
Sbjct: 31  LILITASFLVKRFRWFFMVSAFVLWF-------ISTTPGKNLLLSYLEDIKTSS--DTAS 81

Query: 68  IIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHG 127
            +V+L  G+      P  RI+   +++ R+   + L K       +  +I SGG  + + 
Sbjct: 82  AVVVLSGGSN-----PYDRIKTYPEAFKRLMYGILLAKR-----YNIPLIFSGGGLKYND 131

Query: 128 LAESIVYNNKLLESGVERDDIKL--ETQSLDTFQNAQFSSSMIKNMQ-GKNIILVSSAYH 184
            A++   N+  + + +    IK+  E +SL+T+QNA+++S   + M+  K+I +V+SAYH
Sbjct: 132 SAQA--KNDIEIIAKICNCKIKIYFENKSLNTYQNAKYTSKFFEKMKIKKDIFIVTSAYH 189

Query: 185 LKRSQLYFQHFGINTKASCSDYLN-----AYYSIIPLSANFYLTELALKEYIGILIAYYR 239
            KR+ + F++FG    +   ++        ++  +P   NFY +  A+ EYIGI   Y R
Sbjct: 190 QKRANILFRYFGFRVHSRPVNFFKERGSYVFWDFLPQMGNFYKSYKAIHEYIGIFSLYLR 249

Query: 240 G 240
           G
Sbjct: 250 G 250


>gi|291532233|emb|CBL05346.1| Uncharacterized conserved protein [Megamonas hypermegale ART12/1]
          Length = 194

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 100/202 (49%), Gaps = 17/202 (8%)

Query: 44  ILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTT-IIPTIPAIRIEPSFQSYSRIFETMR 102
           +L+  L+ +Y  P   P    + ++I++LG G T   P +       S  + +R+   +R
Sbjct: 1   MLIGRLEDAYDPPKHLP----NADVIIVLGGGATGDTPDVTGTGTLCSIPA-NRLLTAVR 55

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
           L     Q  +   II+SGG   +    E+ +    L E GV  D I LE +SL+T QNA+
Sbjct: 56  L-----QKKLGIPIIVSGGQIYEDSGREADIARRILKELGVSEDMILLENRSLNTTQNAE 110

Query: 163 FSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA------YYSIIPL 216
           +S++++K+ + K  +LV+SA+H++R+ + F   G++      DY+        Y  + P 
Sbjct: 111 YSTNILKSRKYKQPLLVTSAFHMERAVVNFNKLGVDVIPYPCDYMVNKEKVFHYNRLAPS 170

Query: 217 SANFYLTELALKEYIGILIAYY 238
           S     T + L+E +   +  Y
Sbjct: 171 SQALEFTAIYLQENLRTFVTKY 192


>gi|75675900|ref|YP_318321.1| hypothetical protein Nwi_1708 [Nitrobacter winogradskyi Nb-255]
 gi|74420770|gb|ABA04969.1| Protein of unknown function DUF218 [Nitrobacter winogradskyi
           Nb-255]
          Length = 280

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 97/201 (48%), Gaps = 23/201 (11%)

Query: 60  PQWKKDG---NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTI 116
           P W+ DG   + I++LG       ++    +E +  S  R+   + L +   +      I
Sbjct: 85  PAWQHDGRDPDGIIVLGGAVDADISVSRGAVETN-ASAERVIAALELARRFPK----ARI 139

Query: 117 IISGGDPQK-HGL-AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK 174
           + SGG      GL AE+ V      + G+ R+ I LET+S  T +NA+F+  ++K   G+
Sbjct: 140 VYSGGAGNLIAGLRAEAPVMGRLFEQFGIPRERIVLETRSRTTDENARFTRELVKPESGE 199

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSD-----YLNAYYSIIPLSANFYLTELALKE 229
             +LV+SAYH+ RS   F+  G + +    D     +++A+     LSA     + A  E
Sbjct: 200 RWLLVTSAYHMPRSVGVFRKAGFDVEPYPVDWRTRGWIDAWMPFDKLSAGLARADTAAHE 259

Query: 230 YIGILI--------AYYRGNR 242
           ++G+L+        A++ G+R
Sbjct: 260 WVGLLVYRMTGRSDAFFPGSR 280


>gi|225849301|ref|YP_002729465.1| hypothetical protein SULAZ_1499 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644421|gb|ACN99471.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 242

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 114/238 (47%), Gaps = 29/238 (12%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTI--LLKHLQFSYQRPLLSPQWK 63
           IF +++Y+    +  RKIF +S     F ++   I P    LL+ L+  Y  P      K
Sbjct: 21  IFSVIAYF---GRKDRKIFIVSFLSAFFIYL-LSIEPVKDSLLRPLETKYPIP-----NK 71

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
            +G++IV+LG G+        I  E S +   R+     L+K      ++  II+SGG  
Sbjct: 72  LNGDVIVVLGGGSYNT----GILTEDSLK---RVLTGFVLHKK-----LNLPIILSGGSA 119

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
             + L E+ V  N L E GV++  I  +  S DT  NA F   + +    K IILV+SAY
Sbjct: 120 ITN-LPEAEVMKNILNELGVDKSMIYTDVNSRDTLGNAFFVKKICEKNGFKRIILVTSAY 178

Query: 184 HLKRSQLYFQHFGINTKASCSDYLN----AYYSIIPLSANFYLTELALKEYIGILIAY 237
           H+ RS + FQ  G++     +D+        YS  P       +  A++EY+G LIAY
Sbjct: 179 HMPRSVIVFQKAGLDVIPYPTDFKMDKRYTVYSYFPKMNVLQDSTKAIREYVG-LIAY 235


>gi|260887636|ref|ZP_05898899.1| putative membrane protein [Selenomonas sputigena ATCC 35185]
 gi|330837998|ref|YP_004412578.1| protein of unknown function DUF218 [Selenomonas sputigena ATCC
           35185]
 gi|260862652|gb|EEX77152.1| putative membrane protein [Selenomonas sputigena ATCC 35185]
 gi|329745762|gb|AEB99118.1| protein of unknown function DUF218 [Selenomonas sputigena ATCC
           35185]
          Length = 252

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 108/229 (47%), Gaps = 28/229 (12%)

Query: 23  IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGT-TIIPT 81
           +   + F LL +++    +  +L+  L+ +Y      P  K +G+++++LG G  +  P 
Sbjct: 42  VLITAVFYLLSTYL----VADVLMGALEDAYM-----PPAKPEGDVVIMLGGGAFSDAPD 92

Query: 82  IP---AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKL 138
           +    A+   PS    +R+   +RL        +   I++SGG   +    E+++    L
Sbjct: 93  VDGEGALTASPS----TRLLTAVRL-----AQKLDLPILVSGGQVFQESGKEALLAKRTL 143

Query: 139 LESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           +  G+    I +E  S +T QNA +++ ++K       ILV+SA+H+KRS L ++  GI 
Sbjct: 144 VSLGIPESRILVEGASQNTVQNAAYTAKILKEHGLVRPILVTSAFHMKRSVLNYEKLGIE 203

Query: 199 TKASCSDYLNAYYSII------PLSANFYLTELALKEYIGILIAYYRGN 241
                +DY+ +++ I       P +   +   + L+E +   + Y  G 
Sbjct: 204 VVPYPTDYMVSHHPIFHVVKLAPSADALHTNAVVLQECLRTAVTYCLGK 252


>gi|288958654|ref|YP_003448995.1| hypothetical protein AZL_018130 [Azospirillum sp. B510]
 gi|288910962|dbj|BAI72451.1| hypothetical protein AZL_018130 [Azospirillum sp. B510]
          Length = 264

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 91/191 (47%), Gaps = 18/191 (9%)

Query: 56  PLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSF-QSYSRIFETMRLYKSCKQHSMHC 114
           P   P+ + DG  I++LG    + P I A R +PS  ++  RI     L    ++H    
Sbjct: 72  PRSEPEGRIDG--IIMLGG--AVNPPITADRGDPSLNEAAERILGFADL---VRRHP-EA 123

Query: 115 TIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
             + +GG  Q     L E +     L ++G+  D +  E +S +T++NA FS  M++   
Sbjct: 124 KAVFTGGSGQLLAPDLKEDVTARAALAQAGIPADRVLYEAESRNTWENAVFSKEMVRPRP 183

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIP-----LSANFYLTELAL 227
           G+  IL++SA H+ RS   F+  G   +    DY    +   P     L  N  + + A+
Sbjct: 184 GERWILITSAMHMPRSVGIFREVGWPVEPYPVDY-RTRHDARPILRFQLDQNLVILDDAV 242

Query: 228 KEYIGILIAYY 238
           +E+IG L AY+
Sbjct: 243 REWIG-LAAYW 252


>gi|83814701|ref|YP_445779.1| hypothetical protein SRU_1660 [Salinibacter ruber DSM 13855]
 gi|83756095|gb|ABC44208.1| Uncharacterized ACR, COG1434 family [Salinibacter ruber DSM 13855]
          Length = 281

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 85/179 (47%), Gaps = 15/179 (8%)

Query: 70  VLLGNGTTIIPTIPAIRIEPSF-QSYSRIFETMRLYKSCKQHSMHCTIIISGG-DPQKHG 127
           V+LG G +  P  P  RI P    +  R++   RLY + K       +I SGG  P K  
Sbjct: 83  VVLGGGVS--PPRPP-RIHPDLNDAADRVWHAARLYHAGKVP----LVIASGGTQPWKRP 135

Query: 128 LAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLK 186
            A      N LL+  GV  D I LE++S +T++NA  ++ ++       ++LV+SA H+ 
Sbjct: 136 DAREAPATNVLLQDWGVPGDAILLESKSANTYENATRTAELLDRRGLNCVLLVTSALHMP 195

Query: 187 RSQLYFQHFGIN-----TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           R+   F+  GI      T     D       ++P +     +  A++EY+G L+  +RG
Sbjct: 196 RALAVFRSAGIKAVPAPTDVQVGDRNYTVLDVLPDAGALAGSTAAIREYVGYLVYDWRG 254


>gi|281418736|ref|ZP_06249755.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
 gi|281407820|gb|EFB38079.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
          Length = 251

 Score = 72.0 bits (175), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 88/183 (48%), Gaps = 15/183 (8%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS--RIFETMRLYKSCKQHSMHCTII 117
           P  + +G++I++LG G       P +  +    S +  R+   ++LY     + +   II
Sbjct: 71  PPSELNGDVIIMLGGGA--FADTPNVNGKGHLSSIAANRLLTCVQLY-----YKLDVPII 123

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ISGG    H  +E  +  N LL  GV  + I +E +SL+T QNA ++  ++        I
Sbjct: 124 ISGGQIPGHTTSEGEIARNILLSLGVPEEKIIVENRSLNTTQNAFYTKELLDKHGFNKPI 183

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLN------AYYSIIPLSANFYLTELALKEYI 231
           LV+SA+H+KR+   F+   +N     +DY         +   +P +        ++KEY+
Sbjct: 184 LVTSAFHMKRAVKQFEKNEVNVIPYPTDYQTNSIRKITFMDFVPSAEALQKFYFSVKEYV 243

Query: 232 GIL 234
           GI+
Sbjct: 244 GIV 246


>gi|75906624|ref|YP_320920.1| hypothetical protein Ava_0399 [Anabaena variabilis ATCC 29413]
 gi|75700349|gb|ABA20025.1| Protein of unknown function DUF218 [Anabaena variabilis ATCC 29413]
          Length = 263

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 98/212 (46%), Gaps = 26/212 (12%)

Query: 47  KHLQFSYQRPLLSPQWKKDGNIIVLLGNGT-TIIPTIPAIRIEPSF-QSYSRIFETMRLY 104
           K+L  S +   L P    +   I++LG  T ++ P     RI P   +   R+    +LY
Sbjct: 58  KYLVRSLEWQNLPPAQLPNAEAIIVLGGATKSVFPP----RITPDLSEQGDRVIYAAQLY 113

Query: 105 KSCKQHSMHCTIIISGG--DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
           +  K       II+SGG  D +  G +ES    N L   G+    +  E  SL+T+QNA 
Sbjct: 114 RQNKAP----LIILSGGRIDWRGSGSSESTDMANILTSLGIPASVLIEEPDSLNTYQNAV 169

Query: 163 FSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL--------------N 208
               ++ +     ++LV+SA H+ RS   FQ  G+N   + +D+L               
Sbjct: 170 NVKKILASRGIDKVLLVTSALHMPRSLKIFQRQGMNVIPAPTDFLVSAGELQELGNTPKA 229

Query: 209 AYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           A  +++P + N +L   ALKEY+G  I + RG
Sbjct: 230 AILNLLPDTYNLHLFTNALKEYVGSFIYWLRG 261


>gi|149925438|ref|ZP_01913702.1| Uncharacterized ACR, COG1434 family protein [Limnobacter sp.
           MED105]
 gi|149825555|gb|EDM84763.1| Uncharacterized ACR, COG1434 family protein [Limnobacter sp.
           MED105]
          Length = 274

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 89/178 (50%), Gaps = 19/178 (10%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSF-QSYSRIFETMRLYKSCKQHSMHCTIIISGG---- 121
           + IV+LG G  +      +R  P    +  R+++  RLYK      +   I++SGG    
Sbjct: 92  DAIVVLGGG--LEGRFDGVRALPDLNDAGDRVWQGARLYK----QGVATRIVLSGGQFQT 145

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
           DP+K   AE+      +L+ GV  D + +E  S  TF+NA  +  ++   + ++I LV+S
Sbjct: 146 DPRKE--AEAPGMKMFMLDMGVPEDALVIEDNSRTTFENAVRTRELLGE-RARSIALVTS 202

Query: 182 AYHLKRSQLYFQHFG-----INTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           A+H+ RS L+F+  G     + T     +   A++  +P       + +A+KEY+G L
Sbjct: 203 AFHMGRSVLWFEKAGFTVYPVRTDIRVLNESRAFWEWLPKPQALDESTVAIKEYLGRL 260


>gi|145299198|ref|YP_001142039.1| integral membrane protein [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142851970|gb|ABO90291.1| integral membrane protein [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 256

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 104/231 (45%), Gaps = 30/231 (12%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIP 83
              +C +++ + +G   +   L + L+ ++  P        D   IV+LGNG    P IP
Sbjct: 40  LLATCSLVIVALMGMRPVSYELARGLEQTF--PPFEISQHPDIEAIVVLGNGHVSDPAIP 97

Query: 84  AIRIEPSFQ---SYSRIFETMRLYKSCKQHSMHCTIIISG---GDPQKHGLAESIVYNNK 137
               E ++Q   + +R  E +RL  +  Q     T++ SG   GDP    L+ + V    
Sbjct: 98  ----ERAWQNNIALARTLEGVRLALAYPQ----ATLVFSGYVSGDP----LSNAEVNARM 145

Query: 138 LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
               G+ER  + L   + DT   A    S+ + ++GK + LVSSA HL R+   +Q  G+
Sbjct: 146 AASLGIERSRMTLFENNQDTHDEA---VSISRYLKGKQVALVSSATHLPRAMALYQGQGL 202

Query: 198 NTKASCSDY-------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
           +   + +DY           YS +P       +E A+ E+IG+  A  RG 
Sbjct: 203 DAVPAPTDYTAKQSQVAQPLYSYLPKGRYLMYSEAAIHEWIGVWWARLRGQ 253


>gi|186681117|ref|YP_001864313.1| hypothetical protein Npun_F0616 [Nostoc punctiforme PCC 73102]
 gi|186463569|gb|ACC79370.1| protein of unknown function DUF218 [Nostoc punctiforme PCC 73102]
          Length = 263

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 115/254 (45%), Gaps = 29/254 (11%)

Query: 3   LSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQW 62
           +S +  +V+ W     +   I F +  +LLF    W  I   L++ L++    PL   Q 
Sbjct: 21  VSLVVALVTLWKRPRTAAIAIAF-ALTLLLFCSNAW--IAKSLVRSLEWQ-NLPLA--QI 74

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG- 121
                I+VL G   +  P  P + +    +S  R+    +LY+  +       II+SGG 
Sbjct: 75  PVAEAIVVLGGATKSAFPPRPTVDLS---ESGDRVIYAAQLYRQKRAP----IIILSGGR 127

Query: 122 -DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
            D +  G  ES      L   G+  + I  E +SL+T+QNA     ++++     ++LV+
Sbjct: 128 IDWRGGGSPESADMATILTSIGIPSEAIVQEPESLNTYQNAVNVRKILESRGINQVLLVT 187

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYL--------------NAYYSIIPLSANFYLTELA 226
           SA H+ RS   FQ  GIN   + +D+L               A  +++P + N +    A
Sbjct: 188 SAMHMPRSLNIFQRQGINVIPAPTDFLVSQGELQELGGTPKAAILNLLPDTDNLHQFTSA 247

Query: 227 LKEYIGILIAYYRG 240
           LKEYIG LI   RG
Sbjct: 248 LKEYIGSLIYRLRG 261


>gi|90424829|ref|YP_533199.1| hypothetical protein RPC_3338 [Rhodopseudomonas palustris BisB18]
 gi|90106843|gb|ABD88880.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB18]
          Length = 264

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 94/195 (48%), Gaps = 20/195 (10%)

Query: 60  PQWKKDG----NIIVLLGNGTTIIPTIP-AIRIEPSFQSYSRIFETMRLYKSCKQHSMHC 114
           P W+ DG     +IVL G+    + T   A+ ++ S +    + +  R +   +      
Sbjct: 70  PAWQADGRAPDGVIVLGGSIDAEVSTARNALELDASAERIVVMLQLARRFPDAR------ 123

Query: 115 TIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
            I+ SGG     +  +AE+ +    L   G+  + I LE +S  T +NA F+ +++    
Sbjct: 124 -IVFSGGSANLLQAPVAEAPIAGRLLHSFGIAPERIVLEDRSRTTAENAAFTRALVTPAA 182

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSD-----YLNAYYSIIPLSANFYLTELAL 227
           G+  +LV+SA+H+ RS   F+  G + +A   D     +++A      LSA    T++A+
Sbjct: 183 GERWLLVTSAFHMPRSIAAFRAVGFDVEAYPVDWRTRGWIDAAMPFDRLSAGLARTDVAV 242

Query: 228 KEYIGILIAYYRGNR 242
            E++G LIAY    R
Sbjct: 243 HEWVG-LIAYRLAGR 256


>gi|125974798|ref|YP_001038708.1| hypothetical protein Cthe_2313 [Clostridium thermocellum ATCC
           27405]
 gi|256004933|ref|ZP_05429906.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|125715023|gb|ABN53515.1| protein of unknown function DUF218 [Clostridium thermocellum ATCC
           27405]
 gi|255991113|gb|EEU01222.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|316941930|gb|ADU75964.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           1313]
          Length = 251

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 88/183 (48%), Gaps = 15/183 (8%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS--RIFETMRLYKSCKQHSMHCTII 117
           P  + +G++I++LG G       P +  +    S +  R+   ++LY     + +   II
Sbjct: 71  PPSELNGDVIIMLGGGA--FADTPNVNGKGHLSSIAANRLLTCVQLY-----YKLDVPII 123

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ISGG    H  +E  +  N LL  GV  + I +E +SL+T QNA ++  ++        I
Sbjct: 124 ISGGQIPGHTTSEGEIAMNILLSLGVPEEKIIVENRSLNTTQNAFYTKELLDKHGFNKPI 183

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLN------AYYSIIPLSANFYLTELALKEYI 231
           LV+SA+H+KR+   F+   +N     +DY         +   +P +        ++KEY+
Sbjct: 184 LVTSAFHMKRAVKQFEKNEVNVIPYPTDYQTNSIRKITFMDFVPSAEALQKFYFSVKEYV 243

Query: 232 GIL 234
           GI+
Sbjct: 244 GIV 246


>gi|218437457|ref|YP_002375786.1| hypothetical protein PCC7424_0452 [Cyanothece sp. PCC 7424]
 gi|218170185|gb|ACK68918.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7424]
          Length = 260

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 86/183 (46%), Gaps = 22/183 (12%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG--DPQKH 126
           IVLLG G T  P  P   ++ S Q   R+    +LY   K       II SGG  D   +
Sbjct: 79  IVLLG-GATKPPAYPRPMVDMSEQG-DRVLYAAKLYLDQKAP----LIIASGGRIDWLSN 132

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLK 186
             +ES    N L   GV    I  E  SL+T++NA     +++    K ++LV+SA H+ 
Sbjct: 133 EQSESADMANLLQLMGVPPQVIIQEPDSLNTYENATNVKKILQEKGIKQVLLVTSALHMP 192

Query: 187 RSQLYFQHFGINTKASCSDYL--------------NAYYSIIPLSANFYLTELALKEYIG 232
           RS   F+  GI+  A+ +D+L                  +I+P S N   T  ALKEYIG
Sbjct: 193 RSLFIFKKLGIDVIAAPTDFLVSRTELEPNNLTLEGIILNILPSSENLDRTTKALKEYIG 252

Query: 233 ILI 235
           +L+
Sbjct: 253 LLV 255


>gi|260459193|ref|ZP_05807448.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
 gi|259034747|gb|EEW36003.1| protein of unknown function DUF218 [Mesorhizobium opportunistum
           WSM2075]
          Length = 265

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 104/219 (47%), Gaps = 17/219 (7%)

Query: 31  LLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPS 90
           L+ +   W  +  ++L  L+  + RP L PQ K DG  IV+LG G      +     E S
Sbjct: 47  LILALSAWTSLGAMMLNPLEERFARPPL-PQ-KVDG--IVVLGGGFEGAINLTRGGYELS 102

Query: 91  FQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQK--HGLAESIVYNNKLLESGVERDDI 148
             S  R+ ET  L +   Q      +++SGG+      G  ++      L   GV  D +
Sbjct: 103 -SSGDRMVETAILARRFPQ----AKVVVSGGNGSLFLDGEGDADTAPRLLGPLGVSADRL 157

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
            LE +S +T++NA FS  +++   G+  +LV+SA+H+ R++  F   G  T     DY  
Sbjct: 158 VLEDKSRNTYENAVFSRKLVEPKPGETWLLVTSAFHMPRAKALFDKAGFPTVPWPVDYRT 217

Query: 209 AYYSIIPL-----SANFYLTELALKEYIGILIAYYRGNR 242
           +    + L     + +   T +A++E+IG L AY+   R
Sbjct: 218 SGKEGVGLFRDNAADSLENTTMAIREWIG-LFAYWLSGR 255


>gi|308274760|emb|CBX31359.1| hypothetical protein N47_E48710 [uncultured Desulfobacterium sp.]
          Length = 254

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 112/251 (44%), Gaps = 32/251 (12%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFS-----FIGWGIIPTILLKHLQFSYQRPLLSP 60
           +FL+   + LL +   K   MS  +++F      FI + I P  +L +L+  YQ PL+  
Sbjct: 20  LFLVCGVFFLLLKKKEK---MSKSIIVFGVISLVFISFNIFPDKILGYLEHKYQ-PLIHI 75

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEP----SFQSYSRIFETMRLYKSCKQHSMHCTI 116
           +   D   IV+LG G         + ++P    +  S  R+ E + ++    +      I
Sbjct: 76  KLISDARWIVVLGGGCK-----GDLMLDPISRLTSDSLFRVVEGISIHNKIPE----SKI 126

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI 176
           I SGG      ++ES    +  L  GV +D I  E++  DT   A     ++ N      
Sbjct: 127 IFSGGSVFST-ISESEAMADVALALGVNKDKIVEESEGPDTEAQALLIKKIVGN---DKF 182

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSII------PLSANFYLTELALKEY 230
           ILV+SA+H+ RS   F   G++  A+ + YL      I      P SA     ELA+ EY
Sbjct: 183 ILVTSAFHMPRSMAVFNKAGMHPIAAPAGYLVKKRKNINLLLFFPKSAEIKKMELAVHEY 242

Query: 231 IGILIAYYRGN 241
           +G+  A  RG 
Sbjct: 243 LGLFWAKIRGR 253


>gi|160902984|ref|YP_001568565.1| hypothetical protein Pmob_1541 [Petrotoga mobilis SJ95]
 gi|160360628|gb|ABX32242.1| protein of unknown function DUF218 [Petrotoga mobilis SJ95]
          Length = 214

 Score = 69.7 bits (169), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 95/178 (53%), Gaps = 14/178 (7%)

Query: 64  KDGNIIVLLGNGTTIIPTIP-AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           ++  +IV+LG G  IIP  P     E S  +  R++E   LYK+     +   I+++GG 
Sbjct: 38  QEKGVIVVLGGG--IIPETPREGSGELSDSAMKRVYEGFLLYKN-----LQIPIVVTGGK 90

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA 182
                + E+ +   +LL+ GV+ +DI +E  + +T QNA+F+ +++++ + + I L++SA
Sbjct: 91  LLGTEIPEAQIMKEELLKMGVKPNDIYVEPLAKNTKQNAEFTLTLLESDEVQKIYLITSA 150

Query: 183 YHLKRSQLYFQHF-GINTKASCSDYLNA-----YYSIIPLSANFYLTELALKEYIGIL 234
            HL R+  YF+ +  I+     +DY  +     +Y  +P       T  A  EY+G++
Sbjct: 151 IHLPRAMNYFKSYTNIDVVPVPTDYKISREELKWYDFLPDMRFLEATSSAWHEYLGLV 208


>gi|183220138|ref|YP_001838134.1| hypothetical protein LEPBI_I0726 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910258|ref|YP_001961813.1| hypothetical protein LBF_0703 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167774934|gb|ABZ93235.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167778560|gb|ABZ96858.1| Conserved hypothetical protein; putative membrane protein
           [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
          Length = 258

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 108/226 (47%), Gaps = 28/226 (12%)

Query: 23  IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTI 82
           +FF+ C  L  +      I   L+  L+  Y  P +S Q     ++ ++LG    +I TI
Sbjct: 41  LFFIICLFLYLA--SSSFIANRLVTELEKEY--PPVSLQDAPKVDVAIVLGG---MIQTI 93

Query: 83  PAIRIEPSF-QSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNK---- 137
            +++  P    S  RI + +RLYK+ K       I+ +GG     GL  S  Y       
Sbjct: 94  SSVKARPELTDSADRITDAIRLYKAGKVKK----ILFTGG----SGLLLSDTYREADLAK 145

Query: 138 --LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHF 195
              ++ GV+ +DI LE  S +T +NA  +  ++     ++ +L++SA+H+KRS   FQ  
Sbjct: 146 SLFIDLGVKEEDIILENNSRNTHENAVETKKILMEKNFQSFLLITSAFHMKRSLGCFQKQ 205

Query: 196 GINTKASCSDYLN------AYYSIIPLSANFYLTELALKEYIGILI 235
            +N     +DY +      A+   +P +    LT L++KE++G  +
Sbjct: 206 NLNVFPFPTDYRSFNTDSGAFELYLPSAGYLDLTTLSIKEWVGYFV 251


>gi|17229959|ref|NP_486507.1| hypothetical protein alr2467 [Nostoc sp. PCC 7120]
 gi|17131559|dbj|BAB74166.1| alr2467 [Nostoc sp. PCC 7120]
          Length = 263

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 89/190 (46%), Gaps = 25/190 (13%)

Query: 68  IIVLLGNGTTIIPTIPAIRIEPSF-QSYSRIFETMRLYKSCKQHSMHCTIIISGG--DPQ 124
           IIVL G   ++ P     RI P   +   R+    +LY+  K       II+SGG  D +
Sbjct: 80  IIVLGGATKSVFPP----RITPDLSEQGDRVIYAAQLYRQNKAP----LIILSGGRIDWR 131

Query: 125 KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYH 184
             G +ES    N L   G+    +  E  SL+T+QNA     ++ +     ++LV+SA H
Sbjct: 132 GSGSSESTDMANILTSLGIPASVLIEEPDSLNTYQNAVNVKKILVSRGIDQVLLVTSALH 191

Query: 185 LKRSQLYFQHFGINTKASCSDYL--------------NAYYSIIPLSANFYLTELALKEY 230
           + RS   FQ  G+N   + +D+L               A  +++P + N +L   ALKEY
Sbjct: 192 MPRSLKIFQRQGMNVIPAPTDFLVSEGELQELGNTPKAAILNLLPDTYNLHLFTNALKEY 251

Query: 231 IGILIAYYRG 240
           +G  + + RG
Sbjct: 252 VGSFVYWLRG 261


>gi|117619411|ref|YP_856904.1| integral membrane protein [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117560818|gb|ABK37766.1| integral membrane protein [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 259

 Score = 69.3 bits (168), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 89/189 (47%), Gaps = 28/189 (14%)

Query: 65  DGNIIVLLGNGTTIIPTIPAIRIEPSFQ---SYSRIFETMRLYKSCKQHSMHCTIIISG- 120
           D   IV+LGNG    P +P    E S+Q   + +R  E +RL ++  Q      +I SG 
Sbjct: 82  DIEAIVVLGNGHVSDPAVP----ERSWQNNIALARTLEGVRLAQAYPQ----AELIFSGY 133

Query: 121 --GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
             GDP    L+ + V     +  G+ R  + L   + DT   A    S+ ++++GK + L
Sbjct: 134 VSGDP----LSNAEVNARMAVSLGIPRSRMTLFENNKDTHDEA---VSISRHLKGKRVAL 186

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDY-------LNAYYSIIPLSANFYLTELALKEYI 231
           VSSA HL R+   +Q  G+N   + ++Y           YS +P       +E A+ E+I
Sbjct: 187 VSSATHLPRAMALYQGQGLNAVPAPTNYTAKQSQVAQPLYSYLPKGRYLMYSEAAIHEWI 246

Query: 232 GILIAYYRG 240
           G+  A  RG
Sbjct: 247 GVWWARLRG 255


>gi|254412764|ref|ZP_05026537.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
 gi|196180499|gb|EDX75490.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
          Length = 263

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 105/232 (45%), Gaps = 30/232 (12%)

Query: 26  MSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGT-TIIPTIPA 84
           +   +LL +  GW  +   +++ L++ +  P   PQ       IV+LG  T + IP  PA
Sbjct: 43  LGLIILLVASNGW--VANSMVQSLEWQHIPPTELPQ----AEAIVILGGATRSAIPPRPA 96

Query: 85  IRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG--DPQKHGLAESIVYNNKLLESG 142
             +    ++  R+F   +LY+  K       II SGG  + +  G  ES      L   G
Sbjct: 97  PDLN---EAGDRVFYGAQLYQQGK----APVIIASGGRIEWRGGGSPESADMAQILEMIG 149

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
           V    I  +  SL+T QNA     +++    K ++LV+SA H  R+   FQ  GI    +
Sbjct: 150 VPPSAILQDPASLNTHQNAVNVRRILQQEGIKKVLLVTSAMHTPRALRVFQRQGIEAIPA 209

Query: 203 CSDYL---------NAYYSII-----PLSANFYLTELALKEYIGILIAYYRG 240
            +D+L         N+  + I     P + N  +T  A+KEYIG  + + RG
Sbjct: 210 PTDFLVTQQELNEPNSSLAAILLNGLPDAQNLDMTTRAIKEYIGTAVYWLRG 261


>gi|187776701|ref|ZP_02993174.1| hypothetical protein CLOSPO_00216 [Clostridium sporogenes ATCC
           15579]
 gi|187775360|gb|EDU39162.1| hypothetical protein CLOSPO_00216 [Clostridium sporogenes ATCC
           15579]
          Length = 324

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 19/154 (12%)

Query: 86  RIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVER 145
           R+ P  +   R+ + +R+Y  C+QH     I++SGG      ++E+    N L+E+G   
Sbjct: 168 RVSPLLKG--RVDKAVRIYHKCRQHP---KIVVSGGKGDDEKISEAAAMKNYLVETGFPE 222

Query: 146 DDIKLETQSLDTFQNAQFSSSMIK-NMQGKNIILVSSAYHLKRSQLYFQHFGINTKA-SC 203
           +DI LE QS  TF+N +    M+  N      I V++ YH+ R+ LY +   I      C
Sbjct: 223 EDIILEEQSKTTFENLKNVRDMLDVNGVKHRYIFVTNNYHVFRTSLYAKKLKIKASGVGC 282

Query: 204 SDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
                        +A +Y     ++EYI I+  Y
Sbjct: 283 G------------TAAYYWPSAFIREYIAIMFRY 304


>gi|209884886|ref|YP_002288743.1| hypothetical protein OCAR_5752 [Oligotropha carboxidovorans OM5]
 gi|209873082|gb|ACI92878.1| protein of unknown function [Oligotropha carboxidovorans OM5]
          Length = 264

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 87/193 (45%), Gaps = 16/193 (8%)

Query: 60  PQWKKDGNI---IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTI 116
           P W  DG     IV+LG    I P + A R      + +   E M       +   +  I
Sbjct: 70  PAWHDDGRAPDGIVVLGG--AISPDLTAERGTAELNASA---ERMTAAAELARRFPNAKI 124

Query: 117 IISGGDPQK-HGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK 174
           ++SGG+    H L+        LLE+ GV  D I  E +S +T++NA F+  ++K   G+
Sbjct: 125 VLSGGNANVFHPLSTEAEVGRVLLENLGVAADRIVREDRSRNTYENAIFTRDVVKPKPGE 184

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKA-----SCSDYLNAYYSIIPLSANFYLTELALKE 229
             +LV+SAYH+ R+   F+      +A       S +  A    + LSA     + A +E
Sbjct: 185 RWLLVTSAYHMPRAIGVFRAANFPVEAYPIDWRTSGWKEAGRPFLKLSAGLARLDTAARE 244

Query: 230 YIGILIAYYRGNR 242
           ++G LI Y    R
Sbjct: 245 WVG-LIGYRLAGR 256


>gi|254423832|ref|ZP_05037550.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
 gi|196191321|gb|EDX86285.1| conserved hypothetical protein [Synechococcus sp. PCC 7335]
          Length = 263

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 102/235 (43%), Gaps = 35/235 (14%)

Query: 26  MSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAI 85
           ++ F+L FS     I+   LL  L++ Y  P   P      + IV+LG  T     +PAI
Sbjct: 42  LALFILFFS--SNPIVSNKLLSSLEWRYFPPDPVPT----ADAIVVLGGAT-----VPAI 90

Query: 86  RIEPSFQ---SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ-KHGLAESIVYNNKL--L 139
              P  +   +  RI    RLY   +   +    I+SGG  Q + G  ES   + K   +
Sbjct: 91  APRPWVEVSEAGDRILYAARLYNQGRAPKL----ILSGGRVQWRGGSDESEADDMKAFAM 146

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
              V   DI LE  SL+T QNA     ++      +++LV+SA H+ RS   FQ   I+ 
Sbjct: 147 AMNVPEADIILEETSLNTRQNAVNVKKILAAQSIDSVLLVTSAVHMPRSVAIFQKLDIDV 206

Query: 200 KASCSDYL--------------NAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
             + +DYL                  S++P +        A+KEY+G +I   RG
Sbjct: 207 IPAPTDYLVTTPSDESGEITIEGRILSLLPRAEATGRFTRAMKEYVGFVIYRLRG 261


>gi|119945885|ref|YP_943565.1| hypothetical protein Ping_2225 [Psychromonas ingrahamii 37]
 gi|119864489|gb|ABM03966.1| hypothetical protein DUF218 [Psychromonas ingrahamii 37]
          Length = 254

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 111/227 (48%), Gaps = 26/227 (11%)

Query: 18  QSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTT 77
           Q + K   +  F+LLF  + +  +   L++ L+  Y  P++ P   ++   I++LG+G  
Sbjct: 36  QKLAKFNLLVSFILLF-LLSFMPVSEQLVQPLERQYP-PVMQP--AQNFKYILVLGSGGI 91

Query: 78  IIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG---DPQKHGLAESIVY 134
             P++P +  + S  + SR  E +RLY +      + T+++SGG   D + H L    + 
Sbjct: 92  ADPSLP-VTGQLSAVALSRFVEALRLYHANP----NATLVVSGGNFGDIKSHAL----LM 142

Query: 135 NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQH 194
               +   + +D+I     +LDT   A+  S +IK   G++ +LV+SA H+ RS   F+ 
Sbjct: 143 QELAMAMNIPKDNIIRLDNTLDTDDEAKQMSKIIK---GQSAVLVTSATHMPRSMGLFKQ 199

Query: 195 FGINTKASCSDYL-------NAYYSIIPLSANFYLTELALKEYIGIL 234
           +      + +DYL         YY  IP S     T++A  EY+G L
Sbjct: 200 YNAFPTPAPADYLAKKREGETPYYYYIPSSNYLDKTKVAWHEYLGKL 246


>gi|319790359|ref|YP_004151992.1| protein of unknown function DUF218 [Thermovibrio ammonificans HB-1]
 gi|317114861|gb|ADU97351.1| protein of unknown function DUF218 [Thermovibrio ammonificans HB-1]
          Length = 261

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 96/197 (48%), Gaps = 22/197 (11%)

Query: 44  ILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAI--RIEPSFQSYSRIFETM 101
           + LK L+ +Y  P LS     +   IV+LG G  I+P  PA   R     Q   R+ E  
Sbjct: 59  LTLKPLEDAYPYPKLS---SLNCTYIVVLGGG--IVPHSPAAGGRATVRPQVAKRLLEAW 113

Query: 102 RLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNA 161
           +L++  K+      I+ +GG    +  +E+ V    L   GV    IK+E +S  TF+NA
Sbjct: 114 KLWRVLKK-----PIVATGGVLYPNVESEAAVMARFLEGLGVPASQIKVEGKSRTTFENA 168

Query: 162 QFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-LNA----YYSIIPL 216
           +F+  +I     ++I LV+SAYH+ RS   F+ FG       +DY +N     + S +P+
Sbjct: 169 EFTYRLIGP---QSICLVTSAYHMPRSVRIFKSFGFKVTPVPTDYRVNRAGYNWLSFMPI 225

Query: 217 SANFYLTELALKEYIGI 233
                 T    +E++GI
Sbjct: 226 YG--VDTYFGFREWVGI 240


>gi|167629577|ref|YP_001680076.1| hypothetical protein HM1_1492 [Heliobacterium modesticaldum Ice1]
 gi|167592317|gb|ABZ84065.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 252

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 104/216 (48%), Gaps = 21/216 (9%)

Query: 26  MSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTI-IPTIPA 84
           M+  + LFS    G     +++ L+  Y      P  K  G++I++LG G T+  P I  
Sbjct: 46  MALLLYLFSISAVG---ETMIRSLENRYL-----PPDKPSGDVIIMLGGGATMDTPDIDG 97

Query: 85  IRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVE 144
           +  + +  S +R+    RL++          II+S G   ++   ES +   +L   GV 
Sbjct: 98  LG-QMTGGSANRLLTAARLHQLTG-----APIIVSAGQVFENSGNESRIAFRQLTGLGVP 151

Query: 145 RDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
              I +E  S +T +NA+++  ++        ILV+SA+H++RS  +F   G++T    +
Sbjct: 152 ESMIIVEEMSRNTEENARYTKEILDARGFHKPILVTSAFHMERSVGHFSKLGVSTLPFPT 211

Query: 205 DY---LNAYYSI---IPLSANFYLTELALKEYIGIL 234
           DY     A YS+    P +       LA+KEY+G++
Sbjct: 212 DYRVNRQARYSLNDWAPSAVAMSNASLAMKEYLGLI 247


>gi|217077219|ref|YP_002334937.1| hypothetical protein THA_1144 [Thermosipho africanus TCF52B]
 gi|217037074|gb|ACJ75596.1| conserved hypothetical protein [Thermosipho africanus TCF52B]
          Length = 241

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 85/173 (49%), Gaps = 15/173 (8%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           ++IV+LG G T        + E    +  R+ +   +Y+       +  IIISGG   K 
Sbjct: 76  SVIVILGGGITFFDG----KYEVGNHTLKRLLKGFEIYRKT-----NAPIIISGGVIGK- 125

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLK 186
           G++ES +  + L+  GV  +DI +E ++  T +NA F S ++K    +NIILV+S  H+K
Sbjct: 126 GISESAIMKDILVTFGVNINDIIVEDKARTTKENAIFVSKLLKGKNFENIILVTSFLHMK 185

Query: 187 RSQLYFQHFGINT--KASCS---DYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           RS + F+ +         C    D+ N++   +P +   Y       E+ GIL
Sbjct: 186 RSIMLFEKYSKKNIIPIVCDYPIDFRNSFLDYLPSAEALYTFSQITHEFFGIL 238


>gi|325524364|gb|EGD02455.1| hypothetical protein B1M_21433 [Burkholderia sp. TJI49]
          Length = 138

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 71/141 (50%), Gaps = 13/141 (9%)

Query: 4   SWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFI--GWGIIPTILLKHLQFSYQRPLLSPQ 61
           S++ L + +  +L +  R++  ++  + LF  +  GW   P I       +   P+  P 
Sbjct: 6   SFVLLFIGF--MLFRKWRRLIALAA-VALFGLLATGWLAAPLIAWAEAGVA---PVARPD 59

Query: 62  WKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
                 +IV+ G GT    T     + P     +RI +T  LY++C+Q +  CT+++SGG
Sbjct: 60  MHGQTTLIVI-GAGTRRTDT----GLRPPPDGDARIRKTAALYRACRQQAQRCTVVMSGG 114

Query: 122 DPQKHGLAESIVYNNKLLESG 142
           DPQ HG  E+ VY  +L+ +G
Sbjct: 115 DPQHHGETEAAVYGRQLVAAG 135


>gi|319783692|ref|YP_004143168.1| hypothetical protein Mesci_4004 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169580|gb|ADV13118.1| protein of unknown function DUF218 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 263

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 102/219 (46%), Gaps = 17/219 (7%)

Query: 31  LLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPS 90
           L+ +   W  +  ++L  L+  +QRP L P+ K DG  IV+LG G      +     E +
Sbjct: 47  LILALSAWTSLGAMMLNPLEERFQRPPL-PE-KVDG--IVVLGGGFEGAINLARGGYELN 102

Query: 91  FQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQK--HGLAESIVYNNKLLESGVERDDI 148
             S  R+ ET  L +          +++SGG       G  ++      L   GV  D +
Sbjct: 103 -SSGDRMVETAILARRFPT----AKVVVSGGTGALFLDGEGDAATAPRLLTALGVAADRM 157

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
            LE +S +T++NA F+  ++    G+  +LV+SA+H+ R++  F   G  T     DY  
Sbjct: 158 ILENKSRNTYENAVFTKELVTPKPGETWLLVTSAFHMPRAKALFDKAGFATVPWPVDYRT 217

Query: 209 AYYSIIPL-----SANFYLTELALKEYIGILIAYYRGNR 242
           +    + L     + +   T +A++E+IG L AY+   R
Sbjct: 218 SGREGVGLFRDNPADSLQATTMAIREWIG-LFAYWLSGR 255


>gi|255524874|ref|ZP_05391823.1| protein of unknown function DUF218 [Clostridium carboxidivorans P7]
 gi|255511444|gb|EET87735.1| protein of unknown function DUF218 [Clostridium carboxidivorans P7]
          Length = 327

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 72/154 (46%), Gaps = 19/154 (12%)

Query: 86  RIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVER 145
           R+ P  +   R+ + + +Y  C+QH+    I++SGG      ++E+    N L+E+G   
Sbjct: 171 RVSPLLKG--RVDKAVHIYHKCRQHT---KIVVSGGKGDDEKISEAAAMKNYLVETGFPE 225

Query: 146 DDIKLETQSLDTFQNAQFSSSMIK-NMQGKNIILVSSAYHLKRSQLYFQHFGINTKA-SC 203
           DDI LE QS  TF+N +    M+  N      I V++ YH+ R+ LY +   +      C
Sbjct: 226 DDIILEEQSKTTFENLKNVKDMLDVNGVKHRYIFVTNNYHVFRTSLYAKKLKMKASGVGC 285

Query: 204 SDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
                        +A +Y     ++EYI I+  Y
Sbjct: 286 G------------TAAYYWPSAFIREYIAIMFRY 307


>gi|325295248|ref|YP_004281762.1| hypothetical protein Dester_1066 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065696|gb|ADY73703.1| protein of unknown function DUF218 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 272

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 86/181 (47%), Gaps = 13/181 (7%)

Query: 65  DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
           D   IV+LG G         ++     Q   R++   +++K  K+      I++SGG   
Sbjct: 77  DCKAIVVLGGGEIFHSPAEGMKAAVKPQVAKRLYTAFKIWKKVKK-----PIVVSGGKVF 131

Query: 125 KHGL-AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
              + AES      L+  G+   +I  E++S +TFQN  F+  ++     K I LV+SAY
Sbjct: 132 NENVEAESSAMKRFLISLGIPNKEIIEESKSKNTFQNGIFTYKILNKKGIKKICLVTSAY 191

Query: 184 HLKRSQLYFQHFGINTKASCSDY-LN----AYYSIIPLSANFYLTELALKEYIGILIAYY 238
           H+ RS   F+  G +     +DY +N    ++ S  P   + Y + L + EY+G  IAY+
Sbjct: 192 HMPRSYRIFKSIGFSVIPVPADYRVNRGSYSWSSYFPRMEDLYDSFLGIHEYVG--IAYF 249

Query: 239 R 239
            
Sbjct: 250 E 250


>gi|45656706|ref|YP_000792.1| hypothetical protein LIC10815 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|294828296|ref|NP_713526.2| hypothetical protein LA_3345 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45599942|gb|AAS69429.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|293386147|gb|AAN50544.2| conserved hypothetical protein [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 258

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 105/206 (50%), Gaps = 23/206 (11%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPS--FQSYSRIFETMR 102
           L++ L+  Y  P +S +     ++I++LG   + +    +I  EP   F S  R+ ET+R
Sbjct: 63  LIQSLEMYY--PPVSLEQLPKADVILVLGGMVSTL----SIHDEPVDLFNSAERLTETVR 116

Query: 103 LYKSCKQHSMHCTIIISGGDPQK--HGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
           LY++ K       I+ SGG        + ES      L + G+    + LE++S +T +N
Sbjct: 117 LYRAKKAPK----ILFSGGSGNLFYQTVPESEPAGRFLKQMGIPDSSLILESKSRNTAEN 172

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANF 220
             F+  ++K     ++ILV+S++H+KRS   FQ  GI      +D+  +  S++ L  NF
Sbjct: 173 KSFAVGLLKEHGWNSVILVTSSFHMKRSVEIFQENGITIIPFPTDF-RSQKSVLTLD-NF 230

Query: 221 YL-------TELALKEYIGILIAYYR 239
           +        + +++KE+IGIL+   R
Sbjct: 231 FPSTGCLENSTISIKEWIGILVHKIR 256


>gi|158335605|ref|YP_001516777.1| hypothetical protein AM1_2455 [Acaryochloris marina MBIC11017]
 gi|158305846|gb|ABW27463.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
          Length = 261

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 107/233 (45%), Gaps = 34/233 (14%)

Query: 26  MSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGN---IIVLLGNGTTIIPTI 82
           ++  +L FS  GW  +   LL  L+  Y      P  K+D     I+VL G   +  P  
Sbjct: 43  LALGILFFSANGW--VGDGLLYSLEHQY------PPLKQDATADAIVVLGGCTRSAHPPR 94

Query: 83  PAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP--QKHGLAESIVYNNKLLE 140
           P + +    ++  R+    +LY+  K       ++++GG    +  G AE++     L  
Sbjct: 95  PWVEVS---EAGDRVLYAAKLYREGKAPK----VVLAGGRIYWKGGGQAEALDMAELLKI 147

Query: 141 SGVERDDIKLETQSLDTFQNAQFSSSMIK--NMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
            GV    + LE  SL+TF+NA     ++K  N+ G  ++LV+SA+H+ RS   F+  G++
Sbjct: 148 MGVPESALLLEPDSLNTFENATNVKRVLKQNNIDGP-LLLVTSAFHMPRSMAIFETQGLS 206

Query: 199 TKASCSDY-----------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
             A+ +DY           L     ++P       T +A KE+IG L+   RG
Sbjct: 207 VIAAPTDYQVTEVNENAGFLGFVLRLLPDIEALVNTTIAFKEWIGFLMYRLRG 259


>gi|119485358|ref|ZP_01619686.1| hypothetical protein L8106_09461 [Lyngbya sp. PCC 8106]
 gi|119457114|gb|EAW38240.1| hypothetical protein L8106_09461 [Lyngbya sp. PCC 8106]
          Length = 263

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 89/189 (47%), Gaps = 24/189 (12%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHG- 127
           IV+LG GT   PT P   ++   ++  RI     LYK  K       +I+SGG  Q  G 
Sbjct: 80  IVVLGGGTKA-PTPPRPWVD-VGEAGDRILYGALLYKQDK----APWLILSGGRIQWDGK 133

Query: 128 -LAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI--KNMQGKNIILVSSAYH 184
              ES       +E GV    I  +  SL+T+QNA     ++   N+ GK ++LV+SA H
Sbjct: 134 EPPESADMKEIAVEMGVRESAILQDPDSLNTYQNAVNVRQILAENNLTGK-VLLVTSALH 192

Query: 185 LKRSQLYFQHFGINTKASCSDYL-------------NAYYSIIPLSANFYLTELALKEYI 231
           + RS L FQ  GI    + +D+L                 ++IP + +      ALKEYI
Sbjct: 193 MPRSLLVFQRQGIEVIPAPTDFLVSQQDLQPSTTIQGRILNLIPDTQSLQQFTQALKEYI 252

Query: 232 GILIAYYRG 240
           G+++   RG
Sbjct: 253 GMIVYRLRG 261


>gi|91203844|emb|CAJ71497.1| conserver hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 263

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 108/230 (46%), Gaps = 31/230 (13%)

Query: 30  MLLFSFIGWG-IIPTILLKHLQFSYQRPLLSPQWKKD--GNI------IVLLGNGTTIIP 80
           +LLF+F  +   +  + ++ L++ Y  PLLS Q   D  G I      IV+L  G T  P
Sbjct: 46  ILLFAFFCYSSPVSKVFIRRLEYKYP-PLLSIQSSDDTRGAIVPEVKWIVVLAGGHTSDP 104

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG---DPQKHGLAESIVYNNK 137
            IP I    S ++  R+ E +RL++   +      I++SGG   DP    ++ +      
Sbjct: 105 DIP-ITSRVSGETLVRLAEGIRLHRLVPE----SRIVLSGGRVFDP----VSGAEAMAEL 155

Query: 138 LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
            +  GVE + + L+++S DT   A+F   ++ N    + ILV+SA H+ R+   F+  G+
Sbjct: 156 AMALGVEEESLILQSESKDTHDEAKFVKPIVGN---DHFILVTSANHMARAMGMFRKSGM 212

Query: 198 NTKASCSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
           +   + + +        A     P S  F   E    EY+GIL A  RG 
Sbjct: 213 SPIPAPAGHTILKSQTTAPGDFFPSSHGFDKAEQVFYEYLGILWALLRGQ 262


>gi|291533114|emb|CBL06227.1| Uncharacterized conserved protein [Megamonas hypermegale ART12/1]
          Length = 255

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 108/238 (45%), Gaps = 22/238 (9%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKD 65
           +F I  YW    + I+  + +S   LLF  +    I   L+K L+  YQ   +  Q K+D
Sbjct: 24  LFNIYLYW----KKIKGKYILSMITLLFYLLSTNFIAYHLVKPLENFYQNKTIE-QLKQD 78

Query: 66  GN-IIVLLGNGTTIIPTIPAIRIEPSFQSY--SRIFETMRLYKSCKQHSMHCTIIISGGD 122
            N +I++LG G   +  I     E     Y  +R+   MRL     Q  +   II+SGG 
Sbjct: 79  KNDVIIMLGGGAINVADIDG---EGQVSGYVANRMITVMRL-----QKELDIPIILSGGK 130

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA 182
             +    E+ +        GV    + LE QS +T +N Q S  +++       ++++S 
Sbjct: 131 VFEDTGREADIEKRIFEGMGVNSQALILENQSRNTVENVQNSKVIMEEYNFTKPLVITSG 190

Query: 183 YHLKRSQLYFQHFGINTKASCSDY------LNAYYSIIPLSANFYLTELALKEYIGIL 234
           +HL R+   F    I      +DY      + + ++ +P + +   + +A++EY+GIL
Sbjct: 191 FHLLRAMEIFAREEIEATPYVADYQMSDELVFSIFNFLPNNGSLNTSCMAIREYLGIL 248


>gi|16330498|ref|NP_441226.1| hypothetical protein sll1606 [Synechocystis sp. PCC 6803]
 gi|1652989|dbj|BAA17906.1| sll1606 [Synechocystis sp. PCC 6803]
          Length = 262

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 100/214 (46%), Gaps = 31/214 (14%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG---TTIIPTIPAIRIEPSFQSYSRIFETM 101
           LL+ L++ Y      PQ      +IV+LG G    T     P +      ++  R+    
Sbjct: 60  LLRTLEYQYLPMEDFPQ----APVIVVLGGGLYQATYPRQFPEVA-----EAGDRVIYGA 110

Query: 102 RLYKSCKQHSMHCTIIISGGD-PQKHGLAESIVYNNKLL--ESGVERDDIKLETQSLDTF 158
           ++Y+  K       II +GG  P    +A S   +  LL     V R+ I  E +SL+T 
Sbjct: 111 QIYQEGK----APYIITTGGRIPWLGTVATSEAEDMALLLQRLDVPREAIIKEEKSLNTR 166

Query: 159 QNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL----------- 207
           QNA F+  +++      IILV+S YH+ R++  F+  GI    + +D+L           
Sbjct: 167 QNAVFTQKILQQRGINTIILVTSGYHMPRAKRVFEKLGIIVIPAATDFLSQPLGRNNFNL 226

Query: 208 -NAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            N    ++P + +  +T +ALKEY+G++I   +G
Sbjct: 227 ANVILGLMPDAKSLQMTTMALKEYLGLVIYKLQG 260


>gi|13470862|ref|NP_102431.1| hypothetical protein mll0674 [Mesorhizobium loti MAFF303099]
 gi|14021605|dbj|BAB48217.1| mll0674 [Mesorhizobium loti MAFF303099]
          Length = 265

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 105/221 (47%), Gaps = 21/221 (9%)

Query: 31  LLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPS 90
           L+ +   W  +  ++L  L+  + RP L PQ K DG  IV+LG G      +     E S
Sbjct: 47  LILALSTWTSLGAMMLNPLEERFPRPPL-PQ-KVDG--IVVLGGGFEGAINLARGGYELS 102

Query: 91  FQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP----QKHGLAESIVYNNKLLESGVERD 146
             S  R+ ET  L +          +++SGG         G A+S   +  L+  GV  D
Sbjct: 103 -SSGDRMVETAILARRFPL----AKVVVSGGHGAFFIDAEGDADSA--SRMLVPLGVSAD 155

Query: 147 DIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
            + LE +S +T++NA FS  +++   G+  +LV+SA+H+ R++  F   G  T     DY
Sbjct: 156 RLVLEDKSRNTYENAIFSRKLVEPKPGETWLLVTSAFHMPRAKALFDKAGFPTVPWPVDY 215

Query: 207 LNAYYSIIPLSANFYL-----TELALKEYIGILIAYYRGNR 242
             +    + L  +  +     T +AL+E+IG L AY+   R
Sbjct: 216 HTSGKEGVGLFRDNAIDSVQNTTIALREWIG-LFAYWLSGR 255


>gi|56476708|ref|YP_158297.1| hypothetical protein ebA2301 [Aromatoleum aromaticum EbN1]
 gi|56312751|emb|CAI07396.1| probable transmembrane protein [Aromatoleum aromaticum EbN1]
          Length = 258

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 92/192 (47%), Gaps = 28/192 (14%)

Query: 56  PLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSF--QSYSRI-FETMRLYKSCKQHSM 112
           P L+    +    IV++G G          R  P +  ++ +R+  E +R Y +   H +
Sbjct: 76  PPLTATSARPAEAIVIVGGGKR--------RHAPEYGGETVNRLTLERLR-YGARLAHGL 126

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERD----DIKLETQSLDTFQNAQFSSSMI 168
              +++SGG P             +L+++ +E D       +E  SLDT QNA+FS+ ++
Sbjct: 127 RLPVLVSGGAPTGE------RPEGELMKAALETDFGIIPRWVEASSLDTGQNAEFSAPLL 180

Query: 169 KNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY------YSIIPLSANFYL 222
           K    + ++LV+ A H++R++  F+  GI   A+ + +L  +       + +P + + Y 
Sbjct: 181 KAAGVRRVLLVTHAAHMRRARAEFEARGIEVIAAPTAWLGRHDANDQVLTALPSATSAYA 240

Query: 223 TELALKEYIGIL 234
              A  E++G+L
Sbjct: 241 GWYAAHEWLGLL 252


>gi|154249896|ref|YP_001410721.1| hypothetical protein Fnod_1217 [Fervidobacterium nodosum Rt17-B1]
 gi|154153832|gb|ABS61064.1| protein of unknown function DUF218 [Fervidobacterium nodosum
           Rt17-B1]
          Length = 219

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 97/197 (49%), Gaps = 20/197 (10%)

Query: 31  LLFSFIGWGIIPTILLKHLQFSY--QRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIE 88
           L F F+ + ++   L  +L F+Y   +  +    +  G  IV+LG G           +E
Sbjct: 16  LAFLFLSFALVFYFLTSNL-FAYLISKTFVLKDTEDKGIFIVVLGGGVDEFSN----NVE 70

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
               +  R+++ + LYK+  +      II++GG   K G+ E+++  N LL  GV  +DI
Sbjct: 71  IGKHTLRRLYKALELYKNRPRK-----IIVTGGIIDK-GVPEALIMKNVLLNFGVPEEDI 124

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS---- 204
            L +++ +TF+N + +  +I ++    I LV+S  H+KRS   F+ F  +     +    
Sbjct: 125 ILGSKARNTFENGKCTFELIGDVP---ITLVTSTIHMKRSLFVFRKFFKDVSFVSADVPV 181

Query: 205 DYLNAYYSIIPLSANFY 221
           D+ N+Y   IP +  FY
Sbjct: 182 DFRNSYLDYIPSANAFY 198


>gi|15964004|ref|NP_384357.1| hypothetical protein SMc00331 [Sinorhizobium meliloti 1021]
 gi|15073180|emb|CAC41688.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
          Length = 335

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 113/245 (46%), Gaps = 19/245 (7%)

Query: 3   LSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIG-WGIIPTILLKHLQFSYQRPLLSPQ 61
           L+++ L+V    +L +  R    +S F L   F+  +    +  L+ L+  + RP  +P+
Sbjct: 90  LAFLALVVGVLLMLGRFRRSGGTLSAFGLAVLFVTLFTTAGSYFLQILEDRFPRP--TPE 147

Query: 62  WKKDGNIIVLLGN-GTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
             +   IIVL G     ++ +   + +    Q+  R  ET+RL ++  Q      I++SG
Sbjct: 148 PTELACIIVLGGAFENVVMASRGGMELN---QAAERFVETLRLAQAYPQ----ARILVSG 200

Query: 121 GDPQKHGLAESIVY--NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
           GD    G+ E   +   N     G+  D +  E +S  TF+NA+++  ++     +   L
Sbjct: 201 GDGSLSGIYEGDAHASENFFGTFGIGSDRLIREGESRTTFENARYTRDLLAKNGLERCAL 260

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDYLNA-----YYSIIPLSANFYLTELALKEYIGI 233
           V+SAYH+ RS   F+  G+      +DY  +      +     S N  L   A KE+ G 
Sbjct: 261 VTSAYHMPRSIGLFRANGMEVTPWPTDYRTSGKVRLGFDFTQPSLNAQLATTAAKEWTG- 319

Query: 234 LIAYY 238
           L+AYY
Sbjct: 320 LVAYY 324


>gi|291278482|ref|YP_003495317.1| hypothetical protein DEFDS_0049 [Deferribacter desulfuricans SSM1]
 gi|290753184|dbj|BAI79561.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 237

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 85/174 (48%), Gaps = 17/174 (9%)

Query: 65  DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
           D + +V+LG G      +          S  R+ E   + K   +      II+SGG   
Sbjct: 72  DFDAVVILGGGVYADGELKE-------DSLKRLVEGYLIAKKANK-----PIILSGGKVF 119

Query: 125 KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYH 184
           K+   ES++  NKLL  G +  +I ++  S DT +NA F   +I       ++L++S YH
Sbjct: 120 KNLEPESLIMRNKLLNLGFD-GEIFIDDTSKDTNENATFVKKIIAANNFNKVLLITSGYH 178

Query: 185 LKRSQLYFQHFGINTKASCSD-YLNAYYSII---PLSANFYLTELALKEYIGIL 234
             RS++ F+  GIN+     D  ++  Y+ +   P+++N +     +KEY+GIL
Sbjct: 179 AMRSKMLFEKHGINSCVVLVDKKIDKKYNFVDFLPVASNLHTISKVIKEYLGIL 232


>gi|307306416|ref|ZP_07586160.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
 gi|306902258|gb|EFN32855.1| protein of unknown function DUF218 [Sinorhizobium meliloti BL225C]
          Length = 262

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 113/245 (46%), Gaps = 19/245 (7%)

Query: 3   LSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIG-WGIIPTILLKHLQFSYQRPLLSPQ 61
           L+++ L+V    +L +  R    +S F L   F+  +    +  L+ L+  + RP  +P+
Sbjct: 17  LAFLALVVGVLLMLGRFRRSGGTLSAFGLAVLFVTLFTTAGSYFLQILEDRFPRP--TPE 74

Query: 62  WKKDGNIIVLLGN-GTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
             +   IIVL G     ++ +   + +    Q+  R  ET+RL ++  Q      I++SG
Sbjct: 75  PTELACIIVLGGAFENVVMASRGGMELN---QAAERFVETLRLAQAYPQ----ARILVSG 127

Query: 121 GDPQKHGLAESIVY--NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
           GD    G+ E   +   N     G+  D +  E +S  TF+NA+++  ++     +   L
Sbjct: 128 GDGSLSGIYEGDAHASENFFGTFGIGSDRLIREGESRTTFENARYTRDLLAKNGLERCAL 187

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDYLNA-----YYSIIPLSANFYLTELALKEYIGI 233
           V+SAYH+ RS   F+  G+      +DY  +      +     S N  L   A KE+ G 
Sbjct: 188 VTSAYHMPRSIGLFRANGMEVTPWPTDYRTSGKVRLGFDFTQPSLNAQLATTAAKEWTG- 246

Query: 234 LIAYY 238
           L+AYY
Sbjct: 247 LVAYY 251


>gi|298492074|ref|YP_003722251.1| hypothetical protein Aazo_3520 ['Nostoc azollae' 0708]
 gi|298233992|gb|ADI65128.1| protein of unknown function DUF218 ['Nostoc azollae' 0708]
          Length = 263

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 87/188 (46%), Gaps = 22/188 (11%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           IV+LG G T     P   ++ S +S  R+    +LY+  K       I++SGG     G 
Sbjct: 80  IVVLG-GATKSGVWPRPTVDLS-ESGDRVIYAAQLYRQKKAP----IIVLSGGRIDWRGS 133

Query: 129 A--ESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLK 186
           A  ES      L   G+  + I  E  SL+T+QNA      ++N   K ++LV+SA H  
Sbjct: 134 ASQESTDMAAILTSIGIPSEAIIQEPDSLNTYQNAVNVKETLENRGIKKVLLVTSAMHTP 193

Query: 187 RSQLYFQHFGINTKASCSDYL--------------NAYYSIIPLSANFYLTELALKEYIG 232
           R+   FQ  GI+   + +D+L               A  +++P + N Y    ALKEYIG
Sbjct: 194 RALKIFQRQGIDVIPAPTDFLVSQGELQELTSSPKGAILNLLPDTTNLYQFTNALKEYIG 253

Query: 233 ILIAYYRG 240
            +I   RG
Sbjct: 254 SVIYSLRG 261


>gi|320530702|ref|ZP_08031746.1| hypothetical protein HMPREF9555_01853 [Selenomonas artemidis F0399]
 gi|320136989|gb|EFW28927.1| hypothetical protein HMPREF9555_01853 [Selenomonas artemidis F0399]
          Length = 258

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 88/180 (48%), Gaps = 20/180 (11%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIE--- 88
           +F  +  G +  + +  L+ +Y  P   PQ    G++I++LG G   I  +  +  E   
Sbjct: 54  VFYLLTTGAVADLFMGSLERTYPVPE-HPQ----GDVIIMLGGGA--IGGVQDVDGEGML 106

Query: 89  -PSFQSYSRIFETMRLYKSCKQHSMH-CTIIISGGDPQKHGLAESIVYNNKLLESGVERD 146
            PS  S        RL  + + H ++   I++SGG   K    E+ +    L+  GV  +
Sbjct: 107 APSPAS--------RLLTAVRLHRLYGLPILLSGGQVFKDTGTEAEIARRVLISLGVPEE 158

Query: 147 DIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
            I  E++SL T QNA++S+ ++      + ILV+SA+HL R+ L F+  GI      SD+
Sbjct: 159 QIYTESESLTTRQNARYSAEILHREGFTHPILVTSAFHLPRAVLNFEKLGIEVTPYPSDF 218


>gi|292670312|ref|ZP_06603738.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292648043|gb|EFF66015.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 252

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 90/185 (48%), Gaps = 21/185 (11%)

Query: 26  MSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTI----IPT 81
           ++C + L S    G     L+  L+ +Y+ P+  PQ    G+IIV+LG G       +  
Sbjct: 45  IACALYLLST---GAAADSLMGSLERTYEVPV-HPQ----GDIIVMLGGGAIADVRDVDG 96

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
              +   PS    SR+   +RL++       H  I++SGG       +E+ +    L   
Sbjct: 97  TGMLAQSPS----SRLLAVLRLHRR-----YHLPILLSGGQVFSDTGSEAEIARRVLRSL 147

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           GV  + I +ET S  T QNA++S+ +++     + ILV+SA+HL R+ L F+  G+    
Sbjct: 148 GVPSEMIYVETHSRTTGQNARYSAEILRREGFAHPILVTSAFHLPRAVLNFEKEGVAVTP 207

Query: 202 SCSDY 206
             +D+
Sbjct: 208 YPTDF 212


>gi|110633719|ref|YP_673927.1| hypothetical protein Meso_1366 [Mesorhizobium sp. BNC1]
 gi|110284703|gb|ABG62762.1| protein of unknown function DUF218 [Chelativorans sp. BNC1]
          Length = 266

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 96/211 (45%), Gaps = 15/211 (7%)

Query: 31  LLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPS 90
           L+ +  GW     +LL  L+  + RP  +PQ   DG  I++LG G      +     E +
Sbjct: 47  LVVALAGWTTFGAMLLHPLESRFARPDPAPQ-HVDG--IIVLGGGFEGAVNLARGGYELN 103

Query: 91  FQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQK--HGLAESIVYNNKLLESGVERDDI 148
             S  R  E   L +   +      +I+SGG       G  ++      L   GV  + I
Sbjct: 104 -DSGDRFVEAAILARRYPE----ARLIVSGGSGSVFLPGEGDADTAPRLLTALGVAPERI 158

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
           +L+ +S DTF+NA+FS SM +    +  +LV+SA+H+ R+   F+  G       +DY  
Sbjct: 159 ELDNRSRDTFENARFSMSMAEPGPDETWLLVTSAFHMPRAVGAFRQAGFPILPWPADYKT 218

Query: 209 AYYSIIPLSANFYL-----TELALKEYIGIL 234
                  L+ +  L     T + ++E++G+L
Sbjct: 219 TGREKPGLTDDNVLDSLRNTSIGIREWVGLL 249


>gi|85715468|ref|ZP_01046449.1| hypothetical protein NB311A_17224 [Nitrobacter sp. Nb-311A]
 gi|85697663|gb|EAQ35539.1| hypothetical protein NB311A_17224 [Nitrobacter sp. Nb-311A]
          Length = 266

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (43%), Gaps = 19/194 (9%)

Query: 60  PQWKKDG----NIIVLLGNGTTIIPTIPAIRIEPSFQSYS-RIFETMRLYKSCKQHSMHC 114
           P W  DG     II+L   G +I P +   R        + R+   + L     Q     
Sbjct: 70  PPWHFDGRAPDGIIIL---GGSIQPPLSVARQTVEIDGAAERVIGGLEL----AQRFPEA 122

Query: 115 TIIISGGDPQ-KHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
            ++ SGG  Q   G A        L E  G+  + I LE +S  T++NA+FS  ++    
Sbjct: 123 RVVYSGGSGQLTEGSAREAPIAGSLFERFGITPERIVLENESRTTYENARFSRELVAPKP 182

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSD-----YLNAYYSIIPLSANFYLTELAL 227
           G+  +LV+SAYH+ RS   F+  G   +    D     +++A+     L+      ++A+
Sbjct: 183 GERWLLVTSAYHMPRSIGVFRKAGFEVEPYPVDWRTRGWIDAWRPFNRLTTGLACADIAV 242

Query: 228 KEYIGILIAYYRGN 241
            E++G+L  +  G 
Sbjct: 243 HEWVGLLAHWMAGR 256


>gi|152981868|ref|YP_001355267.1| hypothetical protein mma_3577 [Janthinobacterium sp. Marseille]
 gi|151281945|gb|ABR90355.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 258

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 89/180 (49%), Gaps = 22/180 (12%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           IV+LG G        A +  PS  +  R+     LY++      H  +++SGG P    +
Sbjct: 84  IVVLGGGRISNALEYAGQDIPSSPTLHRLRYAATLYRTT-----HLPVLVSGGQPDGAAV 138

Query: 129 AESIVYNNKLLESGVERDDIK-----LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
           +E+ V    L      R+D       LE  S +T +NAQ S+ M++    K+I+LV+ A 
Sbjct: 139 SEAAVMARVL------REDFSVPVRWLEQASNNTAENAQLSARMLREAGVKHILLVTDAM 192

Query: 184 HLKRSQLYFQHFGINTKASCSDYL-NAYYS---IIPLSANFYLTELALKEYIGILIAYYR 239
           H++R++  F   G+   A+ + ++ NA ++    +P S     T  AL E++G  +A+YR
Sbjct: 193 HMQRAKQVFTQAGLKVVAAPTIFISNARHTPADFLPSSQWLQQTSYALHEWLG--LAWYR 250


>gi|238927939|ref|ZP_04659699.1| protein of hypothetical function DUF218 [Selenomonas flueggei ATCC
           43531]
 gi|238884272|gb|EEQ47910.1| protein of hypothetical function DUF218 [Selenomonas flueggei ATCC
           43531]
          Length = 253

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 86/173 (49%), Gaps = 18/173 (10%)

Query: 39  GIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTI----IPTIPAIRIEPSFQSY 94
           G +   L+  L+ +Y  P + PQ    G++I++LG G       +  +  +   PS    
Sbjct: 56  GAVSDRLMGELERTYPVPEV-PQ----GDVIIMLGGGAIADVQDVDGMGMLAQSPS---- 106

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SR+    RL+        H  I++SGG       +E+ +    L   GV  + I++ET+S
Sbjct: 107 SRLLAAYRLHLRT-----HLPILLSGGQVFSDTGSEAEIARRVLRSLGVPDEMIRVETRS 161

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL 207
           L T QNA +++ +++     + ILV+SA+HL R+ L F+  GI      +D+L
Sbjct: 162 LTTGQNAHYTAEILRREGLMHPILVTSAFHLPRAVLNFEKQGITVTPYPTDFL 214


>gi|254481130|ref|ZP_05094376.1| conserved hypothetical protein [marine gamma proteobacterium
           HTCC2148]
 gi|214038925|gb|EEB79586.1| conserved hypothetical protein [marine gamma proteobacterium
           HTCC2148]
          Length = 245

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 77/152 (50%), Gaps = 12/152 (7%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
            R+   + LYK+ K       +++SGG        E+    + ++  G+    + +E QS
Sbjct: 98  DRLTHAVSLYKAKKAP----LVLLSGGS-TTGSRPEAEQLRDYMVLMGLPDRALLMERQS 152

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN-----A 209
           LDT QNA++S+ +++    + I+LV+SAYH+ R+   F+  G     + +DY       A
Sbjct: 153 LDTQQNARYSALILQGRDVRRILLVTSAYHMSRAVPLFERQGFEVIPAPTDYQRLVGKPA 212

Query: 210 YYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
               +P + + + +  A+KEY+G L  YYR  
Sbjct: 213 VPRWLPTADDLWRSTAAIKEYVGFL--YYRAQ 242


>gi|313896016|ref|ZP_07829570.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975441|gb|EFR40902.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 258

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 88/180 (48%), Gaps = 20/180 (11%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIE--- 88
           +F  +  G +  + +  L+ +Y  P   PQ    G++I++LG G   I  +  +  E   
Sbjct: 54  VFYLLTTGAVADLFMGSLERTYPVPE-HPQ----GDVIIMLGGGA--IGGVQDVDGEGML 106

Query: 89  -PSFQSYSRIFETMRLYKSCKQHSMH-CTIIISGGDPQKHGLAESIVYNNKLLESGVERD 146
            PS  S        RL  + + H ++   I++SGG   K    E+ +    L+  GV  +
Sbjct: 107 APSPAS--------RLLTAVRLHRLYGLPILLSGGQVFKDTGTEAEIARRVLISLGVPEE 158

Query: 147 DIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
            I  E++SL T QNA++S+ ++      + ILV+SA+HL R+ L F+  GI      SD+
Sbjct: 159 QIYTESESLTTGQNARYSAEILHREGFMHPILVTSAFHLPRAVLNFEKLGIEVTPYPSDF 218


>gi|300691119|ref|YP_003752114.1| hypothetical protein RPSI07_1461 [Ralstonia solanacearum PSI07]
 gi|299078179|emb|CBJ50822.1| conserved exported protein of unknown function [Ralstonia
           solanacearum PSI07]
          Length = 265

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 70/140 (50%), Gaps = 10/140 (7%)

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
           +Y +   H+    ++ +GG P+  G+ E+ +    + + G  +D   +ET+S  T +NA 
Sbjct: 119 VYAARLAHTARLPVLATGGAPEGDGVPEAELMRRLVADMG--QDARWIETRSATTEENAA 176

Query: 163 FSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG-INTKASCS-------DYLNAYYSII 214
           FS+ +++    + I LV+  +H+ R++ YF+  G I T A C               S++
Sbjct: 177 FSAPILRAAGIQRIYLVTHYWHMARARRYFEGQGFIVTPAPCGWGGEVEESPAGGILSLL 236

Query: 215 PLSANFYLTELALKEYIGIL 234
           P +    LT  AL+E +G L
Sbjct: 237 PRTDGLMLTRFALREALGQL 256


>gi|315145674|gb|EFT89690.1| conserved hypothetical protein [Enterococcus faecalis TX2141]
 gi|315160239|gb|EFU04256.1| conserved hypothetical protein [Enterococcus faecalis TX0645]
          Length = 401

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 91/184 (49%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 214 PKYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 264

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 265 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 324

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L+   ++E+I I++
Sbjct: 325 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLSNAFIREFIAIVV 373

Query: 236 AYYR 239
            Y R
Sbjct: 374 MYKR 377


>gi|330829535|ref|YP_004392487.1| integral membrane protein [Aeromonas veronii B565]
 gi|328804671|gb|AEB49870.1| Integral membrane protein [Aeromonas veronii B565]
          Length = 256

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 87/180 (48%), Gaps = 18/180 (10%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           IV+LGNG    P +P +R   +  S +R  E +RL ++     +  +  +SG       L
Sbjct: 83  IVVLGNGHVSDPAVP-MRSWQNNISLARTLEGVRLAQAYPDAELVFSGYVSGDT-----L 136

Query: 129 AESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKR 187
           + + V N ++ ES G+ R  + L   + DT   A    S+ ++++GK + LVSSA HL R
Sbjct: 137 SNAEV-NARMAESLGIPRSRMTLFENNKDTHDEA---VSISRHLKGKEVALVSSATHLPR 192

Query: 188 SQLYFQHFGINTKASCSDYL-------NAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           +   +Q  G+    + +DY           YS +P       +E A+ E+IG+  A  RG
Sbjct: 193 AMALYQGQGLKAVPAPTDYTAKQSQVPQPLYSYLPKGRYLMYSEAAIHEWIGVWWARLRG 252


>gi|254555567|ref|YP_003061984.1| integral membrane protein [Lactobacillus plantarum JDM1]
 gi|254044494|gb|ACT61287.1| integral membrane protein [Lactobacillus plantarum JDM1]
          Length = 340

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 97/212 (45%), Gaps = 18/212 (8%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSF 91
           L+ F+G  ++ T       F+Y    ++ +  +   I  ++  G  ++P       +P+ 
Sbjct: 126 LWQFLGLALLLTAYFAFSFFAYLLACVTTRLGRHRQIDYMIVLGAGLMPNG-----QPTR 180

Query: 92  QSYSRIFETMRLYKSCK-QHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL 150
               R+    + Y++ + ++    TI++SGG      +AES      L++ GV RD I+ 
Sbjct: 181 TLAYRLQAAAKYYRAQRARYHQPITIVVSGGQGPDEVMAESTAMRQYLVDQGVPRDAIQE 240

Query: 151 ETQSLDTFQNAQFSSSMIKNMQG-KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA 209
           E QS  T +N +FS ++I   Q     ++V+S YH+ R+ ++ +   +N     +     
Sbjct: 241 ENQSTSTIENLKFSHALIVRQQPFYRAVIVTSGYHVLRANIFARQLHLNLTGIGAH---- 296

Query: 210 YYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
                PL   +YL     +EY+ +++ Y   N
Sbjct: 297 ----TPL---YYLPFAMFREYLALIVMYRWAN 321


>gi|269120749|ref|YP_003308926.1| hypothetical protein Sterm_2141 [Sebaldella termitidis ATCC 33386]
 gi|268614627|gb|ACZ08995.1| protein of unknown function DUF218 [Sebaldella termitidis ATCC
           33386]
          Length = 346

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 70/136 (51%), Gaps = 12/136 (8%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           K+ + IV LG       T+  + I+   Q+Y    E  RL       + +  II++GG  
Sbjct: 174 KNADFIVTLGYALNNDGTMNEVLIKRLEQTY----EAARL-------NPNANIIVTGG-V 221

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
           QK GL ES +  N L+E G+  D + +E ++ DT +NA +S+ ++K    K +IL++SA 
Sbjct: 222 QKGGLTESYLMKNWLVEKGIAADRVIIEDKARDTVENAIYSTEILKKYNPKRVILITSAS 281

Query: 184 HLKRSQLYFQHFGINT 199
           H++R     Q    N 
Sbjct: 282 HIRRGTALLQEAADNA 297


>gi|251778604|ref|ZP_04821524.1| integral membrane protein [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243082919|gb|EES48809.1| integral membrane protein [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 357

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 87/182 (47%), Gaps = 23/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           P+  +D   I++LG+G      +   R+ P   S  RI + ++ Y    Q +    II S
Sbjct: 170 PKLNQD--FIIVLGSG------LIGDRVPPLLGS--RIEKAIKFYNKQSQVTNPPKIIFS 219

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      ++E+       +  G+  +D  LE  S+ T +N +FS S+++N+  +G   I
Sbjct: 220 GGQGPDEKVSEAFTMQKYAVNKGIPIEDTILEDNSVSTLENMKFSKSIMENLMPEGYRSI 279

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ YHL R+ +Y +  GI ++   S            +A ++L    ++EYI I++ Y
Sbjct: 280 FTTNNYHLFRAGIYARIAGIKSQGIGSK-----------TALYFLPNAMIREYIAIVVMY 328

Query: 238 YR 239
            +
Sbjct: 329 KK 330


>gi|299822466|ref|ZP_07054352.1| conserved domain protein [Listeria grayi DSM 20601]
 gi|299815995|gb|EFI83233.1| conserved domain protein [Listeria grayi DSM 20601]
          Length = 339

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 87/185 (47%), Gaps = 23/185 (12%)

Query: 59  SPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
            P+  KD  I++  G     +P + A R++ + Q +          K  K+     T I+
Sbjct: 156 GPRLNKDFIIVLGCGLKGKKVPQLLANRLDKAIQFHR---------KQQKKRGRTATFIV 206

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI-- 176
           SGG      +AE+      L++ G+ ++ I +E  S +T +N QFS  ++ ++Q KN   
Sbjct: 207 SGGKGPNEEIAEARAMQAYLIDKGIPKEQIFMEADSTNTEENMQFSKKLMTSIQ-KNFKS 265

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIA 236
           + V++ +HL R+ +Y +  G++ +                +A +YL    L+E+I +L  
Sbjct: 266 VFVTNNFHLFRASIYARKAGLDAQGIGGK-----------TALYYLPTALLREFIAVLFL 314

Query: 237 YYRGN 241
           Y + +
Sbjct: 315 YRKAH 319


>gi|92117952|ref|YP_577681.1| hypothetical protein Nham_2431 [Nitrobacter hamburgensis X14]
 gi|91800846|gb|ABE63221.1| protein of unknown function DUF218 [Nitrobacter hamburgensis X14]
          Length = 267

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 102/224 (45%), Gaps = 38/224 (16%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLS----------PQWKKDG----NIIVLLGNGTTIIPTI 82
           G G++ T ++  L F Y  PL +          P W  DG     II+L   G  I P +
Sbjct: 38  GTGLLATGVMALLIFGYS-PLGNVLLLTLSERFPAWHFDGREPDGIIIL---GGAIEPEL 93

Query: 83  PAIRIEPSFQSYS-RIFETMRLYKSCKQHSMHCTIIISGG------DPQKHGLAESIVYN 135
            A R        + RI   + L +   +      ++ SGG      DP    ++E+ +  
Sbjct: 94  SAARKAVEVNGAAERIIGGLELARRFPR----ARVVYSGGSANLIADP----VSEAPIAG 145

Query: 136 NKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHF 195
             L   G+  + I LE++S  T +NA+F+  ++    G+  +LV+SAYH+ RS   F+  
Sbjct: 146 RLLETFGISPERIVLESESRTTDENARFTRKLVSPKPGERWLLVTSAYHMPRSIGVFRKA 205

Query: 196 GINTKASCSD-----YLNAYYSIIPLSANFYLTELALKEYIGIL 234
           G++ +A   D     +++A+     LSA     + A+ E+ G+L
Sbjct: 206 GLDVEAYPVDWRTRGWIDAWTPFDRLSAGLARADTAVHEWCGLL 249


>gi|254479072|ref|ZP_05092426.1| conserved hypothetical protein [Carboxydibrachium pacificum DSM
           12653]
 gi|214034988|gb|EEB75708.1| conserved hypothetical protein [Carboxydibrachium pacificum DSM
           12653]
          Length = 192

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 72/145 (49%), Gaps = 13/145 (8%)

Query: 58  LSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTII 117
            + + KK   IIVL   G  +    P+    P F+   R+ E ++LYK    H     II
Sbjct: 31  FTEKPKKSDAIIVL---GCAVYGDTPS----PFFKE--RLEEALKLYKEGYGH----YII 77

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ISGG      ++E+      LLE GV   +I L+ +S  T++N  FS  +++    K  I
Sbjct: 78  ISGGKGPGESISEAEAGKRYLLEKGVASKNILLDNKSFSTYENLLFSKEIMEKNSLKTAI 137

Query: 178 LVSSAYHLKRSQLYFQHFGINTKAS 202
           +VS+ +HLKR+ +  +  GI+   S
Sbjct: 138 IVSNKFHLKRASVIAKRIGIDASFS 162


>gi|134096504|ref|YP_001101579.1| hypothetical protein HEAR3355 [Herminiimonas arsenicoxydans]
 gi|133740407|emb|CAL63458.1| Conserved hypothetical protein; putative exported protein
           [Herminiimonas arsenicoxydans]
          Length = 256

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 88/191 (46%), Gaps = 23/191 (12%)

Query: 56  PLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK-QHSMHC 114
           PLLS +      I+VL G   +  P       E   Q         RL  + K Q     
Sbjct: 72  PLLSAKAAGAQAIVVLGGGRISNAP-------EYGGQDIPAAITLQRLRYAAKLQRETGL 124

Query: 115 TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL-----ETQSLDTFQNAQFSSSMIK 169
            +++SGG P     +E+      LL      DD  +     E  S +T +NAQFSS +++
Sbjct: 125 PLLVSGGRPDGASESEAAGMARVLL------DDFSVPVKWQEEMSNNTAENAQFSSRVLR 178

Query: 170 NMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIP--LSANFYLTELAL 227
               + I+LV+ A H++R+++ FQ  G+    + + + +A    +P  L  + ++   AL
Sbjct: 179 AAGVQRILLVTDAIHMQRAKIAFQQAGLQVVPAATLFTSAARVTLPDFLPTSLHMASYAL 238

Query: 228 KEYIGILIAYY 238
           +E++G  +A+Y
Sbjct: 239 REWLG--LAWY 247


>gi|319947009|ref|ZP_08021243.1| hypothetical protein HMPREF9421_1424 [Streptococcus australis ATCC
           700641]
 gi|319747057|gb|EFV99316.1| hypothetical protein HMPREF9421_1424 [Streptococcus australis ATCC
           700641]
          Length = 342

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 90/180 (50%), Gaps = 27/180 (15%)

Query: 63  KKDGNIIVLLGNGT--TIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           +K+ + I++LG+G     +P + A R+      Y             +Q      +I+SG
Sbjct: 157 RKEPDAIIVLGSGLIGDKVPPLLAQRLTKGKAIY-------------EQFEGRPKLIVSG 203

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ-GKNIILV 179
           G       +E+    N L+E GV ++DI +E +S  TF+N  FS +++++   GK++++V
Sbjct: 204 GQGADELTSEATAMANYLIEQGVPKEDILIENRSRTTFENLTFSKAILEDQGLGKSVLVV 263

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           ++++H  R+ ++ +   I  ++  S            +A +YL    ++E +G++  Y++
Sbjct: 264 TNSFHALRAGVFMRRLKIPGRSVGSK-----------TAFYYLPSAWIRETVGLVSLYWK 312


>gi|255975975|ref|ZP_05426561.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|255968847|gb|EET99469.1| conserved hypothetical protein [Enterococcus faecalis T2]
          Length = 366

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 179 PKYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 229

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 230 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 289

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 290 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 338

Query: 236 AYYR 239
            Y R
Sbjct: 339 MYQR 342


>gi|255972921|ref|ZP_05423507.1| predicted protein [Enterococcus faecalis T1]
 gi|256762373|ref|ZP_05502953.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|255963939|gb|EET96415.1| predicted protein [Enterococcus faecalis T1]
 gi|256683624|gb|EEU23319.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|315030014|gb|EFT41946.1| conserved hypothetical protein [Enterococcus faecalis TX4000]
          Length = 366

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 179 PKYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 229

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 230 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 289

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 290 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 338

Query: 236 AYYR 239
            Y R
Sbjct: 339 MYKR 342


>gi|312904109|ref|ZP_07763277.1| conserved hypothetical protein [Enterococcus faecalis TX0635]
 gi|310632585|gb|EFQ15868.1| conserved hypothetical protein [Enterococcus faecalis TX0635]
 gi|315578454|gb|EFU90645.1| conserved hypothetical protein [Enterococcus faecalis TX0630]
          Length = 401

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 214 PRYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 264

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 265 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 324

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 325 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 373

Query: 236 AYYR 239
            Y R
Sbjct: 374 MYKR 377


>gi|153873460|ref|ZP_02002036.1| Protein of unknown function DUF218 [Beggiatoa sp. PS]
 gi|152070073|gb|EDN67963.1| Protein of unknown function DUF218 [Beggiatoa sp. PS]
          Length = 195

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 70/145 (48%), Gaps = 10/145 (6%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGD-PQKHGLAESIVYNNKLLESGVERDDIKLETQ 153
            R+    RLY + K       I++SGG  P +    E+      L E GV    +  E  
Sbjct: 46  DRVIHAARLYHAGKA----PLILVSGGTLPWRKVPPEADAMRAFLEELGVPTKAVMSEPD 101

Query: 154 SLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL-----N 208
           S+ T++NA FS  ++ N     I+LV+SA+H++RS   F+  G     + +D+       
Sbjct: 102 SITTYENALFSKKLLDNKGIHKILLVTSAFHMRRSAAVFRKVGFEVIPAPTDFRVVKNPP 161

Query: 209 AYYSIIPLSANFYLTELALKEYIGI 233
           + +  +P     + T +A+KEYIG+
Sbjct: 162 SLFDYLPDVRYLHQTTIAIKEYIGL 186


>gi|307279173|ref|ZP_07560231.1| hypothetical protein HMPREF9515_01492 [Enterococcus faecalis
           TX0860]
 gi|306504298|gb|EFM73510.1| hypothetical protein HMPREF9515_01492 [Enterococcus faecalis
           TX0860]
          Length = 401

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 214 PKYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 264

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 265 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 324

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 325 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 373

Query: 236 AYYR 239
            Y R
Sbjct: 374 MYQR 377


>gi|256618946|ref|ZP_05475792.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256965248|ref|ZP_05569419.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|256598473|gb|EEU17649.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256955744|gb|EEU72376.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
          Length = 359

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 172 PRYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 222

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 223 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 282

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 283 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 331

Query: 236 AYYR 239
            Y R
Sbjct: 332 MYKR 335


>gi|206969698|ref|ZP_03230652.1| conserved domain protein [Bacillus cereus AH1134]
 gi|206735386|gb|EDZ52554.1| conserved domain protein [Bacillus cereus AH1134]
          Length = 277

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 111/242 (45%), Gaps = 39/242 (16%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +L S +FL +S        ++ IF     + ++ FI    +   L  +  + + RP    
Sbjct: 40  ILFSILFLFISPASFFSSHLQPIFGGISLITIYFFIH---LSNFLSAYFLYQFNRP---- 92

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC--TI 116
             +++ + I++LG+G     +P + A RI  +   Y             KQ +++   TI
Sbjct: 93  --RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPTI 138

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK 174
           I SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  ++ ++  +GK
Sbjct: 139 IFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGK 198

Query: 175 -NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I
Sbjct: 199 YKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAI 247

Query: 234 LI 235
           ++
Sbjct: 248 VV 249


>gi|29375933|ref|NP_815087.1| hypothetical protein EF1366 [Enterococcus faecalis V583]
 gi|256853003|ref|ZP_05558373.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256958856|ref|ZP_05563027.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256962050|ref|ZP_05566221.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|257078888|ref|ZP_05573249.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|257082665|ref|ZP_05577026.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|257086869|ref|ZP_05581230.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|257415976|ref|ZP_05592970.1| conserved hypothetical protein [Enterococcus faecalis AR01/DG]
 gi|257419178|ref|ZP_05596172.1| predicted protein [Enterococcus faecalis T11]
 gi|257422744|ref|ZP_05599734.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|29343395|gb|AAO81157.1| conserved hypothetical protein [Enterococcus faecalis V583]
 gi|256711462|gb|EEU26500.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256949352|gb|EEU65984.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256952546|gb|EEU69178.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|256986918|gb|EEU74220.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|256990695|gb|EEU77997.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|256994899|gb|EEU82201.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|257157804|gb|EEU87764.1| conserved hypothetical protein [Enterococcus faecalis ARO1/DG]
 gi|257161006|gb|EEU90966.1| predicted protein [Enterococcus faecalis T11]
 gi|257164568|gb|EEU94528.1| conserved hypothetical protein [Enterococcus faecalis X98]
          Length = 359

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 172 PKYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 222

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 223 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 282

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 283 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 331

Query: 236 AYYR 239
            Y R
Sbjct: 332 MYKR 335


>gi|257085374|ref|ZP_05579735.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
 gi|256993404|gb|EEU80706.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
          Length = 359

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 172 PKYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 222

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 223 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 282

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 283 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 331

Query: 236 AYYR 239
            Y R
Sbjct: 332 MYKR 335


>gi|307273352|ref|ZP_07554597.1| hypothetical protein HMPREF9514_02117 [Enterococcus faecalis
           TX0855]
 gi|306509879|gb|EFM78904.1| hypothetical protein HMPREF9514_02117 [Enterococcus faecalis
           TX0855]
          Length = 401

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 214 PRYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 264

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 265 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 324

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 325 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 373

Query: 236 AYYR 239
            Y R
Sbjct: 374 MYKR 377


>gi|229181123|ref|ZP_04308455.1| hypothetical protein bcere0005_44660 [Bacillus cereus 172560W]
 gi|228602314|gb|EEK59803.1| hypothetical protein bcere0005_44660 [Bacillus cereus 172560W]
          Length = 280

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 111/242 (45%), Gaps = 39/242 (16%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +L S +FL +S        ++ IF     + ++ FI    +   L  +  + + RP    
Sbjct: 43  ILFSILFLFISPASFFSSHLQPIFGGISLITIYFFIH---LSNFLSAYFLYQFNRP---- 95

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC--TI 116
             +++ + I++LG+G     +P + A RI  +   Y             KQ +++   TI
Sbjct: 96  --RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPTI 141

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK 174
           I SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  ++ ++  +GK
Sbjct: 142 IFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGK 201

Query: 175 -NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I
Sbjct: 202 YKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAI 250

Query: 234 LI 235
           ++
Sbjct: 251 VV 252


>gi|227518630|ref|ZP_03948679.1| integral membrane protein [Enterococcus faecalis TX0104]
 gi|227553161|ref|ZP_03983210.1| integral membrane protein [Enterococcus faecalis HH22]
 gi|229545952|ref|ZP_04434677.1| integral membrane protein [Enterococcus faecalis TX1322]
 gi|229550144|ref|ZP_04438869.1| integral membrane protein [Enterococcus faecalis ATCC 29200]
 gi|293383072|ref|ZP_06628990.1| putative membrane protein [Enterococcus faecalis R712]
 gi|293387775|ref|ZP_06632319.1| putative membrane protein [Enterococcus faecalis S613]
 gi|294779558|ref|ZP_06744952.1| putative membrane protein [Enterococcus faecalis PC1.1]
 gi|300860460|ref|ZP_07106547.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|307271145|ref|ZP_07552428.1| hypothetical protein HMPREF9498_03231 [Enterococcus faecalis
           TX4248]
 gi|307288139|ref|ZP_07568149.1| hypothetical protein HMPREF9505_01545 [Enterococcus faecalis
           TX0109]
 gi|307291350|ref|ZP_07571234.1| hypothetical protein HMPREF9509_01659 [Enterococcus faecalis
           TX0411]
 gi|312900627|ref|ZP_07759924.1| conserved hypothetical protein [Enterococcus faecalis TX0470]
 gi|312907338|ref|ZP_07766329.1| conserved hypothetical protein [Enterococcus faecalis DAPTO 512]
 gi|312909955|ref|ZP_07768803.1| conserved hypothetical protein [Enterococcus faecalis DAPTO 516]
 gi|312952369|ref|ZP_07771244.1| conserved hypothetical protein [Enterococcus faecalis TX0102]
 gi|227073925|gb|EEI11888.1| integral membrane protein [Enterococcus faecalis TX0104]
 gi|227177687|gb|EEI58659.1| integral membrane protein [Enterococcus faecalis HH22]
 gi|229304730|gb|EEN70726.1| integral membrane protein [Enterococcus faecalis ATCC 29200]
 gi|229308915|gb|EEN74902.1| integral membrane protein [Enterococcus faecalis TX1322]
 gi|291079737|gb|EFE17101.1| putative membrane protein [Enterococcus faecalis R712]
 gi|291082845|gb|EFE19808.1| putative membrane protein [Enterococcus faecalis S613]
 gi|294453348|gb|EFG21756.1| putative membrane protein [Enterococcus faecalis PC1.1]
 gi|300849499|gb|EFK77249.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|306497581|gb|EFM67114.1| hypothetical protein HMPREF9509_01659 [Enterococcus faecalis
           TX0411]
 gi|306500875|gb|EFM70193.1| hypothetical protein HMPREF9505_01545 [Enterococcus faecalis
           TX0109]
 gi|306512643|gb|EFM81292.1| hypothetical protein HMPREF9498_03231 [Enterococcus faecalis
           TX4248]
 gi|310626366|gb|EFQ09649.1| conserved hypothetical protein [Enterococcus faecalis DAPTO 512]
 gi|310629753|gb|EFQ13036.1| conserved hypothetical protein [Enterococcus faecalis TX0102]
 gi|311289913|gb|EFQ68469.1| conserved hypothetical protein [Enterococcus faecalis DAPTO 516]
 gi|311292108|gb|EFQ70664.1| conserved hypothetical protein [Enterococcus faecalis TX0470]
 gi|315027393|gb|EFT39325.1| conserved hypothetical protein [Enterococcus faecalis TX2137]
 gi|315033767|gb|EFT45699.1| conserved hypothetical protein [Enterococcus faecalis TX0017]
 gi|315036853|gb|EFT48785.1| conserved hypothetical protein [Enterococcus faecalis TX0027]
 gi|315147862|gb|EFT91878.1| conserved hypothetical protein [Enterococcus faecalis TX4244]
 gi|315150660|gb|EFT94676.1| conserved hypothetical protein [Enterococcus faecalis TX0012]
 gi|315153332|gb|EFT97348.1| conserved hypothetical protein [Enterococcus faecalis TX0031]
 gi|315155890|gb|EFT99906.1| conserved hypothetical protein [Enterococcus faecalis TX0043]
 gi|315157942|gb|EFU01959.1| conserved hypothetical protein [Enterococcus faecalis TX0312]
 gi|315164245|gb|EFU08262.1| conserved hypothetical protein [Enterococcus faecalis TX1302]
 gi|315166661|gb|EFU10678.1| conserved hypothetical protein [Enterococcus faecalis TX1341]
 gi|315170055|gb|EFU14072.1| conserved hypothetical protein [Enterococcus faecalis TX1342]
 gi|315575579|gb|EFU87770.1| conserved hypothetical protein [Enterococcus faecalis TX0309B]
 gi|315579979|gb|EFU92170.1| conserved hypothetical protein [Enterococcus faecalis TX0309A]
 gi|323480601|gb|ADX80040.1| conserved hypothetical protein [Enterococcus faecalis 62]
 gi|327535007|gb|AEA93841.1| integral membrane protein [Enterococcus faecalis OG1RF]
          Length = 401

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 214 PKYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 264

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 265 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 324

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 325 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 373

Query: 236 AYYR 239
            Y R
Sbjct: 374 MYKR 377


>gi|307277497|ref|ZP_07558589.1| hypothetical protein HMPREF9521_03090 [Enterococcus faecalis
           TX2134]
 gi|306505762|gb|EFM74940.1| hypothetical protein HMPREF9521_03090 [Enterococcus faecalis
           TX2134]
          Length = 401

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 214 PKYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 264

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 265 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 324

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 325 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 373

Query: 236 AYYR 239
            Y R
Sbjct: 374 MYKR 377


>gi|257089760|ref|ZP_05584121.1| predicted protein [Enterococcus faecalis CH188]
 gi|256998572|gb|EEU85092.1| predicted protein [Enterococcus faecalis CH188]
          Length = 359

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 172 PRYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 222

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 223 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 282

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 283 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 331

Query: 236 AYYR 239
            Y R
Sbjct: 332 MYKR 335


>gi|288817420|ref|YP_003431767.1| hypothetical protein HTH_0099 [Hydrogenobacter thermophilus TK-6]
 gi|288786819|dbj|BAI68566.1| conserved hypothetical protein [Hydrogenobacter thermophilus TK-6]
 gi|308751027|gb|ADO44510.1| protein of unknown function DUF218 [Hydrogenobacter thermophilus
           TK-6]
          Length = 240

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 91/194 (46%), Gaps = 24/194 (12%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY 104
           LL  L+  Y  P      K   + IV+LG G+     +          S  R+   + L+
Sbjct: 58  LLTPLESKYSVP-----EKFQADAIVVLGGGSYSTGILKE-------DSMKRLLTALILH 105

Query: 105 KSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS 164
           K          I++SGG      L ++ +  + L+E GV++ DI  E +S DT +NA + 
Sbjct: 106 KRT-----GLPIVLSGG---AENLPDAEIMKSLLVELGVDKRDIITEVRSRDTEENASYV 157

Query: 165 SSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA----YYSIIPLSANF 220
             + +    K+++LV+SAYHL R+   F+  G++     +D+        YS++P  +  
Sbjct: 158 REICQQRNYKSVVLVTSAYHLPRAVFLFKKEGLSVIPYPTDFKRDLRYNLYSLLPKMSVL 217

Query: 221 YLTELALKEYIGIL 234
             +  AL+EY+ +L
Sbjct: 218 NDSVKALREYVALL 231


>gi|315174445|gb|EFU18462.1| conserved hypothetical protein [Enterococcus faecalis TX1346]
          Length = 401

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 90/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 214 PKYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 264

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 265 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 324

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 325 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 373

Query: 236 AYYR 239
            Y R
Sbjct: 374 MYKR 377


>gi|115525420|ref|YP_782331.1| hypothetical protein RPE_3419 [Rhodopseudomonas palustris BisA53]
 gi|115519367|gb|ABJ07351.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisA53]
          Length = 267

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 91/190 (47%), Gaps = 20/190 (10%)

Query: 60  PQWKKDGNI---IVLLGNGTTIIPTIPAIR--IEPSFQSYSRIFETMRLYKSCKQHSMHC 114
           P W+ +G     IV+LG   +I   I A R  +E +  S  R+F  + L +       + 
Sbjct: 70  PSWQAEGRAPDGIVVLGG--SIDSDISAARNALE-TDASAERVFAMLDLARRYP----NA 122

Query: 115 TIIISGGDPQKHG--LAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
            I+ +GG     G   AE+ V    L + G+  D I LE+ S  T +NA  +  ++    
Sbjct: 123 RIVFTGGSANLIGDTAAEAPVAGQLLEQFGIAPDRIVLESGSRTTAENATMTRDLVAPKP 182

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSD-----YLNAYYSIIPLSANFYLTELAL 227
           G+  +LV+SA+H+ RS   F+  G   +A   D     +++  +    LSA     ++A+
Sbjct: 183 GERWLLVTSAFHMPRSIGVFRAIGFEVEAYPVDWRTRGWIDLRWPFGKLSAGLARIDVAV 242

Query: 228 KEYIGILIAY 237
            E++G LIAY
Sbjct: 243 HEWVG-LIAY 251


>gi|229087343|ref|ZP_04219484.1| hypothetical protein bcere0022_39130 [Bacillus cereus Rock3-44]
 gi|228695980|gb|EEL48824.1| hypothetical protein bcere0022_39130 [Bacillus cereus Rock3-44]
          Length = 347

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 106/238 (44%), Gaps = 33/238 (13%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           MLL+ I L+V          + IF     ++++ F     I T L  +  + + RP    
Sbjct: 112 MLLAMISLVVDPTRFFSPHFQPIFAGVSLIMIYFFFH---ISTFLTAYFLYQFNRP---- 164

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
             +++ + I++LG+G     +P + A          SRI + +  Y      +   TII 
Sbjct: 165 --RRNQDFIIVLGSGLINDKVPPLLA----------SRINKAIDFYWKQAAVTTPPTIIF 212

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NII 177
           SGG      L E+       +E G+  +    E +S++T+QN  FS  ++ +++ K   I
Sbjct: 213 SGGQGPDEKLPEAEAMQKYAVEKGIPIEHTVQENRSVNTYQNMLFSKKIMDSLKDKYRSI 272

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
             ++ +HL R+ LY +  G+N++   S            +A +Y     ++EYI I++
Sbjct: 273 FTTNNFHLFRAGLYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYIAIVV 319


>gi|304436974|ref|ZP_07396937.1| conserved hypothetical protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369925|gb|EFM23587.1| conserved hypothetical protein [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 252

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 84/172 (48%), Gaps = 18/172 (10%)

Query: 39  GIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTI----IPTIPAIRIEPSFQSY 94
           G +   L+  L+ +Y  P  +PQ    G++I++LG G       +     +   PS    
Sbjct: 55  GAVSDRLMGELERTYPVPE-APQ----GDVIIMLGGGAIADVQDVDGTGMLAQSPS---- 105

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SR+    RL+        H  I++SGG       +E+ +    L   GV  D I +ET+S
Sbjct: 106 SRLLAVYRLHLRT-----HLPILLSGGQVFSDTGSEAEIARRVLRSLGVPDDMIYVETRS 160

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
           L T QNA++++ +++     + ILV+SA+HL R+ L F+  GI      +D+
Sbjct: 161 LTTGQNARYTAEILRREGFVHPILVTSAFHLPRAVLNFEKQGITVTPYPTDF 212


>gi|87301698|ref|ZP_01084538.1| hypothetical protein WH5701_03449 [Synechococcus sp. WH 5701]
 gi|87283915|gb|EAQ75869.1| hypothetical protein WH5701_03449 [Synechococcus sp. WH 5701]
          Length = 266

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 92/201 (45%), Gaps = 24/201 (11%)

Query: 58  LSPQWKKDGNIIVLLGNG-TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCT- 115
           L+P     G+ IV+LG G    +P    + +    ++  R+   +RL +  +   +  + 
Sbjct: 70  LTPAPVPRGDAIVVLGGGLRAALPPRAGVEVN---EAGDRLLSGIRLLRDQRAPLLLLSG 126

Query: 116 --IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +  SGGDP     AE+I   +  LE GV  D + +  Q+  T + A+    + ++   
Sbjct: 127 GRVSFSGGDPAP---AEAISARSLALELGVPADRLLVSDQARTTAEEARDLRRIGQSRGW 183

Query: 174 KNIILVSSAYHLKRSQLYFQ-HFGINTKASCSDYL-------------NAYYSIIPLSAN 219
             ++LV+SA H+ R+   F+   G+       DYL             +   S+ P + +
Sbjct: 184 STVLLVTSALHMPRALASFRRQSGLQVVPVACDYLLPARDQLGRPTAGSVLLSLWPDAGS 243

Query: 220 FYLTELALKEYIGILIAYYRG 240
             L+ LA+KE++G+L+   RG
Sbjct: 244 LLLSSLAIKEHLGLLVYRLRG 264


>gi|237738277|ref|ZP_04568758.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229420157|gb|EEO35204.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 252

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 75/149 (50%), Gaps = 10/149 (6%)

Query: 46  LKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYK 105
           L  L+ SY   ++S +  + G + VLLG G  II T     I P      RI +T     
Sbjct: 61  LYDLENSYS--IISEKNLEKGEVYVLLGGG--IITTTGEGNI-PGIMPAVRIMKTAEY-- 113

Query: 106 SCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSS 165
                     I ISGG P ++  +ES VY  +L+  GV  +DI +E  S +T +NA F  
Sbjct: 114 ---YKKYPKKIYISGGSPLQNQESESSVYARELISLGVNSEDIIVEENSKNTNENALFIK 170

Query: 166 SMIKNMQGKNIILVSSAYHLKRSQLYFQH 194
             ++    KNIIL++SA+H+KRS   F+ 
Sbjct: 171 QELEKNGIKNIILITSAFHMKRSMFIFEK 199


>gi|307319303|ref|ZP_07598732.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
 gi|306895139|gb|EFN25896.1| protein of unknown function DUF218 [Sinorhizobium meliloti AK83]
          Length = 262

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 112/245 (45%), Gaps = 19/245 (7%)

Query: 3   LSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIG-WGIIPTILLKHLQFSYQRPLLSPQ 61
           L+++ L+V    +L +  R    +S F L   F+  +    +  L+ L+  + RP  +P+
Sbjct: 17  LAFLALVVGVLLMLGRFRRSGGTLSAFGLAVLFVTLFTTAGSYFLQILEDRFPRP--TPE 74

Query: 62  WKKDGNIIVLLGN-GTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
             +   IIVL G     ++ +   + +    Q+  R  ET+RL ++  Q      I++SG
Sbjct: 75  PTELACIIVLGGAFENVVMASRGGMELN---QAAERFVETLRLAQAYPQ----ARILVSG 127

Query: 121 GDPQKHGLAESIVY--NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
           GD    G+ E   +   N     G+  D +    +S  TF+NA+++  ++     +   L
Sbjct: 128 GDGSLSGIYEGDAHASENFFGTFGIGSDRLIRAGESRTTFENARYTRDLLAKNGLERCAL 187

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDYLNA-----YYSIIPLSANFYLTELALKEYIGI 233
           V+SAYH+ RS   F+  G+      +DY  +      +     S N  L   A KE+ G 
Sbjct: 188 VTSAYHMPRSIGLFRANGMEVTPWPTDYRTSGKVRLGFDFTQPSLNAQLATTAAKEWTG- 246

Query: 234 LIAYY 238
           L+AYY
Sbjct: 247 LVAYY 251


>gi|254282506|ref|ZP_04957474.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
 gi|219678709|gb|EED35058.1| conserved hypothetical protein [gamma proteobacterium NOR51-B]
          Length = 253

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 95/221 (42%), Gaps = 36/221 (16%)

Query: 32  LFSFIGWGII--------PTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIP 83
           L+SF+ + ++           L++ L+  Y  P  +P+      +IV+LG          
Sbjct: 39  LWSFLAFALVYFCSTEFGANTLMEPLEARY--PAFAPEELPKAEVIVVLGG--------- 87

Query: 84  AIRIEPSF-------QSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNN 136
           AI  E  F        +  R+     LY       M   +++SGG P      E+ +   
Sbjct: 88  AIDGESRFGRGGDATHAADRLLTAAELYA----RKMAPYMLLSGGAPSGQ-RPEADLMAE 142

Query: 137 KLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG 196
           KL   GV R  + LE  S  TF NA  S+ M+     ++I+LV+S  H++R+   F+ FG
Sbjct: 143 KLEFMGVPRSAMLLEPASRTTFDNAVNSADMLNARNYRHILLVTSGAHMRRAVALFEAFG 202

Query: 197 INTKASCSDYLNAYYSI-----IPLSANFYLTELALKEYIG 232
           +   A  +D+    Y+      +P +     +  A+ E++G
Sbjct: 203 LQVTAVATDHQIPRYAPTVPGWLPTADRLARSTRAVHEWVG 243


>gi|315659320|ref|ZP_07912184.1| conserved hypothetical protein [Staphylococcus lugdunensis M23590]
 gi|315495745|gb|EFU84076.1| conserved hypothetical protein [Staphylococcus lugdunensis M23590]
          Length = 317

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 81/171 (47%), Gaps = 17/171 (9%)

Query: 33  FSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQ 92
           FS I    + T  L +L FS     ++     DG  I++LG G       P +       
Sbjct: 117 FSLIAISTLTTFAL-YLCFSSAFGRMTNHCTFDG--IIVLGAGIFTEAVTPLLA------ 167

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLET 152
             SR+   + +Y    Q S HCTII+SGG  +   ++E++     LL  GV    I +E 
Sbjct: 168 --SRLNRALSIYN---QQS-HCTIIVSGGQGKDEPISEALAMKRYLLSHGVPEQSIIMEA 221

Query: 153 QSLDTFQNAQFSSSMIKNMQGK--NIILVSSAYHLKRSQLYFQHFGINTKA 201
            S +T +N  +S S+I  M  K   +++V+S +H+ R+  + Q FG+  + 
Sbjct: 222 HSTNTAENFLYSKSIIDAMTPKPNKLLVVTSQFHILRALRFAQKFGLPVQG 272


>gi|289550052|ref|YP_003470956.1| membrane protein [Staphylococcus lugdunensis HKU09-01]
 gi|289179584|gb|ADC86829.1| membrane protein [Staphylococcus lugdunensis HKU09-01]
          Length = 317

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 81/171 (47%), Gaps = 17/171 (9%)

Query: 33  FSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQ 92
           FS I    + T  L +L FS     ++     DG  I++LG G       P +       
Sbjct: 117 FSLIAISTLTTFAL-YLCFSSAFGRMTNHCTFDG--IIVLGAGIFTEAVTPLLA------ 167

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLET 152
             SR+   + +Y    Q S HCTII+SGG  +   ++E++     LL  GV    I +E 
Sbjct: 168 --SRLNRALSIYN---QQS-HCTIIVSGGQGKDEPISEALAMKRYLLSHGVPEQSIIMEA 221

Query: 153 QSLDTFQNAQFSSSMIKNMQGK--NIILVSSAYHLKRSQLYFQHFGINTKA 201
            S +T +N  +S S+I  M  K   +++V+S +H+ R+  + Q FG+  + 
Sbjct: 222 HSTNTAENFLYSKSIIDAMTPKPNKLLVVTSQFHILRALRFAQKFGLPVQG 272


>gi|298695620|gb|ADI98842.1| probable membrane protein [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 322

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 99/218 (45%), Gaps = 40/218 (18%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPT 81
           F + C  LL +FI + ++ T+  +H             + K+ +II++LG G  T  +  
Sbjct: 117 FAILCLSLLLTFICY-LVWTVSYRH-----------RSYNKEVDIIIVLGAGIFTEFVTP 164

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES 141
           + A R++ +   Y             +Q +    II+SGG      + E++     L+  
Sbjct: 165 MLAARLDRALDIY-------------QQQASATKIIVSGGQGPDEPIPEALAMQRYLIAH 211

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNIILVSSAYHLKRSQLYFQHFGINT 199
           GV++ DI +E+ S++T+ N  +S  +I N+  +   I+ V+S +H+ R+    Q  G++ 
Sbjct: 212 GVDKTDILMESHSINTYTNFLYSKQIINNLYHEAVKIVCVTSQFHVLRALRLAQKLGLSI 271

Query: 200 KASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
               S            +   +   + +K+Y+G++  Y
Sbjct: 272 DGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|254931387|ref|ZP_05264746.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|293582938|gb|EFF94970.1| conserved hypothetical protein [Listeria monocytogenes HPB2262]
 gi|328475355|gb|EGF46128.1| hypothetical protein LM220_00285 [Listeria monocytogenes 220]
 gi|332311412|gb|EGJ24507.1| Integral membrane protein [Listeria monocytogenes str. Scott A]
          Length = 344

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 88/182 (48%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   ++ Y K   +     T I+
Sbjct: 159 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLNRAIKFYDKQYAKKGKRATFIV 209

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+      LLE G++ + I +E QS++T QN +FS + M   M   N +
Sbjct: 210 SGGQGANETISEAEAMRGYLLEKGIDENFIIMEDQSVNTLQNMKFSKAKMDAIMSNYNSL 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ +Y +  G+ ++   +            +A +Y+    ++E+I I + Y
Sbjct: 270 FSTNNFHLFRAGIYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAITVMY 318

Query: 238 YR 239
            +
Sbjct: 319 KK 320


>gi|17546687|ref|NP_520089.1| hypothetical protein RSc1968 [Ralstonia solanacearum GMI1000]
 gi|17428986|emb|CAD15670.1| probable transmembrane protein [Ralstonia solanacearum GMI1000]
          Length = 265

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 65/127 (51%), Gaps = 10/127 (7%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           ++ +GG P+ +G+ E+ +    + + G  +D   +ET+S  T +NA FS+ M++    + 
Sbjct: 132 VLATGGAPEGNGVPEAELMRRLVADMG--QDARWIETRSATTEENAAFSAPMLRAAGIRR 189

Query: 176 IILVSSAYHLKRSQLYFQHFGIN-TKASCS-------DYLNAYYSIIPLSANFYLTELAL 227
           I LV+  +H+ R++ YF+  G   T A C               S++P +    LT  AL
Sbjct: 190 IYLVTHYWHMARARRYFEGQGFTVTPAPCGWGGEVEESPAGGILSLLPRTDGLMLTRFAL 249

Query: 228 KEYIGIL 234
           +E +G L
Sbjct: 250 REALGQL 256


>gi|300865598|ref|ZP_07110374.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300336399|emb|CBN55524.1| conserved exported hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 236

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 99/220 (45%), Gaps = 29/220 (13%)

Query: 39  GIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIF 98
           G I   L++ L+     P   PQ +     IV+LG G  I P +P        ++  RI 
Sbjct: 26  GWIAQNLVRSLETQNLPPTPIPQTRA----IVVLGGG--IKPALPPRPWVEVGEAGDRIL 79

Query: 99  ETMRLYKSCKQHSMHCTIIISGG--DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
              +LY+  K       +I+SGG  + +  G  ES          GV    I  +  SL+
Sbjct: 80  YGSQLYRQGK----APWLILSGGRVEWKGGGPPESADMAEIAQAMGVPTSAILQDPTSLN 135

Query: 157 TFQNAQFSSSMIK--NMQGKNIILVSSAYHLKRSQLYFQHFGINT--------------K 200
           T+QNA     ++K  N+ G  I+LV+SA H+ RS L FQ  GI T              +
Sbjct: 136 TYQNAVNVRKILKDNNILGP-ILLVTSALHMPRSLLIFQRQGIETIPAPTDFSITQQDME 194

Query: 201 ASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           AS S +     +++P + N   +  ALKEYIG+ +   RG
Sbjct: 195 ASQSSFQAVLLNLLPDAYNLQQSTKALKEYIGLAVYRLRG 234


>gi|228936112|ref|ZP_04098918.1| hypothetical protein bthur0009_45540 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228823567|gb|EEM69393.1| hypothetical protein bthur0009_45540 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
          Length = 302

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 108/240 (45%), Gaps = 35/240 (14%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +L S +FL +S        ++ IF     + L+ FI    +   L  +  + + RP    
Sbjct: 65  ILFSILFLFISPASFFSPHLQPIFGGISLITLYFFIH---LSNFLSAYFLYQFNRP---- 117

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
             +++ + I++LG+G     +P + A          SRI + +  Y      +   TII 
Sbjct: 118 --RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQAAVNTPPTIIF 165

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK-N 175
           SGG     GL E+       +E G+  +    E +S++T+QN  FS  ++ ++  +GK  
Sbjct: 166 SGGQGPDEGLPEAEAMQKYAVEKGIPIEHTVQENRSVNTYQNMSFSKEIMDSLKPEGKYR 225

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 226 SIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIVV 274


>gi|228993553|ref|ZP_04153461.1| hypothetical protein bpmyx0001_42800 [Bacillus pseudomycoides DSM
           12442]
 gi|228766144|gb|EEM14790.1| hypothetical protein bpmyx0001_42800 [Bacillus pseudomycoides DSM
           12442]
          Length = 342

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 106/238 (44%), Gaps = 33/238 (13%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           MLL  + LIV          + IF    F++++ F     I T L  +  + + RP    
Sbjct: 107 MLLIMLSLIVDPTRFFSPHFQPIFTGIFFIMVYFFFH---ISTFLTAYFLYQFNRP---- 159

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
             +++ + I++LG+G     +P + A          SRI + +  Y      +   TII 
Sbjct: 160 --RRNQDFIIVLGSGLINDKVPPLLA----------SRINKAIDFYHKQAAVASPPTIIF 207

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NII 177
           SGG      L E+       +E G+  +    E +S++T+QN  FS  ++ +++ +   I
Sbjct: 208 SGGQGPDENLPEAEAMQKYAIEKGIPIEHTVQENRSVNTYQNMLFSKQIMDSLKDRYKSI 267

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
             ++ +HL R+ LY +  G+N++   S            +A +Y     ++EYI I++
Sbjct: 268 FTTNNFHLFRAGLYAKQAGLNSQGIGSK-----------TAFYYWPNAMIREYIAIVV 314


>gi|152992958|ref|YP_001358679.1| hypothetical protein SUN_1369 [Sulfurovum sp. NBC37-1]
 gi|151424819|dbj|BAF72322.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 251

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 105/205 (51%), Gaps = 27/205 (13%)

Query: 3   LSWIFLIVSYWHLLCQSIRK----IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLL 58
           L   F +++ + L  Q +R+    ++    ++ LFS+  +     ILL  ++ +Y     
Sbjct: 18  LGVFFFLMAIFFLSRQKVRRAKSFLYVGIIWLFLFSYAPFA---NILLHPIESAYSALQH 74

Query: 59  SPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
           +P   K+   I +LGNG T   T+P I  + + ++  R+ E +RLY+   Q   + TII+
Sbjct: 75  AP---KNTRYIYVLGNGHTTDRTLP-ITSQLASEAIVRLNEGIRLYR---QLEGNATIIL 127

Query: 119 SG----GDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
           SG     DP  H   +      KL  + G++  D+ L T + DT + AQ +  + K+   
Sbjct: 128 SGYEGLHDPTPHAFMQ-----EKLATALGIDPKDLILRTTAKDTEEEAQAARQIAKD--- 179

Query: 174 KNIILVSSAYHLKRSQLYFQHFGIN 198
           + +ILV+SAYH+ R+  +F+  G++
Sbjct: 180 QPLILVTSAYHMPRAMGWFEKEGLH 204


>gi|299066425|emb|CBJ37610.1| conserved exported protein of unknown function [Ralstonia
           solanacearum CMR15]
          Length = 265

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 10/125 (8%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           ++ +GG P+ +G+ E+ +    + + G  +D   +ET+S  T +NA FS+ M++    + 
Sbjct: 132 VLATGGAPEGNGVPEAELMRRLVADMG--QDARWIETRSATTEENAAFSAPMLRAAGIRR 189

Query: 176 IILVSSAYHLKRSQLYFQHFGIN-TKASCS-------DYLNAYYSIIPLSANFYLTELAL 227
           I LV+  +H+ R++ YF+  G   T A C               S++P +    LT  AL
Sbjct: 190 IYLVTHYWHMARARRYFEGQGFTVTPAPCGWGGEVEESPAGGILSLLPRTDGLMLTRFAL 249

Query: 228 KEYIG 232
           +E +G
Sbjct: 250 REALG 254


>gi|154248380|ref|YP_001419338.1| hypothetical protein Xaut_4460 [Xanthobacter autotrophicus Py2]
 gi|154162465|gb|ABS69681.1| protein of unknown function DUF218 [Xanthobacter autotrophicus Py2]
          Length = 267

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 93/194 (47%), Gaps = 25/194 (12%)

Query: 60  PQWKKDGNI---IVLLGNGTTIIPTIPAIRIEPSF-QSYSRIFETMRLYKSCKQHSMH-- 113
           PQ+K DG     I++LG      P I  +R  PSF ++  R      L +   Q  +   
Sbjct: 72  PQFKDDGTPVTGIIMLGGSEK--PEIGNVRGLPSFGEAGERPIAFAALSRRYPQARLAFV 129

Query: 114 --CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM 171
               ++   GD       E+ +    L + G+    ++ E +S +T +NA+F+ +++K  
Sbjct: 130 GGSGLLFPNGD-----AVEAQMIRMSLPDLGIPEARVEFEGKSRNTAENAEFAKALLKPK 184

Query: 172 QGKNIILVSSAYHLKRSQLYFQHFG-------INTKASCSDYLNAYYSIIPLSANFYLTE 224
            G+  +LV+SA+H+ R+   F+  G       ++ + +  D L+  +S    +     T+
Sbjct: 185 PGERWLLVTSAWHMPRAVGCFRKVGFDVVPYPVDFQTAAPDRLDQPFSRA--ADGLDKTD 242

Query: 225 LALKEYIGILIAYY 238
           +A +E+IG L+AYY
Sbjct: 243 VATREWIG-LVAYY 255


>gi|291246382|ref|YP_003505768.1| protein of unknown function DUF218 [Staphylococcus simulans bv.
           staphylolyticus]
 gi|290463913|gb|ADD24900.1| protein of unknown function DUF218 [Staphylococcus simulans bv.
           staphylolyticus]
          Length = 304

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 22/149 (14%)

Query: 61  QWKK-DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
            WK+ D   IV+LG+G       P ++        SRI + + +Y+  K+    C +I+S
Sbjct: 129 NWKRRDLKYIVVLGSGLRGDQVTPLLK--------SRIDKAINIYRGQKK----CKMIMS 176

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK--NII 177
           GG  +   + ES+   N  + SGV ++DI  ETQS +T +N Q S ++   M GK   I 
Sbjct: 177 GGQGEDELIPESVAMLNYAVNSGVSKEDIITETQSKNTRENIQLSYNL---MMGKPERIA 233

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDY 206
           +V++ YHL R+ L  +      K  C  Y
Sbjct: 234 IVTNYYHLFRALLIAKE----NKIKCIGY 258


>gi|283471580|emb|CAQ50791.1| membrane protein [Staphylococcus aureus subsp. aureus ST398]
          Length = 322

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 85/180 (47%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 143 YTKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 189

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      ++E++     L+  GV++ DI +E+ S++T+ N  +S  +I N+  +   I+
Sbjct: 190 GGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHEAVKIV 249

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S            +   +   + +K+Y+G++  Y
Sbjct: 250 CVTSQFHVLRALRLAQKLGLSIDGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|116329099|ref|YP_798819.1| hypothetical protein LBL_2520 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116330291|ref|YP_800009.1| hypothetical protein LBJ_0560 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116121843|gb|ABJ79886.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116123980|gb|ABJ75251.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 273

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 80/156 (51%), Gaps = 15/156 (9%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQK--HGLAESIVYNNKLLESGVERDDIKL 150
           S  R+ ET+RLY++ K       I+ SGG        + ES      L + G+    + L
Sbjct: 105 SAERLTETVRLYRAKKAPK----ILFSGGSGNLLYQTVPESEPAGRFLKQMGIPDSSLIL 160

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E++S +T +N  F+  ++K     ++ILV+S++H+KRS   FQ  GI      +D+    
Sbjct: 161 ESKSRNTVENKNFAVELLKKHGWSSVILVTSSFHMKRSVEIFQEKGITIIPFPTDF-RTQ 219

Query: 211 YSIIPLSANFYL-------TELALKEYIGILIAYYR 239
            S++ L  NF+        + +++KE+IGIL+   R
Sbjct: 220 KSVLTLD-NFFPSTGCLENSTISIKEWIGILVHKIR 254


>gi|258442759|ref|ZP_05691319.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|282893804|ref|ZP_06302036.1| hypothetical protein SGAG_01156 [Staphylococcus aureus A8117]
 gi|257851880|gb|EEV75814.1| conserved hypothetical protein [Staphylococcus aureus A8115]
 gi|282763862|gb|EFC03990.1| hypothetical protein SGAG_01156 [Staphylococcus aureus A8117]
          Length = 322

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 85/180 (47%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 143 YNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 189

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      ++E++     L+  GV++ DI +E+ S++T+ N  +S  +I N+  +   I+
Sbjct: 190 GGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHEAVKIV 249

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S            +   +   + +K+Y+G++  Y
Sbjct: 250 CVTSQFHVLRALRLAQKLGLSIDGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|170749150|ref|YP_001755410.1| hypothetical protein Mrad2831_2743 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655672|gb|ACB24727.1| protein of unknown function DUF218 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 281

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 64/116 (55%), Gaps = 6/116 (5%)

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLK 186
           G+AE+ + + +    GV R  + LE +S +T +NA FS++++K   G+  +LV+SA+H+ 
Sbjct: 137 GMAEADIVSRQADVIGVPRTRLILENRSRNTHENAAFSAALVKPKPGERWLLVTSAWHMP 196

Query: 187 RSQLYFQHFGINTKASCSDYLNAYYSIIP-----LSANFYLTELALKEYIGILIAY 237
           R+   F+  G    A   DY    +S +       S      +LA+KE+IG L+AY
Sbjct: 197 RAVGCFRQAGFAVDAFPVDYRTRGWSDVAHFHGFASDGLLQFDLAVKEWIG-LVAY 251


>gi|253734225|ref|ZP_04868390.1| membrane protein [Staphylococcus aureus subsp. aureus TCH130]
 gi|253727920|gb|EES96649.1| membrane protein [Staphylococcus aureus subsp. aureus TCH130]
          Length = 322

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 85/180 (47%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 143 YNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 189

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      ++E++     L+  GV++ DI +E+ S++T+ N  +S  +I N+  +   I+
Sbjct: 190 GGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHEAVKIV 249

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S            +   +   + +K+Y+G++  Y
Sbjct: 250 CVTSQFHVLRALRLAQKLGLSIDGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|15925348|ref|NP_372882.1| hypothetical protein SAV2358 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927938|ref|NP_375471.1| hypothetical protein SA2148 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21284008|ref|NP_647096.1| hypothetical protein MW2279 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49487141|ref|YP_044362.1| hypothetical protein SAS2249 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650902|ref|YP_187160.1| hypothetical protein SACOL2354 [Staphylococcus aureus subsp. aureus
           COL]
 gi|87162083|ref|YP_494939.1| hypothetical protein SAUSA300_2304 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88196279|ref|YP_501100.1| hypothetical protein SAOUHSC_02638 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148268795|ref|YP_001247738.1| hypothetical protein SaurJH9_2382 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150394865|ref|YP_001317540.1| hypothetical protein SaurJH1_2428 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|151222471|ref|YP_001333293.1| hypothetical protein NWMN_2259 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156980673|ref|YP_001442932.1| hypothetical protein SAHV_2342 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161510552|ref|YP_001576211.1| hypothetical protein USA300HOU_2340 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221141291|ref|ZP_03565784.1| hypothetical protein SauraJ_06573 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253314698|ref|ZP_04837911.1| hypothetical protein SauraC_00695 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|255007134|ref|ZP_05145735.2| hypothetical protein SauraM_11715 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257794700|ref|ZP_05643679.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|258407380|ref|ZP_05680523.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|258422292|ref|ZP_05685204.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|258439684|ref|ZP_05690430.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|258446541|ref|ZP_05694696.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|258450342|ref|ZP_05698434.1| conserved hypothetical protein [Staphylococcus aureus A6224]
 gi|258452631|ref|ZP_05700635.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|262049818|ref|ZP_06022682.1| hypothetical protein SAD30_0164 [Staphylococcus aureus D30]
 gi|262052093|ref|ZP_06024302.1| hypothetical protein SA930_1560 [Staphylococcus aureus 930918-3]
 gi|269203990|ref|YP_003283259.1| hypothetical protein SAAV_2423 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282925248|ref|ZP_06332907.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|282926912|ref|ZP_06334539.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|284025381|ref|ZP_06379779.1| hypothetical protein Saura13_12367 [Staphylococcus aureus subsp.
           aureus 132]
 gi|294848900|ref|ZP_06789645.1| hypothetical protein SKAG_00971 [Staphylococcus aureus A9754]
 gi|295405045|ref|ZP_06814858.1| hypothetical protein SMAG_00190 [Staphylococcus aureus A8819]
 gi|296275444|ref|ZP_06857951.1| hypothetical protein SauraMR_03830 [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297209823|ref|ZP_06926219.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|297244102|ref|ZP_06927992.1| hypothetical protein SLAG_00189 [Staphylococcus aureus A8796]
 gi|300910835|ref|ZP_07128285.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304379551|ref|ZP_07362285.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|13702309|dbj|BAB43450.1| SA2148 [Staphylococcus aureus subsp. aureus N315]
 gi|14248132|dbj|BAB58520.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50]
 gi|21205451|dbj|BAB96144.1| MW2279 [Staphylococcus aureus subsp. aureus MW2]
 gi|49245584|emb|CAG44062.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57285088|gb|AAW37182.1| membrane protein, putative [Staphylococcus aureus subsp. aureus
           COL]
 gi|87128057|gb|ABD22571.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203837|gb|ABD31647.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741864|gb|ABQ50162.1| protein of unknown function DUF218 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149947317|gb|ABR53253.1| protein of unknown function DUF218 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|150375271|dbj|BAF68531.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156722808|dbj|BAF79225.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
 gi|160369361|gb|ABX30332.1| hypothetical membrane protein [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|257788672|gb|EEV27012.1| conserved hypothetical protein [Staphylococcus aureus A9781]
 gi|257840892|gb|EEV65343.1| conserved hypothetical protein [Staphylococcus aureus A9763]
 gi|257841723|gb|EEV66160.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gi|257847460|gb|EEV71462.1| conserved hypothetical protein [Staphylococcus aureus A9299]
 gi|257854609|gb|EEV77557.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gi|257856434|gb|EEV79343.1| conserved hypothetical protein [Staphylococcus aureus A6224]
 gi|257859703|gb|EEV82547.1| conserved hypothetical protein [Staphylococcus aureus A5948]
 gi|259159994|gb|EEW45029.1| hypothetical protein SA930_1560 [Staphylococcus aureus 930918-3]
 gi|259162125|gb|EEW46703.1| hypothetical protein SAD30_0164 [Staphylococcus aureus D30]
 gi|262076280|gb|ACY12253.1| hypothetical protein SAAV_2423 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941943|emb|CBI50354.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282591363|gb|EFB96436.1| conserved hypothetical protein [Staphylococcus aureus A10102]
 gi|282592649|gb|EFB97658.1| conserved hypothetical protein [Staphylococcus aureus A9765]
 gi|285818021|gb|ADC38508.1| Integral membrane protein [Staphylococcus aureus 04-02981]
 gi|294824279|gb|EFG40703.1| hypothetical protein SKAG_00971 [Staphylococcus aureus A9754]
 gi|294969990|gb|EFG46008.1| hypothetical protein SMAG_00190 [Staphylococcus aureus A8819]
 gi|296885496|gb|EFH24433.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|297178880|gb|EFH38125.1| hypothetical protein SLAG_00189 [Staphylococcus aureus A8796]
 gi|300887815|gb|EFK83010.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302752229|gb|ADL66406.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|304341896|gb|EFM07801.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|312830705|emb|CBX35547.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315128719|gb|EFT84720.1| hypothetical membrane protein [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315198096|gb|EFU28427.1| hypothetical membrane protein [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|329315045|gb|AEB89458.1| Membrane protein, putative [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329723592|gb|EGG60121.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           21172]
 gi|329726055|gb|EGG62528.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           21189]
 gi|329730403|gb|EGG66793.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           21193]
          Length = 322

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 85/180 (47%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 143 YNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 189

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      ++E++     L+  GV++ DI +E+ S++T+ N  +S  +I N+  +   I+
Sbjct: 190 GGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHEAVKIV 249

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S            +   +   + +K+Y+G++  Y
Sbjct: 250 CVTSQFHVLRALRLAQKLGLSIDGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|46907236|ref|YP_013625.1| hypothetical protein LMOf2365_1025 [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47094138|ref|ZP_00231859.1| membrane protein, putative [Listeria monocytogenes str. 4b H7858]
 gi|226223622|ref|YP_002757729.1| hypothetical protein Lm4b_01024 [Listeria monocytogenes Clip81459]
 gi|254823724|ref|ZP_05228725.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
 gi|254827949|ref|ZP_05232636.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|254994315|ref|ZP_05276505.1| hypothetical protein LmonocytoFSL_16035 [Listeria monocytogenes FSL
           J2-064]
 gi|255521903|ref|ZP_05389140.1| hypothetical protein LmonocFSL_11877 [Listeria monocytogenes FSL
           J1-175]
 gi|46880503|gb|AAT03802.1| putative membrane protein [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47017485|gb|EAL08297.1| membrane protein, putative [Listeria monocytogenes str. 4b H7858]
 gi|225876084|emb|CAS04790.1| unnamed protein product [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
 gi|258600331|gb|EEW13656.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165]
 gi|293592945|gb|EFG00706.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194]
          Length = 344

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 88/182 (48%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   ++ Y K   +     T I+
Sbjct: 159 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLNRAIKFYDKQYAKKGKRATFIV 209

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+      L+E G++ + I +E QS++T QN +FS + M   M   N +
Sbjct: 210 SGGQGANETISEAEAMRGYLIEKGIDENFIIMEDQSVNTLQNMKFSKAKMDAIMSNYNSL 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ +Y +  G+ ++   +            +A +Y+    ++E+I I + Y
Sbjct: 270 FSTNNFHLFRAGIYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAITVMY 318

Query: 238 YR 239
            +
Sbjct: 319 KK 320


>gi|258512251|ref|YP_003185685.1| hypothetical protein Aaci_2287 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257478977|gb|ACV59296.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 259

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 88/192 (45%), Gaps = 18/192 (9%)

Query: 59  SPQWKKDGNIIVLLGNG-TTIIPTI--PAIRIEPSF-QSYSRIFETMRLYKSCKQHSMHC 114
           +P  +  G+ IV+LG G +   P    PA+     +  S  R+     LY+      +H 
Sbjct: 68  APPARPTGDAIVVLGAGFSAATPDFADPALDTGTLYGDSGERVLAAAALYRR-----LHL 122

Query: 115 TIIISGGD---PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM 171
            I++SGG          A +++    L   GV + D+ ++  S  T +NA+ ++ M++ +
Sbjct: 123 PIVLSGGPLIRANGKSYAFALIAARDLAALGVPQRDLYVDATSRTTEENAEHTAVMLRRL 182

Query: 172 QGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA------YYSIIPLSANFYLTEL 225
                ILV+SA  + R+ + F+  G+  +     Y+ +       Y+ +P  A    T  
Sbjct: 183 HRSRPILVASAAQMARAVIDFRRVGVKVEPYPVGYVASSVCTPLAYAWLPSQAGLDETCT 242

Query: 226 ALKEYIGILIAY 237
           AL E +GIL A+
Sbjct: 243 ALHEDLGILAAH 254


>gi|188590697|ref|YP_001920933.1| integral membrane protein [Clostridium botulinum E3 str. Alaska
           E43]
 gi|188500978|gb|ACD54114.1| integral membrane protein [Clostridium botulinum E3 str. Alaska
           E43]
          Length = 357

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 86/182 (47%), Gaps = 23/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           P+  +D   I++LG+G      +   R+ P   S  RI + +  Y    Q +    II S
Sbjct: 170 PKLNQD--FIIVLGSG------LIGDRVPPLLAS--RIDKAIEFYNKQSQVTNPPKIIFS 219

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      ++E+       +  G+  +D  +E  S+ T +N +FS ++++N+  +G   I
Sbjct: 220 GGQGPDEKVSEAFAMQKYAVNKGITIEDTIIEDNSVSTLENMKFSKNIMENLMPEGYRSI 279

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ YHL R+ +Y +  GI ++   S            +A ++L    ++EYI I++ Y
Sbjct: 280 FTTNNYHLFRAGIYARLAGIKSQGVGSK-----------TALYFLPNAMIREYIAIVVMY 328

Query: 238 YR 239
            +
Sbjct: 329 KK 330


>gi|300703732|ref|YP_003745334.1| hypothetical protein RCFBP_11417 [Ralstonia solanacearum CFBP2957]
 gi|299071395|emb|CBJ42714.1| conserved exported protein of unknown function [Ralstonia
           solanacearum CFBP2957]
          Length = 265

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 66/127 (51%), Gaps = 10/127 (7%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           ++ +GG PQ  G+ E+ +    + + G  +D   +ET+S  T +NA FS+ M++    + 
Sbjct: 132 VLATGGAPQGLGVPEAELMGRLVADLG--QDARWIETRSATTEENAAFSAPMLRAAGIQR 189

Query: 176 IILVSSAYHLKRSQLYFQHFG-INTKASCS-------DYLNAYYSIIPLSANFYLTELAL 227
           I LV+  +H+ R++ YF+  G I T A C          +    S++P +    LT  AL
Sbjct: 190 IYLVTHYWHMARARRYFEGQGLIVTPAPCGWGGEVGESPVGGILSLLPRTDGLALTRSAL 249

Query: 228 KEYIGIL 234
           +E +G L
Sbjct: 250 REALGQL 256


>gi|257876627|ref|ZP_05656280.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
 gi|257810793|gb|EEV39613.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
          Length = 356

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 98/232 (42%), Gaps = 36/232 (15%)

Query: 14  HLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG 73
           H     IR +F +    LL+ F+       + L  L  S       P++ +D   I++LG
Sbjct: 131 HFFPDWIRTLFGIVPLSLLYLFV-------VFLNFLSISVIYQFNHPRYNQD--FIIVLG 181

Query: 74  ----NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLA 129
               NGTT+ P + A RI  +   Y   F         K       +++SGG      L 
Sbjct: 182 AGLLNGTTVSPLL-AKRINTAISFYESQF---------KAKKTAPRLLMSGGQGSDEQLP 231

Query: 130 ESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ--GKNIILVSSAYHLKR 187
           E++   +  +  GV   +I +ET S  T++N +FS  ++ +++  G   I  S+ YH+ R
Sbjct: 232 EAVAMKDYAIAQGVPEGEILVETNSTTTYENMKFSKEIMDSLKPNGYKAIFASNNYHIFR 291

Query: 188 SQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           + LY        KA       A+Y         YL    L+E++ IL  + R
Sbjct: 292 AGLYADQ--AQLKADGIGAPTAFY---------YLPNAFLREFVAILFMHKR 332


>gi|224502681|ref|ZP_03670988.1| hypothetical protein LmonFR_09199 [Listeria monocytogenes FSL
           R2-561]
 gi|254832250|ref|ZP_05236905.1| hypothetical protein Lmon1_12929 [Listeria monocytogenes 10403S]
          Length = 312

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 88/182 (48%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   ++ Y K   +     T I+
Sbjct: 127 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLNRAIKFYDKQYAKKGKRATFIV 177

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+      L+E G++ + I +E QS++T QN +FS + M   M   N +
Sbjct: 178 SGGQGANETISEAEAMRGYLIEQGIDENFIIMEDQSVNTLQNMKFSKAKMDAIMSNYNSL 237

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ +Y +  G+ ++   +            +A +Y+    ++E+I I + Y
Sbjct: 238 FSTNNFHLFRAGIYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAITVMY 286

Query: 238 YR 239
            +
Sbjct: 287 KK 288


>gi|16803044|ref|NP_464529.1| hypothetical protein lmo1004 [Listeria monocytogenes EGD-e]
 gi|47096336|ref|ZP_00233932.1| membrane protein, putative [Listeria monocytogenes str. 1/2a F6854]
 gi|224500750|ref|ZP_03669099.1| hypothetical protein LmonF1_14176 [Listeria monocytogenes Finland
           1988]
 gi|254898822|ref|ZP_05258746.1| hypothetical protein LmonJ_03375 [Listeria monocytogenes J0161]
 gi|254911689|ref|ZP_05261701.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254936015|ref|ZP_05267712.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|284801336|ref|YP_003413201.1| hypothetical protein LM5578_1086 [Listeria monocytogenes 08-5578]
 gi|284994478|ref|YP_003416246.1| hypothetical protein LM5923_1040 [Listeria monocytogenes 08-5923]
 gi|16410406|emb|CAC99082.1| lmo1004 [Listeria monocytogenes EGD-e]
 gi|47015294|gb|EAL06231.1| membrane protein, putative [Listeria monocytogenes str. 1/2a F6854]
 gi|258608603|gb|EEW21211.1| conserved hypothetical protein [Listeria monocytogenes F6900]
 gi|284056898|gb|ADB67839.1| hypothetical protein LM5578_1086 [Listeria monocytogenes 08-5578]
 gi|284059945|gb|ADB70884.1| hypothetical protein LM5923_1040 [Listeria monocytogenes 08-5923]
 gi|293589638|gb|EFF97972.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 344

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 88/182 (48%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   ++ Y K   +     T I+
Sbjct: 159 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLNRAIKFYDKQYAKKGKRATFIV 209

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+      L+E G++ + I +E QS++T QN +FS + M   M   N +
Sbjct: 210 SGGQGANETISEAEAMRGYLIEQGIDENFIIMEDQSVNTLQNMKFSKAKMDAIMSNYNSL 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ +Y +  G+ ++   +            +A +Y+    ++E+I I + Y
Sbjct: 270 FSTNNFHLFRAGIYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAITVMY 318

Query: 238 YR 239
            +
Sbjct: 319 KK 320


>gi|307298224|ref|ZP_07578028.1| protein of unknown function DUF218 [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306916310|gb|EFN46693.1| protein of unknown function DUF218 [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 252

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 95/211 (45%), Gaps = 27/211 (12%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGW----GIIPTILLKHLQFSYQRPLLSPQ 61
           IFLI++   +     R+       M++  F  +    G    + L+ L+ +Y  P     
Sbjct: 21  IFLIIAVILIKKSEERRTKISGVVMIILCFFAYLLSTGFGTHLYLQPLERAYTAPN---- 76

Query: 62  WKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC----TII 117
               G  IV+L +G  I P               ++ +   + +  K +S+H      II
Sbjct: 77  -NVSGQAIVVLSSGIIISPE-------------GQVLDNHSVARLSKAYSLHLQTKLPII 122

Query: 118 ISGG-DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI 176
           ++G   P +  +A S +  + LL+ GV    + +E  +  T++NA++S+ +       +I
Sbjct: 123 VTGSFMPGRSTVAVSELMRDWLLDRGVASSKVIVEPMAQTTWENARYSADICSQFNWSSI 182

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYL 207
           +LV+SA H+KR+   F+ FG+      +DYL
Sbjct: 183 VLVTSAVHMKRAVTSFEKFGLRVTPFPTDYL 213


>gi|323443681|gb|EGB01294.1| hypothetical protein SAO46_0340 [Staphylococcus aureus O46]
          Length = 322

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 84/180 (46%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 143 YNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 189

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK--NII 177
           GG      + E++     L+  GV++ DI +E+ S++T+ N  +S  +I N+  K   I+
Sbjct: 190 GGQGPDEPIPEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHKAVKIV 249

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S            +   +   + +K+Y+G++  Y
Sbjct: 250 CVTSQFHVLRALRLAQKLGLSIDGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|255026242|ref|ZP_05298228.1| hypothetical protein LmonocytFSL_07670 [Listeria monocytogenes FSL
           J2-003]
          Length = 284

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 88/182 (48%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   ++ Y K   +     T I+
Sbjct: 99  PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLNRAIKFYDKQYAKKGKRATFIV 149

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+      L+E G++ + I +E QS++T QN +FS + M   M   N +
Sbjct: 150 SGGQGANETISEAEAMRGYLIEKGIDENFIIMEDQSVNTLQNMKFSKAKMDAIMSNYNSL 209

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ +Y +  G+ ++   +            +A +Y+    ++E+I I + Y
Sbjct: 210 FSTNNFHLFRAGIYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAITVMY 258

Query: 238 YR 239
            +
Sbjct: 259 KK 260


>gi|82751953|ref|YP_417694.1| hypothetical protein SAB2237 [Staphylococcus aureus RF122]
 gi|258425099|ref|ZP_05687970.1| conserved hypothetical protein [Staphylococcus aureus A9635]
 gi|82657484|emb|CAI81926.1| probable membrane protein [Staphylococcus aureus RF122]
 gi|257844933|gb|EEV68976.1| conserved hypothetical protein [Staphylococcus aureus A9635]
          Length = 322

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 84/180 (46%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 143 YNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 189

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      + E++     L+  GV++ DI +E+ S++T+ N  +S  +I N+  +   I+
Sbjct: 190 GGQGPDEPIPEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHEAVKIV 249

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S            +   +   + +K+Y+G++  Y
Sbjct: 250 CVTSQFHVLRALRLAQKLGLSIDGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|312114877|ref|YP_004012473.1| hypothetical protein Rvan_2149 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220006|gb|ADP71374.1| protein of unknown function DUF218 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 276

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 88/185 (47%), Gaps = 17/185 (9%)

Query: 67  NIIVLLGNGTTIIPTIP-AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP-- 123
            IIVL G  +  IPT   AI + PS +   R+ ET+RL     +H     +I SGG    
Sbjct: 80  GIIVLGGGVSGAIPTEGGAIPLGPSVE---RVTETLRL---ALRHP-DLPVIFSGGSGLI 132

Query: 124 -QKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
            Q            +  E  G+    ++LE +S +T +NA  S++M++    +  ILV+S
Sbjct: 133 LQLSDAPNEADAARRFFEGFGIVAPRLRLEDRSRNTLENATLSAAMLQPKPDQRWILVTS 192

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYLNAYYSII--PL---SANFYLTELALKEYIGILIA 236
           A+H++R+   F+  G         YL +    +  P    S   +  ++A KE++GI ++
Sbjct: 193 AFHMRRAAALFEAQGFRVVPWPVGYLTSGTGDLRQPFGRASEGLHRIDIATKEWLGIFVS 252

Query: 237 YYRGN 241
           +  G+
Sbjct: 253 WANGD 257


>gi|49484573|ref|YP_041797.1| hypothetical protein SAR2444 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257423840|ref|ZP_05600269.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257426523|ref|ZP_05602925.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257429159|ref|ZP_05605546.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257431805|ref|ZP_05608168.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257434765|ref|ZP_05610816.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282902270|ref|ZP_06310163.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906699|ref|ZP_06314547.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909675|ref|ZP_06317484.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911921|ref|ZP_06319717.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282915217|ref|ZP_06322994.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           M899]
 gi|282920941|ref|ZP_06328659.1| hypothetical protein SASG_01122 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282925847|ref|ZP_06333495.1| hypothetical protein SARG_01174 [Staphylococcus aureus subsp.
           aureus C101]
 gi|283959139|ref|ZP_06376580.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293497613|ref|ZP_06665467.1| hypothetical protein SCAG_00186 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293511192|ref|ZP_06669888.1| membrane protein [Staphylococcus aureus subsp. aureus M809]
 gi|293549800|ref|ZP_06672472.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295428939|ref|ZP_06821563.1| hypothetical protein SIAG_02182 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|297589565|ref|ZP_06948206.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49242702|emb|CAG41426.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257272858|gb|EEV04960.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257276154|gb|EEV07605.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257279640|gb|EEV10227.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257282684|gb|EEV12816.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257285361|gb|EEV15477.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           M876]
 gi|282312676|gb|EFB43080.1| hypothetical protein SARG_01174 [Staphylococcus aureus subsp.
           aureus C101]
 gi|282315356|gb|EFB45740.1| hypothetical protein SASG_01122 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282320938|gb|EFB51272.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           M899]
 gi|282323617|gb|EFB53933.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282326249|gb|EFB56553.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282329598|gb|EFB59119.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282596729|gb|EFC01688.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           C160]
 gi|283788731|gb|EFC27558.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290918847|gb|EFD95923.1| putative membrane protein [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291096544|gb|EFE26802.1| hypothetical protein SCAG_00186 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291465818|gb|EFF08348.1| membrane protein [Staphylococcus aureus subsp. aureus M809]
 gi|295127288|gb|EFG56930.1| hypothetical protein SIAG_02182 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|297578076|gb|EFH96789.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           MN8]
 gi|312437225|gb|ADQ76296.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|315193624|gb|EFU24020.1| hypothetical protein CGSSa00_14298 [Staphylococcus aureus subsp.
           aureus CGS00]
          Length = 322

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 84/180 (46%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 143 YNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 189

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      + E++     L+  GV++ DI +E+ S++T+ N  +S  +I N+  +   I+
Sbjct: 190 GGQGPDEPIPEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHEAVKIV 249

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S            +   +   + +K+Y+G++  Y
Sbjct: 250 CVTSQFHVLRALRLAQKLGLSIDGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|282917710|ref|ZP_06325461.1| hypothetical protein SATG_02569 [Staphylococcus aureus subsp.
           aureus D139]
 gi|283767447|ref|ZP_06340362.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           H19]
 gi|282318465|gb|EFB48824.1| hypothetical protein SATG_02569 [Staphylococcus aureus subsp.
           aureus D139]
 gi|283461326|gb|EFC08410.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           H19]
          Length = 322

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 84/180 (46%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 143 YNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 189

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      + E++     L+  GV++ DI +E+ S++T+ N  +S  +I N+  +   I+
Sbjct: 190 GGQGPDEPIPEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHEAVKIV 249

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S            +   +   + +K+Y+G++  Y
Sbjct: 250 CVTSQFHVLRALRLAQKLGLSIDGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|312866618|ref|ZP_07726833.1| putative membrane protein [Streptococcus parasanguinis F0405]
 gi|311097917|gb|EFQ56146.1| putative membrane protein [Streptococcus parasanguinis F0405]
          Length = 342

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 86/180 (47%), Gaps = 27/180 (15%)

Query: 63  KKDGNIIVLLGNGTT--IIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           +K+ + I++LG+G     +P + A R+E     Y             +Q      +I+SG
Sbjct: 157 RKEPDAIIILGSGLIGDKVPPLLAQRLEKGKAIY-------------EQFERRPKLIVSG 203

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ-GKNIILV 179
           G      +AE+      L+E GV  D I +E +S  TF+N  FS  +++    GK +++V
Sbjct: 204 GQGSDELIAEAEAMAGYLIEHGVPEDAILIENRSRTTFENLTFSKRILEEEGLGKRVLVV 263

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           ++++H  R+ ++ +   I  ++  S            +A +YL    ++E +G++  Y++
Sbjct: 264 TNSFHALRAGVFMRRLKIPGRSIGSK-----------TAFYYLPSAWIRETVGLVSLYWK 312


>gi|86749502|ref|YP_485998.1| hypothetical protein RPB_2382 [Rhodopseudomonas palustris HaA2]
 gi|86572530|gb|ABD07087.1| Protein of unknown function DUF218 [Rhodopseudomonas palustris
           HaA2]
          Length = 264

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 85/187 (45%), Gaps = 19/187 (10%)

Query: 60  PQWKKDG----NIIVLLGNGTTIIPTIPAIRIEPSFQSYS-RIFETMRLYKSCKQHSMHC 114
           P W+  G     IIVL   G  I   + A R      S + R+   + L +   Q     
Sbjct: 70  PPWQFSGRAPDGIIVL---GGAIDSEVSAARDAVELDSSAERVMAALELARDYPQ----A 122

Query: 115 TIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
            I+ SGG     ++ +AE+ +  +     GV  D   +E++S  T +NA F+  ++    
Sbjct: 123 RIVYSGGSGNLIQNSVAEAPIAADLFARFGVAPDRFVVESRSRTTAENASFTRELVSPKP 182

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL-----NAYYSIIPLSANFYLTELAL 227
           G+  +LV+SA+H+ RS   F+  G +  A+  D+      +A      LS+    T++A 
Sbjct: 183 GEVWLLVTSAFHMPRSITAFRAAGFDVTAAPVDWRTRGWGDAARPFDRLSSGLARTDVAA 242

Query: 228 KEYIGIL 234
            E+ G+L
Sbjct: 243 HEWAGLL 249


>gi|3056882|gb|AAC14002.1| unknown [Actinosynnema pretiosum subsp. auranticum]
          Length = 336

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 83/167 (49%), Gaps = 18/167 (10%)

Query: 63  KKDGNI-IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
           K+ G+  IV+LG G      +P  R+ P      R+   ++LY+          ++ SGG
Sbjct: 157 KRTGHTAIVVLGAG------VPGGRVTPLLAG--RLDRALKLYRRAAAKGASPLVVASGG 208

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI--KNMQGKNIILV 179
                  +E+ V  N L E G+  + +  E +S  T++N + SS+++  + + G+ +++V
Sbjct: 209 QGPDEPASEAEVMANYLRERGIPDEALLEERESTSTWENLRLSSALLAERGVTGR-LLVV 267

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELA 226
           +S+YH+ R+ +  +  G+  KA       A+Y  +P   N +L E A
Sbjct: 268 TSSYHVPRAAILSRRAGL--KADVRGGRTAWY-FVP---NAFLREFA 308


>gi|119502798|ref|ZP_01624883.1| hypothetical protein MGP2080_05817 [marine gamma proteobacterium
           HTCC2080]
 gi|119461144|gb|EAW42234.1| hypothetical protein MGP2080_05817 [marine gamma proteobacterium
           HTCC2080]
          Length = 236

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 83/185 (44%), Gaps = 13/185 (7%)

Query: 54  QRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH 113
           + P  SP+       IVLLG  +         R      +  R+     LY + K     
Sbjct: 49  RHPAFSPEELPAAQAIVLLGGASNGAARFG--RGADLNDAADRVMFAAELYFAGKA---- 102

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             I+ISGG P+     E+ +   +L    + R  + LETQS  TF NA  +  M+KN   
Sbjct: 103 PIILISGGAPETM-QPEAELLAQQLQALQIPRKQLLLETQSRTTFDNAVMAGEMLKNAGL 161

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI------IPLSANFYLTELAL 227
           ++I+LV+S  H++RS   F+  G+   A+ +D+    +S       IP  A    +  A+
Sbjct: 162 QHILLVTSGAHMRRSLALFERQGLQVTAAATDHQIPKFSDPYIPGWIPTYARLARSSRAI 221

Query: 228 KEYIG 232
            E++G
Sbjct: 222 HEWVG 226


>gi|157364443|ref|YP_001471210.1| hypothetical protein Tlet_1592 [Thermotoga lettingae TMO]
 gi|157315047|gb|ABV34146.1| protein of unknown function DUF218 [Thermotoga lettingae TMO]
          Length = 245

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 105/228 (46%), Gaps = 36/228 (15%)

Query: 25  FMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPA 84
           FM    L F F   G+    L+  L+ SY+  +      K  + +V+LG G    P    
Sbjct: 39  FMIFLALCFYFFSSGLGALTLVLPLERSYEISI-----PKKIDAVVVLGGGIVKTPN--- 90

Query: 85  IRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD-PQKHGLAESIVYNNKLLESGV 143
              +PS  S  R+ E +R+ K          +IISGG  P  +   E++V  +  +  G 
Sbjct: 91  -GYQPSQSSIVRLLEGVRIAKDFDSF-----LIISGGMLPLLNQPPEAVVMRDLAISLGF 144

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ--HFGI---- 197
             + I +E  +  TF+NA F+S + +    +N+++V+SA H+KR+   F    F +    
Sbjct: 145 PAEAIIIEPDAKTTFENAIFTSQICREKGFQNVVVVTSAIHMKRAIYSFSKARFTVHPCP 204

Query: 198 ------NTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
                 ++K   SDYL    +   L+AN +    A+ E IGIL  +YR
Sbjct: 205 TGYLYNHSKLGWSDYLPNRDA---LTANLW----AIHEIIGIL--WYR 243


>gi|307946395|ref|ZP_07661730.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307770059|gb|EFO29285.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 267

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 111/234 (47%), Gaps = 21/234 (8%)

Query: 18  QSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTT 77
           Q + +   +  F+  F+F G G +  IL++ L+  +Q P    Q   DG IIVL G   T
Sbjct: 35  QKLGRGLVLLSFLGFFAF-GLGPLGNILMQPLEDRFQTPEDVGQ--IDG-IIVLGGAIDT 90

Query: 78  IIPTIPAIRIEPSFQSYS-RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNN 136
           ++      R+  S  + + R+    +L +   +  +  +             AE ++   
Sbjct: 91  VVTNT---RLLTSINTAAERVTVVAQLAREHPKAEVIHSGGEGLLLGSGTSEAEGVL--P 145

Query: 137 KLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG 196
             L  G+ER+ I LE Q+ +T++NA  +   ++ ++G+  +LV+SAYH+ RS   F+  G
Sbjct: 146 LFLSFGIERERIILEDQARNTWENATLTKEQLEPIEGQRWLLVTSAYHMPRSVGVFEAAG 205

Query: 197 --------INTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGNR 242
                   ++ +         ++  + L+     T++A+KE+IG L+AYY   R
Sbjct: 206 WTGIVPYPVDQRTRGPQDAGRWF--VGLAEGLKRTDVAVKEWIG-LVAYYATGR 256


>gi|307267183|ref|ZP_07548690.1| protein of unknown function DUF218 [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306917799|gb|EFN48066.1| protein of unknown function DUF218 [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 191

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 88/182 (48%), Gaps = 22/182 (12%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSY-QRPLLSPQWKKDGNIIVLLGNGTTIIP 80
           K+     ++LL  FI  GII  +  + + F+Y ++P      KK   IIVL   G  +  
Sbjct: 2   KMILKIVWLLLVLFIIIGII--LEWQIISFAYNEKP------KKSDVIIVL---GCAVYG 50

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLE 140
            IP+    P F++  R+ E +RLY           II+SGG      ++E+      LL+
Sbjct: 51  DIPS----PFFKA--RLEEALRLY----NEGYGRYIIVSGGKGPGENISEAEAGKGYLLK 100

Query: 141 SGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTK 200
            G+    I ++ +S  T++N QFS  ++     K  +++S+ +HLKR+ +  +  GI   
Sbjct: 101 KGIPEKAILIDDKSFSTYENLQFSKEIMDKKSLKRAVIISNKFHLKRASVIAKRVGIEAS 160

Query: 201 AS 202
            S
Sbjct: 161 FS 162


>gi|296876546|ref|ZP_06900597.1| GdmH protein [Streptococcus parasanguinis ATCC 15912]
 gi|296432539|gb|EFH18335.1| GdmH protein [Streptococcus parasanguinis ATCC 15912]
          Length = 342

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 85/179 (47%), Gaps = 27/179 (15%)

Query: 64  KDGNIIVLLGNGT--TIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
           K+ + I++LG+G     +P + A R+E     Y             +Q      +I+SGG
Sbjct: 158 KEPDAIIILGSGLIGDKVPPLLAQRLEKGKAIY-------------EQFERRPKLIVSGG 204

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ-GKNIILVS 180
                 +AE+      L+E GV  D I +E +S  TF+N  FS  +++    GK ++LV+
Sbjct: 205 QGSDELIAEAEAMAGYLIEHGVPEDAILIENRSRTTFENLTFSKRILEEEGLGKRVLLVT 264

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           +++H  R+ ++ +   I  ++  S            +A +YL    ++E +G++  Y++
Sbjct: 265 NSFHALRAGVFMRRLKIPGRSIGSR-----------TAFYYLPSAWIRETVGLVSLYWK 312


>gi|320140100|gb|EFW31959.1| conserved domain protein [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143369|gb|EFW35150.1| conserved domain protein [Staphylococcus aureus subsp. aureus
           MRSA177]
          Length = 208

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 87/180 (48%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 29  YNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 75

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      ++E++     L+  GV++ DI +E+ S++T+ N  +S  +I N+  +   I+
Sbjct: 76  GGQGPDEPISEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHEAVKIV 135

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S              +F+L  L +K+Y+G++  Y
Sbjct: 136 CVTSQFHVLRALRLAQKLGLSIDGVGSH----------TPYHFFLHVL-IKDYLGVMYQY 184


>gi|256377332|ref|YP_003100992.1| hypothetical protein Amir_3239 [Actinosynnema mirum DSM 43827]
 gi|255921635|gb|ACU37146.1| protein of unknown function DUF218 [Actinosynnema mirum DSM 43827]
          Length = 336

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 83/167 (49%), Gaps = 18/167 (10%)

Query: 63  KKDGNI-IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
           K+ G+  I++LG G      +P  R+ P      R+   ++LY+          ++ SGG
Sbjct: 157 KRTGHTAIIVLGAG------VPGGRVTPLLAG--RLDRALKLYRRAAAKGASPVVVASGG 208

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI--KNMQGKNIILV 179
                  +E+ V  N L E G+  + +  E +S  T++N + SS+++  + + G+ +++V
Sbjct: 209 QGPDEPASEAEVMANYLRERGIPDEALLEERESTSTWENLRLSSALLAERGVTGR-LLVV 267

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELA 226
           +S+YH+ R+ +  +  G+  KA       A+Y  +P   N +L E A
Sbjct: 268 TSSYHVPRAAILSRRAGL--KADVRGGRTAWY-FVP---NAFLREFA 308


>gi|78188131|ref|YP_378469.1| hypothetical protein Cag_0148 [Chlorobium chlorochromatii CaD3]
 gi|78170330|gb|ABB27426.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 251

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 91/212 (42%), Gaps = 26/212 (12%)

Query: 41  IPTILLKHLQF-SYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQ-----SY 94
           IPT+    + F    R +  PQ     + IV+LG            R+E + +     + 
Sbjct: 46  IPTVADGLMHFVEGNRTVALPQTLHQADAIVVLGGMIR--------RVEGAAEGEWNDAA 97

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDP-QKHGLAESIVYNNKLLESGVERDDIKLETQ 153
            R    + LY++ K   +  T    G  P     + E  +   + L+ GV    + L   
Sbjct: 98  DRFEAGVTLYRAGKAPLLLFT---RGRMPWSPDAVPEGELLVERALQRGVPEAALGLTAP 154

Query: 154 SLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL------ 207
             +T   A   + +++    + IILV+SAYH++RSQL F+H G++ +    D+       
Sbjct: 155 VANTEDEAADVARLLRERGAERIILVTSAYHMRRSQLLFEHTGLSVEPYPVDFRVDSYPE 214

Query: 208 NAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
            A     P +   Y +E AL+E IG L  YYR
Sbjct: 215 PAVLRFAPSAEALYRSETALRELIGWL--YYR 244


>gi|157149755|ref|YP_001450471.1| GdmH [Streptococcus gordonii str. Challis substr. CH1]
 gi|157074549|gb|ABV09232.1| GdmH [Streptococcus gordonii str. Challis substr. CH1]
          Length = 340

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 71/133 (53%), Gaps = 12/133 (9%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           +Q      +I+SGG       +E+    N L+E GV++D I +E +S  TF+N  FS ++
Sbjct: 191 EQFEGRPKLIVSGGQGADELTSEAAAMANYLMEQGVQKDAILIENRSRTTFENLTFSKAI 250

Query: 168 IKNMQ-GKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELA 226
           ++    GK++++V++++H  R+ ++ +   I  ++  S            +A +YL    
Sbjct: 251 LEEQGLGKSVLVVTNSFHALRAGVFMRRLKIPGRSVGSK-----------TAFYYLPSAW 299

Query: 227 LKEYIGILIAYYR 239
           ++E +G++  Y++
Sbjct: 300 IRETVGLVSLYWK 312


>gi|329571446|gb|EGG53133.1| hypothetical protein HMPREF9520_02827 [Enterococcus faecalis
           TX1467]
          Length = 401

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 89/184 (48%), Gaps = 24/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   I +LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 214 PKYTQD--YIDVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 264

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 265 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 324

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ YHL R+ L+ +  G+      +            +A ++L    ++E+I I++
Sbjct: 325 AIFTTNNYHLFRAGLFARMAGLKADGIGAK-----------TAFYFLPNAFIREFIAIVV 373

Query: 236 AYYR 239
            Y R
Sbjct: 374 MYKR 377


>gi|229099276|ref|ZP_04230207.1| hypothetical protein bcere0020_44960 [Bacillus cereus Rock3-29]
 gi|228684094|gb|EEL38041.1| hypothetical protein bcere0020_44960 [Bacillus cereus Rock3-29]
          Length = 277

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 110/242 (45%), Gaps = 39/242 (16%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           ML   +  I++   L+   +  IF     + ++ FI    +   L  +  + + RP    
Sbjct: 40  MLFFMLLPIINPASLVSSHLEPIFAGISLISVYFFIH---LSNFLSAYFLYQFNRP---- 92

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC--TI 116
             +++ + I++LG+G     +P + A RI  +   Y             KQ +++   TI
Sbjct: 93  --RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPTI 138

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK 174
           I SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  ++ ++  +GK
Sbjct: 139 IFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMSFSKEIMASLKPEGK 198

Query: 175 -NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I
Sbjct: 199 YRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAI 247

Query: 234 LI 235
           ++
Sbjct: 248 VV 249


>gi|229016285|ref|ZP_04173233.1| hypothetical protein bcere0030_8630 [Bacillus cereus AH1273]
 gi|229022523|ref|ZP_04179055.1| hypothetical protein bcere0029_8750 [Bacillus cereus AH1272]
 gi|228738776|gb|EEL89240.1| hypothetical protein bcere0029_8750 [Bacillus cereus AH1272]
 gi|228745056|gb|EEL95110.1| hypothetical protein bcere0030_8630 [Bacillus cereus AH1273]
          Length = 332

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 84/175 (48%), Gaps = 28/175 (16%)

Query: 67  NIIVLLGNG---TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           + I++LG+G      +P + A R++     Y    ++ R+ K          II+SGG  
Sbjct: 163 DFIIVLGSGLIGGDRVPPLLASRLDKGMDEY---IKSGRIPK----------IIVSGGQG 209

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN-IILVSSA 182
               ++E+      L+E G+   D+  E +S +T QN  FS  ++  ++  +  I V++ 
Sbjct: 210 PDELVSEAAAMKKYLVEKGMNEKDVLTEDKSRNTLQNMLFSKKIMDTIKTDHKSIFVTNN 269

Query: 183 YHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
           YH+ R+ +Y +  G+  +   S+           +A +YL    L+EYIGIL+ Y
Sbjct: 270 YHVFRASIYARLSGLKCEGVGSN-----------TARYYLPSAFLREYIGILVMY 313


>gi|315187461|gb|EFU21217.1| protein of unknown function DUF218 [Spirochaeta thermophila DSM
           6578]
          Length = 249

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 101/210 (48%), Gaps = 35/210 (16%)

Query: 43  TILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRIEPSFQSYSRIF 98
           T L++HL  +   PL    P W   G +  +V+LG G       PA  + P   S +R++
Sbjct: 54  THLVEHLLLA---PLERAFPVWDAGGGVRYVVVLGGGAQA--GTPAGDV-PGVVSLARLW 107

Query: 99  ETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTF 158
             +R  +      +   ++++GG     G +E  +  + + E G E  ++ +E +S  T+
Sbjct: 108 GGLRYARM-----LGVPLVLAGGSVWDEGKSEGEMMADLVRELGWE--EVVVEGESRTTW 160

Query: 159 QNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSA 218
           +NA+ ++ M+       ++LV+SAYH++R+   F+  G+    +  D+ +      P   
Sbjct: 161 ENARNTARMVGR---GPVLLVTSAYHMQRAVWCFRAQGVEVIPAPVDFRDER----PAHW 213

Query: 219 NFYL---------TELALKEYIGILIAYYR 239
            FYL          + AL+EY+G++  +YR
Sbjct: 214 IFYLGISAEAARDVQAALREYVGMV--WYR 241


>gi|258455282|ref|ZP_05703242.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|257862493|gb|EEV85261.1| conserved hypothetical protein [Staphylococcus aureus A5937]
          Length = 322

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 84/180 (46%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 143 YNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 189

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNII 177
           GG      ++E +     L+  GV++ DI +E+ S++T+ N  +S  +I N+  +   I+
Sbjct: 190 GGQGPDEPISEVLAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHEAVKIV 249

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S            +   +   + +K+Y+G++  Y
Sbjct: 250 CVTSQFHVLRALRLAQKLGLSIDGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|257867722|ref|ZP_05647375.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257874049|ref|ZP_05653702.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
 gi|257801805|gb|EEV30708.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257808213|gb|EEV37035.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
          Length = 356

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 97/232 (41%), Gaps = 36/232 (15%)

Query: 14  HLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG 73
           H     IR +F +    LL+ F+       + L  L  S       P++ +D   I++LG
Sbjct: 131 HFFPDWIRTLFGIVPLSLLYLFV-------VFLNFLSISVIYQFNHPRYNQD--FIIVLG 181

Query: 74  ----NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLA 129
               NGTT+ P + A RI  +   Y   F         K       +++SGG      L 
Sbjct: 182 AGLLNGTTVSPLL-AKRINTAISFYESQF---------KAKKTAPRLLMSGGQGSDEQLP 231

Query: 130 ESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ--GKNIILVSSAYHLKR 187
           E++      +  GV   +I +ET S  T++N +FS  ++ +++  G   I  S+ YH+ R
Sbjct: 232 EAVAMKEYAIAQGVPEGEILVETNSTTTYENMKFSKEIMDSLKPNGYKAIFASNNYHIFR 291

Query: 188 SQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           + LY        KA       A+Y         YL    L+E++ IL  + R
Sbjct: 292 AGLYADQ--AQLKADGIGAPTAFY---------YLPNAFLREFVAILFMHKR 332


>gi|196041486|ref|ZP_03108779.1| conserved domain protein [Bacillus cereus NVH0597-99]
 gi|196027734|gb|EDX66348.1| conserved domain protein [Bacillus cereus NVH0597-99]
          Length = 345

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 108/240 (45%), Gaps = 35/240 (14%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +L   +F I+S   L    +  IF     ++++ FI    +   L  +  + + RP    
Sbjct: 108 ILFFILFAILSPASLFSSHLEPIFAGISLIIVYFFIH---LSNFLTAYFLYQFNRP---- 160

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
             +++ + I++LG+G     +P + A          SRI + +  Y      +   TII 
Sbjct: 161 --RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQAAVNTPPTIIF 208

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK-N 175
           SGG     GL E+       +E G+  +    E +S++T+QN  FS  ++ ++  +GK  
Sbjct: 209 SGGQGPDEGLPEAEAMQKYAVEKGIPIEHTVQENRSVNTYQNMSFSKEIMDSLKPEGKYR 268

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 269 SIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIVV 317


>gi|148255961|ref|YP_001240546.1| hypothetical protein BBta_4612 [Bradyrhizobium sp. BTAi1]
 gi|146408134|gb|ABQ36640.1| hypothetical protein BBta_4612 [Bradyrhizobium sp. BTAi1]
          Length = 262

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 100/217 (46%), Gaps = 14/217 (6%)

Query: 30  MLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEP 89
           MLL + +G   + +++L  L+  +  P   P       IIVL   G  + P +  +   P
Sbjct: 46  MLLLAVLGLTPLGSLMLSPLESRF--PKWDPAKGAPDGIIVL---GGPVDPDLSIMYGMP 100

Query: 90  -SFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERD 146
            +     R+ +   L +       +  I+ +GG          E+ V  + LL  GV ++
Sbjct: 101 VTVAGADRLIQAAALARRYP----NARIVFTGGSANLISTDAREADVAADILLSLGVAKE 156

Query: 147 DIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
            + LE +S +T++NA FS +M+    G+  +LV+SA+H+ RS   F+  G   +    D+
Sbjct: 157 RLTLERESRNTYENAVFSKAMVAPKPGERWLLVTSAFHMPRSVGLFRKAGFPVEPYPVDW 216

Query: 207 -LNAYYSIIPLS-ANFYLTELALKEYIGILIAYYRGN 241
            +     +  +S       ++A++E++G++    RG 
Sbjct: 217 RVGRVLDVDGVSLLGLRRADIAVREWVGLVAYRLRGR 253


>gi|229032461|ref|ZP_04188429.1| hypothetical protein bcere0028_45010 [Bacillus cereus AH1271]
 gi|228728830|gb|EEL79838.1| hypothetical protein bcere0028_45010 [Bacillus cereus AH1271]
          Length = 344

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 90/190 (47%), Gaps = 32/190 (16%)

Query: 51  FSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK 108
           + + RP      +++ + I++LG+G     +P + A          SRI + +  Y    
Sbjct: 154 YQFNRP------RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQA 197

Query: 109 QHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI 168
             +   TII SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  ++
Sbjct: 198 AVNTAPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMSFSKEIM 257

Query: 169 KNM--QGKN-IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTEL 225
            ++  +GK+  I  ++ +HL R+ +Y +  G+N++   S            +A +Y    
Sbjct: 258 DSLKPEGKHRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNA 306

Query: 226 ALKEYIGILI 235
            ++EY+ I++
Sbjct: 307 MIREYVAIVV 316


>gi|331701646|ref|YP_004398605.1| hypothetical protein Lbuc_1288 [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128989|gb|AEB73542.1| protein of unknown function DUF218 [Lactobacillus buchneri NRRL
           B-30929]
          Length = 351

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 103/235 (43%), Gaps = 37/235 (15%)

Query: 24  FFMSCFMLLFSFI---GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTI-- 78
           F M+   +L ++I    W  + ++LL  L F        P+  KD   I++LG G     
Sbjct: 132 FVMTFLTMLIAYILLTVWNTLSSMLLYQLYF--------PRSNKD--YIIVLGAGLVDGH 181

Query: 79  -IPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNK 137
            +  +   RI      Y++     +++++ K+      ++ SGG      L ES+   + 
Sbjct: 182 KVGRLLGGRINKGIAFYNQ-----QIHRTNKR----AKLVFSGGQGGDELLPESVAMRDY 232

Query: 138 LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---IILVSSAYHLKRS-----Q 189
            LE G    D  +E QS++TFQN +FS ++I    G     I+ V+S YH  R+     +
Sbjct: 233 ALEHGARGADTLIEDQSVNTFQNMKFSKALIDKDAGSTNHRIVFVTSNYHTLRAGILSRE 292

Query: 190 LYFQHFGINTKASCSDYLNA----YYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           +    FGI +K       NA    Y +++ +   F+L  L L     +++    G
Sbjct: 293 VGMHAFGIGSKTPFYYLPNAVIREYLALVVMHKKFHLVMLGLMLVASVIVGVLAG 347


>gi|294507679|ref|YP_003571737.1| hypothetical protein SRM_01864 [Salinibacter ruber M8]
 gi|294344007|emb|CBH24785.1| Conserved hypothetical protein [Salinibacter ruber M8]
          Length = 180

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 69/153 (45%), Gaps = 13/153 (8%)

Query: 101 MRLYKSCKQHSMHCT------IIISGG-DPQKHGLAESIVYNNKLLES-GVERDDIKLET 152
           M L   C       T      +I SGG  P K   A      N LL+  GV  D I LE+
Sbjct: 1   MTLPTGCGTRRASTTPARCPLVIASGGTQPWKRPDAREAPATNVLLQDWGVPGDAILLES 60

Query: 153 QSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN-----TKASCSDYL 207
           +S +T++NA  ++ ++       ++LV+SA H+ R+   F+  GI      T     D  
Sbjct: 61  KSANTYENATRTAELLDRRGLNCVLLVTSALHMPRALAVFRSAGIKAVPAPTDVQVGDRN 120

Query: 208 NAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
                ++P +     +  A++EY+G L+  +RG
Sbjct: 121 YTVLDVLPDAGALAGSTAAIREYVGYLVYDWRG 153


>gi|229128467|ref|ZP_04257446.1| hypothetical protein bcere0015_29130 [Bacillus cereus BDRD-Cer4]
 gi|228654970|gb|EEL10829.1| hypothetical protein bcere0015_29130 [Bacillus cereus BDRD-Cer4]
          Length = 297

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 108/236 (45%), Gaps = 37/236 (15%)

Query: 7   FLIVSYW---HLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWK 63
           FL++S     +   ++IR +++ +  + L+ FI    +   L  +  + + RP      K
Sbjct: 64  FLVISLVEPINFFPEAIRTLYWGAVLISLYLFID---LSNFLTAYFLYQFNRP------K 114

Query: 64  KDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
            + + I++LG+G     +P + A          SRI   +  YK  +  S    II SGG
Sbjct: 115 YNQDFIIVLGSGLINDKVPPLLA----------SRINRAIEFYKKQEAVSSPPKIIFSGG 164

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK--NIILV 179
                 ++E+       + +G+  ++   E +S  T+QN  FS  ++++++G   N I  
Sbjct: 165 QGSDENISEAKAMQEYAVNNGIPLENTIKEDRSTTTYQNMLFSKRIMESLKGTQYNCIFS 224

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           ++ +H+ R+ LY +  G+N++   S            +A +Y     ++EYI I +
Sbjct: 225 TNNFHVFRAGLYAKIVGLNSQGIGSK-----------TAFYYWPNAMIREYIAIFV 269


>gi|254501304|ref|ZP_05113455.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222437375|gb|EEE44054.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 176

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 50/87 (57%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           II+  G    H  AE+ V   +L+  GV +  I+ ET+S +T +NA FS+ +++  + +N
Sbjct: 49  IIVGCGGLGNHPPAEAEVMKRELIALGVPQSAIRTETRSRNTLENAVFSARILRREKLEN 108

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKAS 202
            ++VS  YHL R+ L FQ  G +   S
Sbjct: 109 TLIVSDRYHLPRAVLCFQTLGFSATGS 135


>gi|229169539|ref|ZP_04297243.1| hypothetical protein bcere0007_44860 [Bacillus cereus AH621]
 gi|228613929|gb|EEK71050.1| hypothetical protein bcere0007_44860 [Bacillus cereus AH621]
          Length = 277

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 91/192 (47%), Gaps = 36/192 (18%)

Query: 51  FSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK 108
           + + RP      +++ + I++LG+G     +P + A RI  +   Y             K
Sbjct: 87  YQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WK 128

Query: 109 QHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS 166
           Q +++   TII SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  
Sbjct: 129 QSAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMSFSKE 188

Query: 167 MIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLT 223
           ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +A +Y  
Sbjct: 189 IMDSLKPEGKYKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWP 237

Query: 224 ELALKEYIGILI 235
              ++EY+ I++
Sbjct: 238 NAMIREYVAIVV 249


>gi|229147646|ref|ZP_04275990.1| hypothetical protein bcere0012_47720 [Bacillus cereus BDRD-ST24]
 gi|228635855|gb|EEK92341.1| hypothetical protein bcere0012_47720 [Bacillus cereus BDRD-ST24]
          Length = 343

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 108/235 (45%), Gaps = 34/235 (14%)

Query: 5   WIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKK 64
           W+  ++   +   +SIR +++ +  + ++ F+    +   L  +  + + RP      K 
Sbjct: 111 WVISLIEPVNFFPESIRTLYWGAVLISIYLFVD---LSNFLTAYFLYQFNRP------KY 161

Query: 65  DGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           + + I++LG+G     +P + A          SRI   +  Y+  +  S    II SGG 
Sbjct: 162 NQDFIIVLGSGLINDKVPPLLA----------SRINRAIEFYRKQEAVSSPPKIIFSGGQ 211

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG--KNIILVS 180
                ++E+    +  +++G+  +    E +S  T+QN  +S  ++++++G   N I  +
Sbjct: 212 GPDENISEAEAMQDYAVKNGIPLEHTIKENRSTTTYQNMLYSKEIMESLKGFQYNCIFST 271

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           + +H+ R+ LY +  G+N++   S            +A +Y     ++EYI I +
Sbjct: 272 NNFHVFRAGLYAKIVGLNSQGIGSK-----------TAFYYWPNAMIREYIAIFV 315


>gi|254852499|ref|ZP_05241847.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|300764214|ref|ZP_07074209.1| hypothetical protein LMHG_10188 [Listeria monocytogenes FSL N1-017]
 gi|258605808|gb|EEW18416.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503]
 gi|300515204|gb|EFK42256.1| hypothetical protein LMHG_10188 [Listeria monocytogenes FSL N1-017]
          Length = 344

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 88/182 (48%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   ++ Y K   +     T I+
Sbjct: 159 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLNRAIKFYDKQYAKKGKRATFIV 209

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+      L+E G++ + I +E QS++T QN +FS + M   +   N +
Sbjct: 210 SGGQGANETISEAEAMRGYLIEKGIDENFIIMEDQSVNTLQNMKFSKAKMDAILSNYNSL 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ +Y +  G+ ++   +            +A +Y+    ++E+I I + Y
Sbjct: 270 FSTNNFHLFRAGIYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAITVMY 318

Query: 238 YR 239
            +
Sbjct: 319 KK 320


>gi|163942531|ref|YP_001647415.1| hypothetical protein BcerKBAB4_4633 [Bacillus weihenstephanensis
           KBAB4]
 gi|163864728|gb|ABY45787.1| protein of unknown function DUF218 [Bacillus weihenstephanensis
           KBAB4]
          Length = 344

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 93/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 148 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 193

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+    N  +E G+  +    E +S++T+QN
Sbjct: 194 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQN 249

Query: 161 AQFSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 250 MSFSKEIMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 298

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 299 AFYYWPNAMIREYVAIVV 316


>gi|239832066|ref|ZP_04680395.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824333|gb|EEQ95901.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 279

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 106/222 (47%), Gaps = 27/222 (12%)

Query: 27  SCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG--NGTTIIPTIPA 84
           + F+  F+ +G      +LL  L+  + +P   PQ + DG I+VL G  NG      I A
Sbjct: 63  TLFLAAFTTLG-----AVLLAPLEDRFAKPDAMPQ-RVDG-IVVLGGYMNGE-----INA 110

Query: 85  IRIEPSFQSYS-RIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLES 141
            R      S + RIFE MRL +          +I+SGG+    +    E+      L + 
Sbjct: 111 GRKGFELNSAADRIFEAMRLARLYPD----AKVIVSGGEGAFFEKSAKEADSTRQMLADL 166

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G   +    E +S +T +NA FS  + +   G+  +LV+SAYH+ RS   F+  G +  A
Sbjct: 167 GFSGERYIFENKSRNTVENAVFSKELAQPKPGETWLLVTSAYHMPRSIGCFRKAGFDVVA 226

Query: 202 SCSDY---LNAYYSIIPLSANFYLTE--LALKEYIGILIAYY 238
              D+    + ++++   S N  L+   +A++E+ G L AY+
Sbjct: 227 WPVDFKTRASEHFALYLESPNEALSRFSVAMREW-GGLAAYW 267


>gi|229118290|ref|ZP_04247646.1| hypothetical protein bcere0017_45590 [Bacillus cereus Rock1-3]
 gi|228665120|gb|EEL20606.1| hypothetical protein bcere0017_45590 [Bacillus cereus Rock1-3]
          Length = 345

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 93/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 149 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 194

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+    N  +E G+  +    E +S++T+QN
Sbjct: 195 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQN 250

Query: 161 AQFSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 251 MSFSKEIMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 299

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 300 AFYYWPNAMIREYVAIVV 317


>gi|153009344|ref|YP_001370559.1| hypothetical protein Oant_2014 [Ochrobactrum anthropi ATCC 49188]
 gi|151561232|gb|ABS14730.1| protein of unknown function DUF218 [Ochrobactrum anthropi ATCC
           49188]
          Length = 235

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 101/214 (47%), Gaps = 22/214 (10%)

Query: 35  FIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG--NGTTIIPTIPAIRIEPSFQ 92
           F  +  + ++LL  L+  + +P   PQ   DG I+VL G  NG      I A R      
Sbjct: 22  FAAFTTLGSVLLAPLEDRFAKPDAMPQ-HVDG-IVVLGGYMNGD-----INAGRKGFELN 74

Query: 93  SYS-RIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIK 149
           S + RIFE MRL +          +I+SGGD    +    E+      L++ G   +   
Sbjct: 75  SAADRIFEAMRLARLYPD----ARVIVSGGDGAFFEEAAKEADSTRQMLIDLGFSGERYI 130

Query: 150 LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY--- 206
            E +S +T +NA FS  + +   G+  +LV+SAYH+ RS   F+    +  A   DY   
Sbjct: 131 YENKSRNTVENAIFSKELAQPKPGETWLLVTSAYHMPRSVGCFRKADFDVVAWPVDYKTR 190

Query: 207 LNAYYSIIPLSANFYLTE--LALKEYIGILIAYY 238
               +++   S N  L+   +A++E++G L AY+
Sbjct: 191 ARERFALYLESPNEALSRFSVAMREWVG-LAAYW 223


>gi|229014000|ref|ZP_04171124.1| hypothetical protein bmyco0001_44080 [Bacillus mycoides DSM 2048]
 gi|229135650|ref|ZP_04264428.1| hypothetical protein bcere0014_45390 [Bacillus cereus BDRD-ST196]
 gi|228647830|gb|EEL03887.1| hypothetical protein bcere0014_45390 [Bacillus cereus BDRD-ST196]
 gi|228747256|gb|EEL97135.1| hypothetical protein bmyco0001_44080 [Bacillus mycoides DSM 2048]
          Length = 257

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 107/234 (45%), Gaps = 39/234 (16%)

Query: 9   IVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI 68
           I++   L  +  + IF     + ++ FI    +   L  +  + + RP      +++ + 
Sbjct: 28  IINPASLFSEHFQFIFAAISLVTMYFFIH---LSNFLSAYFLYQFNRP------RRNQDF 78

Query: 69  IVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC--TIIISGGDPQ 124
           I++LG+G     +P + A RI  +   Y             KQ +++   TII SGG   
Sbjct: 79  IIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPTIIFSGGQGP 126

Query: 125 KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK-NIILVSS 181
             GL E+    N  +E G+  +    E +S++T+QN  FS  ++ ++  +GK   I  ++
Sbjct: 127 DEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMSFSKEIMDSLKPEGKYKSIFTTN 186

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 187 NFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIVV 229


>gi|227824083|ref|YP_002828056.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
 gi|227343085|gb|ACP27303.1| putative transmembrane protein [Sinorhizobium fredii NGR234]
          Length = 261

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 107/245 (43%), Gaps = 23/245 (9%)

Query: 2   LLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQ 61
           +L  + LI++ +H        +  +  F+ LF+  G        L+ L+  + RP  SP 
Sbjct: 22  ILVGMLLILARFHRSGGVFASLGLIVLFLSLFTTTG-----PYFLQMLEDRFPRP--SPP 74

Query: 62  WKKDGNIIVLLGNGTTIIPTIPAIRIEPSF-QSYSRIFETMRLYKSCKQHSMHCTIIISG 120
             +   IIVL G    ++    A R    F Q+  R  E +RL K+         I++SG
Sbjct: 75  PAEIACIIVLGGAFENVVI---ASRGGMEFNQAADRFVEAVRLAKAYPA----ARILVSG 127

Query: 121 GDPQKHGLAESIVYNNKLLES--GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
           GD    G  E     ++   +  G+  D +  E  S  TF+NA+++  ++     +   L
Sbjct: 128 GDGSISGAYEGDARASQGFFNAFGIGADRVIREEDSRTTFENARYTKDLLAANGLERCAL 187

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDYLNA-----YYSIIPLSANFYLTELALKEYIGI 233
           V+SAYH+ RS   F+  GI      +DY  +      +     S N  L   A KE+ G 
Sbjct: 188 VTSAYHMPRSVGLFRANGIAVVPWPADYRTSGKVRLGFDFSQPSLNAQLATTAAKEWTG- 246

Query: 234 LIAYY 238
           L+AYY
Sbjct: 247 LLAYY 251


>gi|302392084|ref|YP_003827904.1| hypothetical protein Acear_1326 [Acetohalobium arabaticum DSM 5501]
 gi|302204161|gb|ADL12839.1| protein of unknown function DUF218 [Acetohalobium arabaticum DSM
           5501]
          Length = 264

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 102/206 (49%), Gaps = 30/206 (14%)

Query: 44  ILLKHLQFSYQRPLLSPQWKKDGN--IIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETM 101
           +L K L+  +   L+S +  K GN   IVLLG+G   +    +  +E    + +R++ T 
Sbjct: 69  LLTKPLESQFDPLLISNRESKVGNSTAIVLLGSG---VRRGTSRGVEIGEITLARLYRTW 125

Query: 102 RLYKSCKQHSMHCTIIISGGD-PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
           +++K          +++SGG  P     + + V    LL+ GV+ D I LE ++ +T+QN
Sbjct: 126 QIHKET-----GLDLVVSGGVVPGADNTSGAEVMKEVLLDLGVKEDKIILEKKAKNTWQN 180

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ------------HFGINTKASCSDYLN 208
           A  ++ +++  + + IILV+SA H+KR+   F+            ++  NT  S  DYL 
Sbjct: 181 AVNTALLLEEREYEQIILVTSALHMKRAVYSFERNCNQRLIPAPANYTFNTDVSLLDYL- 239

Query: 209 AYYSIIPLSANFYLTELALKEYIGIL 234
                 P   +   +  AL E+IG++
Sbjct: 240 ------PNRESLDNSLAALHEWIGLV 259


>gi|123966515|ref|YP_001011596.1| hypothetical protein P9515_12821 [Prochlorococcus marinus str. MIT
           9515]
 gi|123200881|gb|ABM72489.1| Hypothetical protein P9515_12821 [Prochlorococcus marinus str. MIT
           9515]
          Length = 236

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 103/226 (45%), Gaps = 24/226 (10%)

Query: 24  FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIP 83
           F  S  ++L  F   G+    L + L++ ++R   S     DG  IV+L  G  + P   
Sbjct: 16  FIYSALIILLVFSN-GVFSECLWRLLEYPWKRLEFSSINSADG--IVVLSGGRHL-PLGN 71

Query: 84  AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP--QKHGLAESIVYNNKLLES 141
              IE  +    R    + LYK+ K + +    I +GG      +   E  +Y  + +  
Sbjct: 72  TKIIE--WHDPDRFLAGIELYKANKSNKL----IFTGGVSLLTSNLPPEGTIYIKEAISM 125

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMI---KNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           G+ + D+       +T + A+   +++   K +  K IILV+SA+H+KR++  F+  G+N
Sbjct: 126 GIPKKDVLTTYPVYNTLEEAEAVKALLYREKPLSKKKIILVTSAFHMKRAKKVFEREGMN 185

Query: 199 TKASCSDY---------LNAYYSIIPLSANFYLTELALKEYIGILI 235
                 D+         L   +  IP S+N Y + +A++E IG +I
Sbjct: 186 VLPYPVDFKSSRNFISSLTNIFKWIPSSSNLYKSSMAVREIIGRMI 231


>gi|300769627|ref|ZP_07079511.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308179587|ref|YP_003923715.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|300492780|gb|EFK27964.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308045078|gb|ADN97621.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 340

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 94/213 (44%), Gaps = 37/213 (17%)

Query: 33  FSFIGW--GIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT-IPAIRIEP 89
           FSFI +    + T L +H Q  Y               +++LG G  ++P   P   +  
Sbjct: 142 FSFIAYLLACVMTRLGRHRQIDY---------------MIVLGAG--LMPNGQPTRTLAY 184

Query: 90  SFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIK 149
             Q+ ++ +   R      ++    TI++SGG      +AES      L++ GV RD I+
Sbjct: 185 RLQTAAKYYRVQR-----ARYHQPITIVVSGGQGPDEVMAESTAMRQYLVDQGVPRDAIQ 239

Query: 150 LETQSLDTFQNAQFSSSMIKNMQG-KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
            E +S  T +N +FS ++I   Q     ++V+S YH+ R+ ++ +   +N     +    
Sbjct: 240 EENRSTSTIENLKFSHALIVRQQPFYRAVIVTSGYHVLRANIFARQLHLNLTGIGAH--- 296

Query: 209 AYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
                 PL   +YL     +EY+ +++ Y   N
Sbjct: 297 -----TPL---YYLPFAMFREYLALIVMYRWAN 321


>gi|28377368|ref|NP_784260.1| integral membrane protein [Lactobacillus plantarum WCFS1]
 gi|28270200|emb|CAD63099.1| integral membrane protein [Lactobacillus plantarum WCFS1]
          Length = 340

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 94/213 (44%), Gaps = 37/213 (17%)

Query: 33  FSFIGW--GIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT-IPAIRIEP 89
           FSFI +    + T L +H Q  Y               +++LG G  ++P   P   +  
Sbjct: 142 FSFIAYLLACVMTRLGRHRQIDY---------------MIVLGAG--LMPNGQPTRTLAY 184

Query: 90  SFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIK 149
             Q+ ++ +   R      ++    TI++SGG      +AES      L++ GV RD I+
Sbjct: 185 RLQAAAKYYRVQR-----ARYHQPITIVVSGGQGPDEVMAESTAMRQYLVDQGVPRDAIQ 239

Query: 150 LETQSLDTFQNAQFSSSMIKNMQG-KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
            E +S  T +N +FS ++I   Q     ++V+S YH+ R+ ++ +   +N     +    
Sbjct: 240 EENRSTSTIENLKFSHALIVRQQPFYRAVIVTSGYHVLRANIFARQLHLNLTGIGAH--- 296

Query: 209 AYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
                 PL   +YL     +EY+ +++ Y   N
Sbjct: 297 -----TPL---YYLPFAMFREYLALIVMYRWAN 321


>gi|293553828|ref|ZP_06674443.1| integral membrane protein [Enterococcus faecium E1039]
 gi|291602034|gb|EFF32271.1| integral membrane protein [Enterococcus faecium E1039]
          Length = 399

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 177 LPQWINALFFCVPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 227

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y++  + +++  I++ SGG      L E
Sbjct: 228 LINGETVSPLLA-----------KRINKAIAFYRAQSRATLNPPILLMSGGQGADEKLPE 276

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N  +S   M + M+G    I  S+ YH+ R+
Sbjct: 277 AIAMKQYAMEQGIPERDILVETNSTTTLENMLYSKEIMDQQMKGPYRAIFSSNNYHIFRA 336

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 337 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 372


>gi|30021293|ref|NP_832924.1| hypothetical protein BC3183 [Bacillus cereus ATCC 14579]
 gi|29896847|gb|AAP10125.1| hypothetical Membrane Spanning Protein [Bacillus cereus ATCC 14579]
          Length = 343

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 108/236 (45%), Gaps = 37/236 (15%)

Query: 7   FLIVSYW---HLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWK 63
           FL++S     +   ++IR +++ +  + L+ FI    +   L  +  + + RP      K
Sbjct: 110 FLVISLVEPINFFPEAIRTLYWGAVLISLYLFID---LSNFLTAYFLYQFNRP------K 160

Query: 64  KDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
            + + I++LG+G     +P + A          SRI   +  YK  +  S    II SGG
Sbjct: 161 YNQDFIIVLGSGLINDKVPPLLA----------SRINRAIEFYKKQEAVSSPPKIIFSGG 210

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK--NIILV 179
                 ++E+       + +G+  ++   E +S  T+QN  FS  ++++++G   N I  
Sbjct: 211 QGSDENISEAKAMQEYAVNNGIPLENTIKEDRSTTTYQNMLFSKRIMESLKGTQYNCIFS 270

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           ++ +H+ R+ LY +  G+N++   S            +A +Y     ++EYI I +
Sbjct: 271 TNNFHVFRAGLYAKIVGLNSQGIGSK-----------TAFYYWPNAMIREYIAIFV 315


>gi|150020778|ref|YP_001306132.1| hypothetical protein Tmel_0886 [Thermosipho melanesiensis BI429]
 gi|149793299|gb|ABR30747.1| protein of unknown function DUF218 [Thermosipho melanesiensis
           BI429]
          Length = 236

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 82/176 (46%), Gaps = 19/176 (10%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           KDG I+VL G          A  IE    +  R+ +   +YK  +       I+++GG  
Sbjct: 72  KDGTIVVLGGGIVNY-----ANNIEIGTHTLKRLLKGWEIYKEKR-----LKIVVAGG-V 120

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
              G+ E+ V  + L++ GV +DDI  E  S  T +NA+  S + K+    NIILV+S  
Sbjct: 121 IGDGIREADVMKDFLIKLGVSKDDIITENTSRTTKENAKNVSKITKD---PNIILVTSFL 177

Query: 184 HLKRSQLYFQHFGINT--KASCS---DYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           H+KR+++ F+ +  +      C    D    +   +P     Y   L   E++GIL
Sbjct: 178 HMKRAKMLFEKYTQSNIIPVVCDYPIDLRKNFLDFLPSPRGIYTFSLITHEFLGIL 233


>gi|326799244|ref|YP_004317063.1| hypothetical protein Sph21_1831 [Sphingobacterium sp. 21]
 gi|326550008|gb|ADZ78393.1| protein of unknown function DUF218 [Sphingobacterium sp. 21]
          Length = 242

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 101/219 (46%), Gaps = 16/219 (7%)

Query: 20  IRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTII 79
           + K  F+  F+ LF  I    IP IL+  L+  Y+    S   K D   I++LG G T  
Sbjct: 28  VSKRLFVGGFLWLF-IITCSPIPNILIYGLESKYRTYSRSRNDKID--YILVLGGGFTEN 84

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL 139
            T+P    + S  S SRI E MR+ K           ++  G      ++++ +Y + + 
Sbjct: 85  KTLPNFE-QLSTASLSRISEAMRIKKI-----FPAAKLVMSGSKMNRTISQAEIYAHTVF 138

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
           E G +R+D+ L  +  +T + A+  S   K  +G   ILV+ A H++R+   F+      
Sbjct: 139 ELGFQRNDVVLLNEPKNTAEEAK--SFNNKFGKGAKFILVTDAAHMQRALYAFRDMS-PI 195

Query: 200 KASCSDYLNA----YYSIIPLSANFYLTELALKEYIGIL 234
            A  + Y+      YY+  P      +  +A+ EYIG+L
Sbjct: 196 PAPTNHYVKEPEKIYYAFKPSYLKIKMMNIAIHEYIGLL 234


>gi|325571076|ref|ZP_08146648.1| hypothetical protein HMPREF9087_2937 [Enterococcus casseliflavus
           ATCC 12755]
 gi|325156161|gb|EGC68347.1| hypothetical protein HMPREF9087_2937 [Enterococcus casseliflavus
           ATCC 12755]
          Length = 399

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 92/215 (42%), Gaps = 36/215 (16%)

Query: 38  WGIIP-------TILLKHLQFSYQRPLLSPQWKKDGNIIVLLG----NGTTIIPTIPAIR 86
           +G++P        + L  L  S       P++ +D   I++LG    NGTT+ P + A R
Sbjct: 184 FGVVPLSLMYLFVVFLNFLSISVIYQFNHPRYNQD--FIIVLGAGLLNGTTVSPLL-AKR 240

Query: 87  IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERD 146
           I  +   Y   F         K       +++SGG      L E++      +  GV   
Sbjct: 241 INKAISFYEAQF---------KAKKTAPRLLMSGGQGSDEKLPEAVAMKEYAVAQGVPEG 291

Query: 147 DIKLETQSLDTFQNAQFSSSMIKNMQ--GKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
           +I +ET S  T++N +FS  ++ +++  G  +I  S+ YH+ R+ LY        KA   
Sbjct: 292 EILVETNSTTTYENMKFSKEIMDSLKPNGYKVIFSSNNYHIFRAGLYADQ--AQLKADGI 349

Query: 205 DYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
               A+Y         YL    L+E++ IL  + R
Sbjct: 350 GAPTAFY---------YLPNAFLREFVAILFMHKR 375


>gi|322389504|ref|ZP_08063055.1| hypothetical protein HMPREF8577_0525 [Streptococcus parasanguinis
           ATCC 903]
 gi|321143779|gb|EFX39206.1| hypothetical protein HMPREF8577_0525 [Streptococcus parasanguinis
           ATCC 903]
          Length = 324

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 86/180 (47%), Gaps = 27/180 (15%)

Query: 63  KKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           +K+ + I++LG+G     +P + A R++     Y             +Q      +I+SG
Sbjct: 139 RKEPDAIIILGSGLIGDKVPPLLAQRLDKGKAIY-------------EQFEGRPKLIVSG 185

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ-GKNIILV 179
           G      +AE+      L+E GV  D I +E +S  TF+N  FS  +++    GK +++V
Sbjct: 186 GQGSDELIAEAEAMAGYLMEHGVPEDAILIENRSRTTFENLTFSKRLLEEEGLGKRVLVV 245

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           ++++H  R+ ++ +   I  ++  S            +A +YL    ++E IG++  Y++
Sbjct: 246 TNSFHALRAGVFMRRLKIPGRSIGSR-----------TAFYYLPSAWIRETIGLVSLYWK 294


>gi|293568622|ref|ZP_06679937.1| integral membrane protein [Enterococcus faecium E1071]
 gi|291588582|gb|EFF20415.1| integral membrane protein [Enterococcus faecium E1071]
          Length = 399

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 177 LPQWINALFFCIPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 227

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y +  + +++  I++ SGG      + E
Sbjct: 228 LINGETVSPLLA-----------KRINKAIAFYGAQSRATLNPPILLMSGGQGADEKVPE 276

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N ++S   M + M+G    I  S+ YH+ R+
Sbjct: 277 AIAMKQYAMEQGIPERDILVETNSTTTLENMRYSKEIMDQQMKGPYRAIFSSNNYHIFRA 336

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI ILI
Sbjct: 337 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILI 372


>gi|220910044|ref|YP_002485355.1| hypothetical protein Cyan7425_4689 [Cyanothece sp. PCC 7425]
 gi|219866655|gb|ACL46994.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7425]
          Length = 262

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 91/190 (47%), Gaps = 25/190 (13%)

Query: 68  IIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHG 127
           I+VL G      P  P I +    ++  R+    +LY+  K       +I+SGG      
Sbjct: 79  IVVLGGAIKGADPPRPWIEVA---EAGDRLLYAAKLYRDGKAP----LVILSGGRISWLS 131

Query: 128 LAESIVYNNK---LLES-GVERDDIKLETQSLDTFQNAQFSSSMIK--NMQGKNIILVSS 181
            A +   +     L+E+ GV    +  ++ SL+T+QNA     ++K  N+ G +I+LV+S
Sbjct: 132 TATAAPESADMAILIETMGVPASALLQDSTSLNTYQNAVNVQKILKEKNITG-SILLVTS 190

Query: 182 AYHLKRSQLYFQHFGINTKASCSDY-----------LNAYYSIIPLSANFYLTELALKEY 230
           A+H+ R+   F   GI   A+ +D+           +    S++P +     T LALKEY
Sbjct: 191 AFHMPRALAIFNRLGIPAIAAPTDFHTTQTAELSGAIGFLLSLLPSAETLQNTTLALKEY 250

Query: 231 IGILIAYYRG 240
           +G+++   RG
Sbjct: 251 VGLVVYRLRG 260


>gi|228999589|ref|ZP_04159166.1| hypothetical protein bmyco0003_41440 [Bacillus mycoides Rock3-17]
 gi|229007135|ref|ZP_04164760.1| hypothetical protein bmyco0002_40340 [Bacillus mycoides Rock1-4]
 gi|228754114|gb|EEM03534.1| hypothetical protein bmyco0002_40340 [Bacillus mycoides Rock1-4]
 gi|228760115|gb|EEM09084.1| hypothetical protein bmyco0003_41440 [Bacillus mycoides Rock3-17]
          Length = 342

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 105/238 (44%), Gaps = 33/238 (13%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           MLL  + LIV          + IF    F++++ F     I T L  +  + + RP    
Sbjct: 107 MLLIMLSLIVDPTRFFSPHFQPIFTGIFFIMVYFFFH---ISTFLTAYFLYQFNRP---- 159

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
             + + + I++LG+G     +P + A          SRI + +  Y      +   TII 
Sbjct: 160 --RCNQDFIIVLGSGLINDKVPPLLA----------SRINKAIDFYHKQAAVASPPTIIF 207

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NII 177
           SGG      L E+       +E G+  +    E +S++T+QN  FS  ++ +++ +   I
Sbjct: 208 SGGQGPDENLPEAEAMQKYAIEKGIPIEHTVQENRSVNTYQNMLFSKQIMDSLKDRYKSI 267

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
             ++ +HL R+ LY +  G+N++   S            +A +Y     ++EYI I++
Sbjct: 268 FTTNNFHLFRAGLYAKQAGLNSQGIGSK-----------TAFYYWPNAMIREYIAIVV 314


>gi|295112887|emb|CBL31524.1| Uncharacterized conserved protein [Enterococcus sp. 7L76]
          Length = 371

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 84/170 (49%), Gaps = 23/170 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC-TIII 118
           P++ +D   IV+LG+G      +P     P  Q+  RI + ++ YK+  + +++   I++
Sbjct: 214 PKYTQD--YIVVLGSGLINGEIVP-----PLLQA--RINKAIQFYKAQNRATLNPPKIVM 264

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNI- 176
           SGG      L ES+      L  G+  DDI +E  S +T +N +FS  +MI++    N  
Sbjct: 265 SGGQGPDELLPESVAMKMYALTQGIPDDDILVEAHSKNTLENMRFSKETMIEDFGNANFQ 324

Query: 177 -ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTEL 225
            I  ++ YHL R+ L+ +  G+  KA       A+Y        FYLT L
Sbjct: 325 AIFTTNNYHLFRAGLFARMAGL--KADGIGAKTAFY--------FYLTRL 364


>gi|42784000|ref|NP_981247.1| hypothetical protein BCE_4954 [Bacillus cereus ATCC 10987]
 gi|42739930|gb|AAS43855.1| conserved domain protein [Bacillus cereus ATCC 10987]
          Length = 345

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 91/196 (46%), Gaps = 32/196 (16%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A          SRI + + 
Sbjct: 149 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAID 192

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
            Y      +   TII SGG     GL E+       +E G+  +    E +S++T+QN  
Sbjct: 193 FYWKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNML 252

Query: 163 FSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSAN 219
           FS  ++ ++  +GK N I  ++ +HL R+ +Y +  G+N++   S            +A 
Sbjct: 253 FSKEIMDSLKPEGKYNSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAF 301

Query: 220 FYLTELALKEYIGILI 235
           +Y     ++EY+ I++
Sbjct: 302 YYWPNAMIREYVAIVV 317


>gi|114704894|ref|ZP_01437802.1| hypothetical protein FP2506_08156 [Fulvimarina pelagi HTCC2506]
 gi|114539679|gb|EAU42799.1| hypothetical protein FP2506_08156 [Fulvimarina pelagi HTCC2506]
          Length = 270

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 94/206 (45%), Gaps = 18/206 (8%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGN-GTTIIPTIPAIRIEPSFQSYSRIFETMRL 103
           +  +L+  ++RP+  P  + DG IIVL G   T +  T   I +  +    S      R 
Sbjct: 61  MTAYLENRFERPVPMPA-EVDG-IIVLGGAFDTRVARTRGVIELNEAADRASVSVALART 118

Query: 104 YKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNA 161
           Y           ++ SGG     +  + E+       L  G++ + +KL+ ++ DTF+NA
Sbjct: 119 YPGAD-------VLFSGGVAAAFREDIPETQSAEQFYLGLGLDPNRLKLDGKARDTFENA 171

Query: 162 QFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSII--PLSA- 218
            ++ ++     G+  +LV+SAYH+ R+   F+  G +      DY     + +  P +A 
Sbjct: 172 VYAKALADPQPGETWLLVTSAYHMPRAMGCFRTVGFDVVPYPVDYRTPEGADVWRPSTAT 231

Query: 219 --NFYLTELALKEYIGILIAYYRGNR 242
             N      A++EYIG L AY+   R
Sbjct: 232 TRNLEKVHFAIREYIG-LAAYWAAGR 256


>gi|220933067|ref|YP_002509975.1| hypothetical protein Hore_22350 [Halothermothrix orenii H 168]
 gi|219994377|gb|ACL70980.1| uncharacterized conserved protein [Halothermothrix orenii H 168]
          Length = 256

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 112/245 (45%), Gaps = 21/245 (8%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFI---GWGIIPTILLKHLQFSYQRPLLSPQW 62
           I+++++ + +  +S R I  ++C  L+  +I     G++  ++    +F Y       ++
Sbjct: 21  IWVVITVYLIKKRSNRLIVGLACISLVLMYILSSAVGVMLFLIPLETKFPYYN---ISRY 77

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
            K+  I+VL G G          ++ P   +  R+    RLYK  +      T+I +GG 
Sbjct: 78  DKELPIVVL-GGGINYFGEKGEGKLNPI--TLQRLVTGYRLYKEVE-----TTLIFTGGQ 129

Query: 123 PQKH-GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG--KNIILV 179
              H G +E+ V    L E G+ ++ + LE ++ +T++N  +    ++   G  + + LV
Sbjct: 130 GIGHSGPSEADVAGEFLRELGINQEALVLENRARNTYENGLYVRDYLEQRNGLDRGVYLV 189

Query: 180 SSAYHLKRSQLYFQHFGINT----KASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           +SA HL R+   F+   +          +D+   +    P  +N   T  A+ E+IG+L 
Sbjct: 190 TSAVHLPRAVGVFRRLNLKVVPVPAGYFADHTQGWLDFFPARSNLNATLAAIHEWIGLLW 249

Query: 236 AYYRG 240
              RG
Sbjct: 250 YKVRG 254


>gi|217976941|ref|YP_002361088.1| protein of unknown function DUF218 [Methylocella silvestris BL2]
 gi|217502317|gb|ACK49726.1| protein of unknown function DUF218 [Methylocella silvestris BL2]
          Length = 264

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 66/140 (47%), Gaps = 17/140 (12%)

Query: 106 SCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSS 165
           S +  S         G+  +  + ES       L+ GV  D ++ E++S +T++NA F+ 
Sbjct: 116 SKRYPSARLVFTGGSGNLVEQTIVESTGVKKFWLDMGVPPDRMEFESRSRNTWENALFTR 175

Query: 166 SMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN---------TKASCSD--YLNAYYSII 214
            +++   G+  +LV+SA+H+ RS   F+  G +         T    SD  +L   +  +
Sbjct: 176 DLLRPKPGETWLLVTSAWHMPRSMGIFRRLGFDVIAYPVAYRTSGDSSDWSFLRPAFERV 235

Query: 215 PLSANFYLTELALKEYIGIL 234
           PL        LA +E+IG+L
Sbjct: 236 PLVV------LAFREWIGLL 249


>gi|229072307|ref|ZP_04205512.1| hypothetical protein bcere0025_44700 [Bacillus cereus F65185]
 gi|229082056|ref|ZP_04214544.1| hypothetical protein bcere0023_46830 [Bacillus cereus Rock4-2]
 gi|228701281|gb|EEL53779.1| hypothetical protein bcere0023_46830 [Bacillus cereus Rock4-2]
 gi|228710844|gb|EEL62814.1| hypothetical protein bcere0025_44700 [Bacillus cereus F65185]
          Length = 345

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 109/242 (45%), Gaps = 39/242 (16%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           ML   +  I++   L+   +  IF     +  + FI    +   L  +  + + RP    
Sbjct: 108 MLFFMLLPIINPASLVSSHLEPIFAAISLISFYFFIH---LSNFLSAYFLYQFNRP---- 160

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC--TI 116
             +++ + I++LG+G     +P + A RI  +   Y             KQ +++   TI
Sbjct: 161 --RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPTI 206

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK 174
           I SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  ++ ++  +GK
Sbjct: 207 IFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGK 266

Query: 175 -NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I
Sbjct: 267 YKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAI 315

Query: 234 LI 235
           ++
Sbjct: 316 VV 317


>gi|228955081|ref|ZP_04117096.1| hypothetical protein bthur0006_44460 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228804591|gb|EEM51195.1| hypothetical protein bthur0006_44460 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
          Length = 345

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 109/242 (45%), Gaps = 39/242 (16%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           ML   +  I++   L+   +  IF     +  + FI    +   L  +  + + RP    
Sbjct: 108 MLFFMLLPIINPASLVSSHLEPIFAAISLISFYFFIH---LSNFLSAYFLYQFNRP---- 160

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC--TI 116
             +++ + I++LG+G     +P + A RI  +   Y             KQ +++   TI
Sbjct: 161 --RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPTI 206

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK 174
           I SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  ++ ++  +GK
Sbjct: 207 IFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGK 266

Query: 175 -NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I
Sbjct: 267 YKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAI 315

Query: 234 LI 235
           ++
Sbjct: 316 VV 317


>gi|20808561|ref|NP_623732.1| hypothetical protein TTE2177 [Thermoanaerobacter tengcongensis MB4]
 gi|20517188|gb|AAM25336.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 192

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 69/142 (48%), Gaps = 13/142 (9%)

Query: 58  LSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTII 117
            + + KK   IIVL   G  +    P+    P F+   R+ E ++LYK          II
Sbjct: 31  FTEKPKKSDAIIVL---GCAVYGDAPS----PFFKE--RLEEALKLYK----EGYGRYII 77

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ISGG      ++E+       LE GV   +I L+ +S  T++N  FS  +++    K  I
Sbjct: 78  ISGGKGPGESISEAEAGKRYFLEKGVASKNILLDNKSFSTYENLLFSKEIMEKNSLKTAI 137

Query: 178 LVSSAYHLKRSQLYFQHFGINT 199
           +VS+ +HLKR+ +  +  GI+ 
Sbjct: 138 IVSNKFHLKRASVIAKRIGIDA 159


>gi|324328702|gb|ADY23962.1| hypothetical protein YBT020_23670 [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 344

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 91/196 (46%), Gaps = 32/196 (16%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A          SRI + + 
Sbjct: 148 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAID 191

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
            Y      +   TII SGG     GL E+       +E G+  +    E +S++T+QN  
Sbjct: 192 FYWKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNML 251

Query: 163 FSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSAN 219
           FS  ++ ++  +GK N I  ++ +HL R+ +Y +  G+N++   S            +A 
Sbjct: 252 FSKEIMDSLKPEGKYNSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAF 300

Query: 220 FYLTELALKEYIGILI 235
           +Y     ++EY+ I++
Sbjct: 301 YYWPNAMIREYVAIVV 316


>gi|229153006|ref|ZP_04281187.1| hypothetical protein bcere0011_45370 [Bacillus cereus m1550]
 gi|228630426|gb|EEK87074.1| hypothetical protein bcere0011_45370 [Bacillus cereus m1550]
          Length = 345

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 109/242 (45%), Gaps = 39/242 (16%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           ML   +  I++   L+   +  IF     +  + FI    +   L  +  + + RP    
Sbjct: 108 MLFFMLLPIINPASLVSSHLEPIFAAISLISFYFFIH---LSNFLSAYFLYQFNRP---- 160

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC--TI 116
             +++ + I++LG+G     +P + A RI  +   Y             KQ +++   TI
Sbjct: 161 --RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPTI 206

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK 174
           I SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  ++ ++  +GK
Sbjct: 207 IFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGK 266

Query: 175 -NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I
Sbjct: 267 YKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAI 315

Query: 234 LI 235
           ++
Sbjct: 316 VV 317


>gi|217964896|ref|YP_002350574.1| integral membrane protein [Listeria monocytogenes HCC23]
 gi|217334166|gb|ACK39960.1| integral membrane protein [Listeria monocytogenes HCC23]
 gi|307570545|emb|CAR83724.1| membrane protein, putative [Listeria monocytogenes L99]
          Length = 344

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 86/182 (47%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   +  Y K   +     T I+
Sbjct: 159 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLNRAIAFYEKQYSKTGKRATFIV 209

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+    + L+  G++   I +E QS++T QN QFS + M   M   N +
Sbjct: 210 SGGQGANETVSEAQAMRDYLISKGIDETFIIMEDQSVNTLQNMQFSKAKMDAIMPDYNSL 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ LY +  G+ ++   +            +A +Y+    ++E+I I + Y
Sbjct: 270 FSTNNFHLFRAGLYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAITVMY 318

Query: 238 YR 239
            +
Sbjct: 319 KK 320


>gi|228923560|ref|ZP_04086840.1| hypothetical protein bthur0011_45360 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228836029|gb|EEM81390.1| hypothetical protein bthur0011_45360 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 283

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 91/192 (47%), Gaps = 36/192 (18%)

Query: 51  FSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK 108
           + + RP      +++ + I++LG+G     +P + A RI  +   Y             K
Sbjct: 93  YQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WK 134

Query: 109 QHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS 166
           Q +++   TII SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  
Sbjct: 135 QAAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMLFSKE 194

Query: 167 MIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLT 223
           ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +A +Y  
Sbjct: 195 IMDSLKPEGKYKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWP 243

Query: 224 ELALKEYIGILI 235
              ++EY+ I++
Sbjct: 244 NAMIREYVAIVV 255


>gi|313624306|gb|EFR94349.1| integral membrane protein [Listeria innocua FSL J1-023]
          Length = 344

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 97/210 (46%), Gaps = 24/210 (11%)

Query: 30  MLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEP 89
           + L +F+G+     +      F YQ     P++ +D   +++LG+G      I   R+ P
Sbjct: 131 VFLMAFVGYFSFLFLSFLLSTFLYQFNF--PRYNQD--FLIVLGSGL-----IGGDRVPP 181

Query: 90  SFQSYSRIFETMRLY-KSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
              S  R+   +  Y K   +     T I+SGG      ++E+    + L+  G++ + I
Sbjct: 182 LLAS--RLNRAIAFYEKQYDKKGKRATFIVSGGQGANETVSEAKAMRDYLISKGIDENFI 239

Query: 149 KLETQSLDTFQNAQFS-SSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL 207
            +E +S++T QN QFS + M   M   N +  ++ +HL R+ LY +  G+ ++   +   
Sbjct: 240 IMEDKSVNTLQNMQFSKAKMDAIMPTYNSLFSTNNFHLFRAGLYARKAGLKSQGIGAK-- 297

Query: 208 NAYYSIIPLSANFYLTELALKEYIGILIAY 237
                    +A +Y+    ++E+I I + Y
Sbjct: 298 ---------TALYYMPNALIREFIAITVMY 318


>gi|290893441|ref|ZP_06556425.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
 gi|290556942|gb|EFD90472.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071]
          Length = 344

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 86/182 (47%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   +  Y K   +     T I+
Sbjct: 159 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLNRAIAFYEKQYSKTGKRATFIV 209

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+    + L+  G++   I +E QS++T QN QFS + M   M   N +
Sbjct: 210 SGGQGANETVSEAQAMRDYLISKGIDETFIIMEDQSVNTLQNMQFSKAKMDAIMPDYNSL 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ LY +  G+ ++   +            +A +Y+    ++E+I I + Y
Sbjct: 270 FSTNNFHLFRAGLYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAITVMY 318

Query: 238 YR 239
            +
Sbjct: 319 KK 320


>gi|16800072|ref|NP_470340.1| hypothetical protein lin1003 [Listeria innocua Clip11262]
 gi|16413462|emb|CAC96234.1| lin1003 [Listeria innocua Clip11262]
 gi|313619596|gb|EFR91250.1| integral membrane protein [Listeria innocua FSL S4-378]
          Length = 344

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   +  Y K   +     T I+
Sbjct: 159 PRYNQD--FLIVLGSGL-----IDGDRVPPLLAS--RLNRAIAFYEKQYDKKGKRATFIV 209

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+    + L+  G++ + I +E +S++T QN QFS + M   M   N +
Sbjct: 210 SGGQGANETVSEARAMRDYLISKGIDENFIIMEDKSVNTLQNMQFSKAKMDAIMPTYNSL 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ LY +  G+ ++   +            +A +Y+    ++E+I I + Y
Sbjct: 270 FSTNNFHLFRAGLYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAITVMY 318


>gi|228910647|ref|ZP_04074458.1| hypothetical protein bthur0013_47910 [Bacillus thuringiensis IBL
           200]
 gi|228848915|gb|EEM93758.1| hypothetical protein bthur0013_47910 [Bacillus thuringiensis IBL
           200]
          Length = 283

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 91/192 (47%), Gaps = 36/192 (18%)

Query: 51  FSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK 108
           + + RP      +++ + I++LG+G     +P + A RI  +   Y             K
Sbjct: 93  YQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WK 134

Query: 109 QHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS 166
           Q +++   TII SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  
Sbjct: 135 QAAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMLFSKE 194

Query: 167 MIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLT 223
           ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +A +Y  
Sbjct: 195 IMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWP 243

Query: 224 ELALKEYIGILI 235
              ++EY+ I++
Sbjct: 244 NAMIREYVAIVV 255


>gi|228903313|ref|ZP_04067444.1| hypothetical protein bthur0014_44780 [Bacillus thuringiensis IBL
           4222]
 gi|228967916|ref|ZP_04128927.1| hypothetical protein bthur0004_47040 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228791783|gb|EEM39374.1| hypothetical protein bthur0004_47040 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228856274|gb|EEN00803.1| hypothetical protein bthur0014_44780 [Bacillus thuringiensis IBL
           4222]
          Length = 283

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 91/192 (47%), Gaps = 36/192 (18%)

Query: 51  FSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK 108
           + + RP      +++ + I++LG+G     +P + A RI  +   Y             K
Sbjct: 93  YQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WK 134

Query: 109 QHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS 166
           Q +++   TII SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  
Sbjct: 135 QAAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMLFSKE 194

Query: 167 MIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLT 223
           ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +A +Y  
Sbjct: 195 IMDSLKTEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWP 243

Query: 224 ELALKEYIGILI 235
              ++EY+ I++
Sbjct: 244 NAMIREYVAIVV 255


>gi|153832463|ref|ZP_01985130.1| integral membrane protein [Vibrio harveyi HY01]
 gi|148871258|gb|EDL70130.1| integral membrane protein [Vibrio harveyi HY01]
          Length = 268

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 110/232 (47%), Gaps = 35/232 (15%)

Query: 27  SCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            CF++LFSF+G     +  + T LL  L+  Y+  L        G +  +++LGNG  + 
Sbjct: 38  GCFVVLFSFVGIFLVAFQPVSTKLLMPLEREYKAFL-----PVSGTVDYVMVLGNGHVVD 92

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISG--GDPQKHGLAESIVYN 135
             IP     P+ Q  SR    MRL +  +   M+    +I+SG  G  +   ++ + +  
Sbjct: 93  NEIP-----PTSQ-LSRT-ALMRLTEGIRILRMYPGAKLILSGYAGGSE---ISHARMMA 142

Query: 136 NKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHF 195
           N  L  GV + DI L   + DT++ A+ +++ +K    K+I+LV+SA H+KR+   F   
Sbjct: 143 NVALSLGVAKSDIILLEDAKDTWEEARQAAAFVKQ---KDIVLVTSASHMKRALYEFNAA 199

Query: 196 GINTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
           GI    + ++++        +    P +     TEL   EY+G L    R N
Sbjct: 200 GIKPIPAPTNFMAIDDIEQPWQKYAPKARYLEQTELYWHEYLGGLWQKLRDN 251


>gi|315635988|ref|ZP_07891248.1| conserved hypothetical protein [Arcobacter butzleri JV22]
 gi|315479709|gb|EFU70382.1| conserved hypothetical protein [Arcobacter butzleri JV22]
          Length = 248

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 109/230 (47%), Gaps = 32/230 (13%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT 81
           KIF +  F L F+ +    I  +++  L+ +Y  P L  +  KD   I++LGNG      
Sbjct: 38  KIFLVLGF-LWFALLSNQTISNMIISPLENAY--PALK-ETPKDIKYILVLGNGHKTNDN 93

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG---GDPQKHGLAESIVYNNKL 138
            P I  E +  + +R+ E +R YK+ +    +  +I+SG    D   H   +      KL
Sbjct: 94  FP-ITSELNTTAINRLIEGIRHYKNLE----NSKLIVSGYSFDDVNSHAQMQK-----KL 143

Query: 139 LES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
             S GV   DI       DT + A  +  ++ N +   +ILV++A H+KR+ + F+   +
Sbjct: 144 AISLGVNETDIITLDTPKDTKEEAIEAKKIVGNQK---LILVTTASHMKRAVMLFEKEDL 200

Query: 198 NTKAS-------CSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           N  AS        S Y  +Y++    + N    ELA  EY+G++ +Y +G
Sbjct: 201 NIIASPTNHKFFTSTYPTSYFN----ATNIKKVELAFHEYLGMVYSYVKG 246


>gi|228961075|ref|ZP_04122702.1| hypothetical protein bthur0005_45260 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228798620|gb|EEM45606.1| hypothetical protein bthur0005_45260 [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 345

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 93/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 149 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 194

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+    N  +E G+  +    E +S++T+QN
Sbjct: 195 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQN 250

Query: 161 AQFSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 251 MLFSKEIMDSLKPEGKYKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 299

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 300 AFYYWPNAMIREYVAIVV 317


>gi|116492028|ref|YP_803763.1| hypothetical protein PEPE_0220 [Pediococcus pentosaceus ATCC 25745]
 gi|116102178|gb|ABJ67321.1| hypothetical protein PEPE_0220 [Pediococcus pentosaceus ATCC 25745]
          Length = 339

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 79/184 (42%), Gaps = 32/184 (17%)

Query: 63  KKDGNIIVLLGNGT---TIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           K + + I++LG G    T+ P +   R++ + + Y R              +    I++S
Sbjct: 161 KGNVDYIIVLGAGVRSETVTPLLKG-RLDKALEYYRR-------------QNGAVKIVVS 206

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI----KNMQGKN 175
           GG      ++E+      L    V  D I LE QS  TF+N QFS   I    +  Q   
Sbjct: 207 GGQGPDEPVSEAFAMAKYLRNQSVPEDKIILEDQSTTTFENMQFSKQKIEADWQGTQPPQ 266

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           II  ++ YH+ R  +Y +  G+N     S            ++ ++L    ++EYI +L+
Sbjct: 267 IIFATNNYHVLRGVIYARKAGLNANGVGSP-----------TSFYFLPSALIREYIALLV 315

Query: 236 AYYR 239
            Y +
Sbjct: 316 IYKK 319


>gi|157736806|ref|YP_001489489.1| hypothetical protein Abu_0553 [Arcobacter butzleri RM4018]
 gi|157698660|gb|ABV66820.1| conserved hypothetical protein (DUF218 domain protein) [Arcobacter
           butzleri RM4018]
          Length = 248

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 112/234 (47%), Gaps = 40/234 (17%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPT 81
           KIF +  F L F+ +    I  +++  L+ +Y  P L  +  KD   I++LGNG      
Sbjct: 38  KIFLVLGF-LWFALLSNQTISNMIISPLENAY--PALK-ETPKDIKYILVLGNGHKTNDN 93

Query: 82  IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG---GDPQKHG-----LAESIV 133
            P I  E +  + +R+ E +R YK+ +    +  +I+SG    D   H      LA S+ 
Sbjct: 94  FP-ITSELNTTAINRLIEGIRHYKNLE----NSKLIVSGYSFDDVNSHAQMQKKLAISLG 148

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
            N        E D I L+T   DT + A  +  ++ N +   +ILV++A H+KR+ + F+
Sbjct: 149 VN--------EADIITLDTPK-DTKEEAIEAKKIVGNQK---LILVTTASHMKRAVMLFE 196

Query: 194 HFGINTKAS-------CSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
              +N  AS        S Y  +Y++    + N    ELA  EY+G++ +Y +G
Sbjct: 197 KEDLNIIASPTNHKFFTSTYPTSYFN----ATNIKKVELAFHEYLGMVYSYVKG 246


>gi|218231692|ref|YP_002369609.1| hypothetical protein BCB4264_A4924 [Bacillus cereus B4264]
 gi|218159649|gb|ACK59641.1| conserved domain protein [Bacillus cereus B4264]
          Length = 345

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 93/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 149 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 194

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+    N  +E G+  +    E +S++T+QN
Sbjct: 195 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQN 250

Query: 161 AQFSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 251 MLFSKEIMDSLKPEGKYKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 299

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 300 AFYYWPNAMIREYVAIVV 317


>gi|75758871|ref|ZP_00738983.1| Hypothetical membrane spanning protein [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|74493637|gb|EAO56741.1| Hypothetical membrane spanning protein [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
          Length = 351

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 93/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 155 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 200

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+    N  +E G+  +    E +S++T+QN
Sbjct: 201 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQN 256

Query: 161 AQFSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 257 MLFSKEIMDSLKTEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 305

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 306 AFYYWPNAMIREYVAIVV 323


>gi|229105438|ref|ZP_04236081.1| hypothetical protein bcere0019_45700 [Bacillus cereus Rock3-28]
 gi|228677994|gb|EEL32228.1| hypothetical protein bcere0019_45700 [Bacillus cereus Rock3-28]
          Length = 345

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 92/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 149 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 194

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+    N  +E G+       E +S++T+QN
Sbjct: 195 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLKHTVQENRSVNTYQN 250

Query: 161 AQFSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 251 MSFSKEIMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 299

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 300 AFYYWPNAMIREYVAIVV 317


>gi|332968539|gb|EGK07600.1| protein of hypothetical function DUF218 [Kingella kingae ATCC
           23330]
          Length = 207

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 72/164 (43%), Gaps = 18/164 (10%)

Query: 51  FSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQH 110
           ++Y RP   P    + +  V+LG         P  R         RI   + LY++ +  
Sbjct: 34  YAYSRPQPLPD---EADAAVVLGAAAWGNKPSPVFR--------ERINHALTLYQTGRVK 82

Query: 111 SMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
                II +GG P+     E+ V     ++ G+   DI  ET+S DTFQN   +  ++K 
Sbjct: 83  K----IIFTGGTPKAGFATEAEVARQYAIKQGIADQDIVFETRSKDTFQNLANTRFLMKK 138

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKAS---CSDYLNAYY 211
               ++I+VS  YH+ R+    Q   +N  AS    S Y NA +
Sbjct: 139 HHLNSVIIVSDPYHMARAMNMAQDLQLNAYASHTPTSRYNNARF 182


>gi|30022866|ref|NP_834497.1| hypothetical protein BC4795 [Bacillus cereus ATCC 14579]
 gi|229130080|ref|ZP_04259042.1| hypothetical protein bcere0015_45180 [Bacillus cereus BDRD-Cer4]
 gi|29898425|gb|AAP11698.1| hypothetical Membrane Spanning Protein [Bacillus cereus ATCC 14579]
 gi|228653397|gb|EEL09273.1| hypothetical protein bcere0015_45180 [Bacillus cereus BDRD-Cer4]
          Length = 345

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 110/242 (45%), Gaps = 39/242 (16%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           ML   +  I++   L+   +  IF     + ++ FI    +   L  +  + + RP    
Sbjct: 108 MLFFMLLPIINPASLVSSHLEPIFAAISLISIYFFIH---LSNFLSAYFLYQFNRP---- 160

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC--TI 116
             +++ + I++LG+G     +P + A RI  +   Y             KQ +++   TI
Sbjct: 161 --RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPTI 206

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK 174
           I SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  ++ ++  +GK
Sbjct: 207 IFSGGQGPDEGLPEAEAMQNYAVEKGIPIEHTVQENRSVNTYQNMLFSKEIMDSLKPEGK 266

Query: 175 -NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I
Sbjct: 267 YKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAI 315

Query: 234 LI 235
           ++
Sbjct: 316 VV 317


>gi|240139755|ref|YP_002964232.1| hypothetical protein MexAM1_META1p3209 [Methylobacterium extorquens
           AM1]
 gi|240009729|gb|ACS40955.1| conserved hypothetical protein, DUF218; putative membrane protein
           precursor [Methylobacterium extorquens AM1]
          Length = 265

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 70/132 (53%), Gaps = 8/132 (6%)

Query: 113 HCTIIISGG--DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
              ++ SGG    ++  ++E+ + +      GV R+ + LE QS +T +NA FS+ M++ 
Sbjct: 122 QARLVFSGGAGSTREDAVSEAEIVSRYADTLGVPRNRLILEQQSRNTHENAVFSARMVQP 181

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLT-----EL 225
             G+  +LV+SA+H+ RS   F+  G +  A   DY   +       A+F  T     ++
Sbjct: 182 KPGERWLLVTSAWHMPRSMGCFRKAGFDVTAYPVDYRTNWPRDAYRLASFASTGLGELDI 241

Query: 226 ALKEYIGILIAY 237
            +KE+IG +IAY
Sbjct: 242 GVKEWIG-MIAY 252


>gi|254562167|ref|YP_003069262.1| hypothetical protein METDI3773 [Methylobacterium extorquens DM4]
 gi|254269445|emb|CAX25411.1| conserved hypothetical protein, DUF218; putative membrane protein
           precursor [Methylobacterium extorquens DM4]
          Length = 265

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 8/132 (6%)

Query: 113 HCTIIISGG--DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
              ++ SGG    ++  ++E+ + +      GV R+ + LE QS +T +NA FS+ M++ 
Sbjct: 122 QARLVFSGGAGSTREDAVSEAEIVSRYADTLGVPRNRLILEQQSRNTHENAVFSARMVQP 181

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-----LNAYYSIIPLSANFYLTEL 225
             G+  +LV+SA+H+ RS   F+  G +  A   DY      +AY      S      ++
Sbjct: 182 KPGERWLLVTSAWHMPRSMGCFRKAGFDVTAYPVDYRTNWPRDAYRLASFASTGLGELDI 241

Query: 226 ALKEYIGILIAY 237
            +KE+IG +IAY
Sbjct: 242 GVKEWIG-MIAY 252


>gi|91977540|ref|YP_570199.1| hypothetical protein RPD_3072 [Rhodopseudomonas palustris BisB5]
 gi|91683996|gb|ABE40298.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           BisB5]
          Length = 264

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 91/195 (46%), Gaps = 20/195 (10%)

Query: 60  PQWKKDG----NIIVLLGN-GTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC 114
           P W+ +G     IIVL G   + +     ++ I+ S +      E  R Y   +      
Sbjct: 70  PPWQFNGRAPDGIIVLGGAVDSEVSAARSSLEIDSSAERVVAALELARQYPQAR------ 123

Query: 115 TIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
            II SGG      + +AE+ +    L   GV  D + LE++S  T +NA F+  ++    
Sbjct: 124 -IIYSGGSGNLIANSVAEAPIAGELLARFGVAPDRVVLESKSRTTAENASFTRELVSPKP 182

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYY--SIIP---LSANFYLTELAL 227
           G+  +LV+SA+H+ RS   F+    + +A   D+    +  + +P   LS+     ++A+
Sbjct: 183 GEVWLLVTSAFHMPRSIEAFRAVEFDVQAYPVDWRTRGWRDAALPFDRLSSGLARMDVAV 242

Query: 228 KEYIGILIAYYRGNR 242
            E+ G L+AY  G +
Sbjct: 243 HEWAG-LLAYRLGGK 256


>gi|218899964|ref|YP_002448375.1| hypothetical protein BCG9842_B0316 [Bacillus cereus G9842]
 gi|218541300|gb|ACK93694.1| conserved domain protein [Bacillus cereus G9842]
          Length = 345

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 93/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 149 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 194

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+    N  +E G+  +    E +S++T+QN
Sbjct: 195 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQN 250

Query: 161 AQFSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 251 MLFSKEIMDSLKTEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 299

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 300 AFYYWPNAMIREYVAIVV 317


>gi|315221464|ref|ZP_07863385.1| integral membrane protein with DUF218 domain protein [Streptococcus
           anginosus F0211]
 gi|315189583|gb|EFU23277.1| integral membrane protein with DUF218 domain protein [Streptococcus
           anginosus F0211]
          Length = 333

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 89/180 (49%), Gaps = 28/180 (15%)

Query: 64  KDGNIIVLLGNGTT--IIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
           K  + I++LG+G     +P + A R+E     Y             K H+ H  I++SGG
Sbjct: 159 KHPDYIIILGSGLIGDKVPPLLAQRLEKGKTMYE------------KFHN-HPKIVVSGG 205

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN--IILV 179
                 + E+      L + G+ ++DI +E QS +T +N +FS +++   + KN   ++V
Sbjct: 206 QGVDEPITEAEAMAQYLRQVGIPQEDIIIERQSTNTLENLRFSKAILDETREKNYRCLVV 265

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           ++++H  R+ +Y +  G+  ++  S            +A ++L    ++E +G+++ Y++
Sbjct: 266 TNSFHSLRAGIYMRKIGLKGRSIGSR-----------TAPYFLPSSWIRETLGLIVLYWK 314


>gi|294623043|ref|ZP_06701932.1| integral membrane protein [Enterococcus faecium U0317]
 gi|291597599|gb|EFF28761.1| integral membrane protein [Enterococcus faecium U0317]
          Length = 399

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 177 LPQWINALFFCVPLILIYLFI-------VFYNFLTISFLYQFNRPRYNQD--FIVVLGAG 227

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y++  + +++  I++ SGG      + E
Sbjct: 228 LINGETVSPLLA-----------KRINKAIAFYRAQSRATLNPPILLMSGGQGADEKVPE 276

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N  +S   M + M+G    I  S+ YH+ R+
Sbjct: 277 AIAMKQYAMEQGIPERDILVETNSTTTLENMLYSKEIMDQQMKGPYRAIFSSNNYHIFRA 336

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 337 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 372


>gi|262204353|ref|YP_003275561.1| hypothetical protein Gbro_4535 [Gordonia bronchialis DSM 43247]
 gi|262087700|gb|ACY23668.1| protein of unknown function DUF218 [Gordonia bronchialis DSM 43247]
          Length = 334

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 64/124 (51%), Gaps = 1/124 (0%)

Query: 94  YSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQ 153
            + +   +R  KS  + +    I++SGG P+K G+ E+      L+++GV+   I  E +
Sbjct: 156 AAELINRVRAGKSQAELTTSAPIVVSGGVPKK-GITEASAMQKWLVDNGVDASRITTEDK 214

Query: 154 SLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI 213
           S  T  NAQ +++++     ++IILV+S  H++R+   F   G+   AS +   +     
Sbjct: 215 SGSTVANAQNTAAILAGKGVRDIILVTSPSHIRRAAADFAATGLRVVASVTTGTDLSRYA 274

Query: 214 IPLS 217
            PL+
Sbjct: 275 TPLT 278


>gi|254457969|ref|ZP_05071396.1| integral membrane protein [Campylobacterales bacterium GD 1]
 gi|207085362|gb|EDZ62647.1| integral membrane protein [Campylobacterales bacterium GD 1]
          Length = 243

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 113/239 (47%), Gaps = 27/239 (11%)

Query: 6   IFLIVSYWHLLCQ----SIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQ 61
           +F +   W +L +     + K+     F LLF F  +      L+  L+  Y      P+
Sbjct: 16  VFSLFVIWFILSKLKKYKLAKVSLSLAFGLLFMF-SYPPFSNYLISDLENQY------PK 68

Query: 62  WKKDGNI--IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           +    NI  I +LGNG     T P   I  S     R  E + +Y   +   +  T    
Sbjct: 69  YDYKHNIKYIHVLGNGHNGDETQPISSI-ISEAGTRRALEGIIIYNQTEGSKLIFTGF-- 125

Query: 120 GGDPQKHGLAESIVYNNKL-LESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
           GGD +K  +A+    N +L L  GV+ +DI L  ++ DT + A F+  ++ +   +  +L
Sbjct: 126 GGD-EKISVAK---MNKRLALALGVKEEDIILGEKAKDTQEEAYFTKELVGD---EPFVL 178

Query: 179 VSSAYHLKRSQLYFQHFGINT-KASCSDYLNAYYSII--PLSANFYLTELALKEYIGIL 234
           V+SA H+ RS + F+  G+    A  + Y + + S +  P   +FYL+++A+ EY+GIL
Sbjct: 179 VTSASHIPRSMMLFESIGLKPIAAPTAFYKDKFRSFLKLPTMGSFYLSQIAMHEYLGIL 237


>gi|257884113|ref|ZP_05663766.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257819951|gb|EEV47099.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
          Length = 368

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 146 LPQWINALFFCVPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 196

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y++  + +++  I++ SGG      + E
Sbjct: 197 LINGETVSPLLA-----------KRINKAIAFYRAQSRATLNPPILLMSGGQGADEKVPE 245

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N  +S   M + M+G    I  S+ YH+ R+
Sbjct: 246 AIAMKQYAMEQGIPERDILVETNSTTTLENMLYSKEIMDQQMKGPYRAIFSSNNYHIFRA 305

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 306 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 341


>gi|152977155|ref|YP_001376672.1| hypothetical protein Bcer98_3467 [Bacillus cereus subsp. cytotoxis
           NVH 391-98]
 gi|152025907|gb|ABS23677.1| protein of unknown function DUF218 [Bacillus cytotoxicus NVH
           391-98]
          Length = 345

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 102/238 (42%), Gaps = 32/238 (13%)

Query: 2   LLSWIFL-IVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +L WI L I     L     + IF     ++L+ FI    +      +L + + RP    
Sbjct: 108 ILLWILLAIFDPASLFSSHFQPIFGAISLIILYFFIH---VLNFFTAYLLYQFNRP---- 160

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
             K + + I++LG+G       P +         SRI + +  Y      +   TII SG
Sbjct: 161 --KYNQDFIIVLGSGLIRDKVPPLLA--------SRIHKAIDFYHKQAAVASPPTIIFSG 210

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK---NII 177
           G      L E+       +E G+  +    E +S++T+QN  FS  ++ +++     N I
Sbjct: 211 GQGPDENLPEAEAMQKYAVEQGIPIEHTVQENRSVNTYQNMLFSKQIMDSLKPDGNYNSI 270

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
             ++ +HL R+ LY +  G+N++   S            +A +Y     ++EYI I++
Sbjct: 271 FATNNFHLFRAGLYAKQAGLNSQGIGSK-----------TAFYYWPNALIREYIAIVV 317


>gi|169628519|ref|YP_001702168.1| hypothetical protein MAB_1428 [Mycobacterium abscessus ATCC 19977]
 gi|169240486|emb|CAM61514.1| Conserved hypothetical protein [Mycobacterium abscessus]
          Length = 188

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 62/118 (52%), Gaps = 1/118 (0%)

Query: 87  IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERD 146
           ++P      ++++ +   ++      +  II++GG+PQ +G++E+    N L+  G   D
Sbjct: 50  LKPDGSMRDKLYQRVATGRAIANMFPNSFIIVTGGNPQ-NGVSEADQMRNMLVGLGYPSD 108

Query: 147 DIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
            I +E ++  T QNAQFS  + K      IILV+++ H +R+   F   G N  A+ S
Sbjct: 109 RIIVEPRANSTVQNAQFSVPLAKQAGASGIILVTNSTHQQRADRNFADAGGNVLATAS 166


>gi|294620208|ref|ZP_06699542.1| integral membrane protein [Enterococcus faecium E1679]
 gi|314940170|ref|ZP_07847348.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0133a04]
 gi|314942413|ref|ZP_07849256.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0133C]
 gi|314952311|ref|ZP_07855322.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0133A]
 gi|314994246|ref|ZP_07859549.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0133B]
 gi|314997161|ref|ZP_07862147.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0133a01]
 gi|291593561|gb|EFF25101.1| integral membrane protein [Enterococcus faecium E1679]
 gi|313588735|gb|EFR67580.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0133a01]
 gi|313591333|gb|EFR70178.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0133B]
 gi|313595570|gb|EFR74415.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0133A]
 gi|313598813|gb|EFR77658.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0133C]
 gi|313640609|gb|EFS05189.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0133a04]
          Length = 399

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 177 LPQWINALFFCVPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 227

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y++  + +++  I++ SGG      + E
Sbjct: 228 LINGETVSPLLA-----------KRINKAIAFYRAQSRATLNPPILLMSGGQGADEKVPE 276

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N  +S   M + M+G    I  S+ YH+ R+
Sbjct: 277 AIAMKQYAMEQGIPERDILVETNSTTTLENMLYSKEIMDQQMKGPYRAIFSSNNYHIFRA 336

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 337 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 372


>gi|83748341|ref|ZP_00945365.1| Integral membrane protein [Ralstonia solanacearum UW551]
 gi|207723927|ref|YP_002254325.1| hypothetical protein RSMK01443 [Ralstonia solanacearum MolK2]
 gi|83724963|gb|EAP72117.1| Integral membrane protein [Ralstonia solanacearum UW551]
 gi|206589134|emb|CAQ36096.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
          Length = 265

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 10/127 (7%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           ++ +GG P+  G+ E+ +    + + G  +D   +E +S  T +NA FS+ M++    + 
Sbjct: 132 VLATGGAPEGRGVPEAELMGRLVADLG--QDARWIEARSATTEENAAFSAPMLRAAGIQR 189

Query: 176 IILVSSAYHLKRSQLYFQHFG-INTKASCS-------DYLNAYYSIIPLSANFYLTELAL 227
           I LV+  +H+ R++ YF+  G I T A C               S++P +    LT  AL
Sbjct: 190 IYLVTHYWHMARARRYFEGQGLIVTPAPCGWGGELEERPAGGILSLLPRTDGLALTRSAL 249

Query: 228 KEYIGIL 234
           +E +G L
Sbjct: 250 REALGQL 256


>gi|114321439|ref|YP_743122.1| hypothetical protein Mlg_2290 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227833|gb|ABI57632.1| protein of unknown function DUF218 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 252

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 96/206 (46%), Gaps = 17/206 (8%)

Query: 38  WGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI 97
           W  +   LL  L+  +  P+   +   +   IV+LG+G +    +P +  + +     R+
Sbjct: 53  WAPVADRLLAPLEQRHP-PVHDARDHPEAQAIVVLGSGYSPHLALP-VTAQLNDSGLVRL 110

Query: 98  FETMRLYKSCKQHSMHCTIIISGG-DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
            E +RL++          +I+SGG  P +  +AE   +    +  GV  D +   T+  D
Sbjct: 111 NEGIRLHRQRPA----LPLIVSGGARPDQAPIAEG--FRRAAIALGVADDRLLPLTEPRD 164

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI--- 213
           T Q A  +  ++   +G  ++LV+SA H+ R+Q +F   G+N   + + +   +      
Sbjct: 165 TAQEAYATREVLG--EGATVLLVTSASHIHRAQAHFHRAGLNPIPAPTRHKAGHVRPATP 222

Query: 214 ---IPLSANFYLTELALKEYIGILIA 236
              IP + +   +E AL EY+G+L A
Sbjct: 223 GYWIPSATHLRKSERALYEYMGLLAA 248


>gi|315302477|ref|ZP_07873325.1| integral membrane protein [Listeria ivanovii FSL F6-596]
 gi|313629156|gb|EFR97441.1| integral membrane protein [Listeria ivanovii FSL F6-596]
          Length = 344

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 85/182 (46%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   +  Y K   +     T I+
Sbjct: 159 PRYNQD--FLIVLGSGL-----IGGDRVSPLLAS--RLDRAISFYQKQLMKKGKRATFIV 209

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+      L+  G++   I +E +S++T QN QFS   M   M   N +
Sbjct: 210 SGGQGTNETISEAEAMRGYLISKGIDETFIIMENKSVNTLQNMQFSKKKMDVIMPDYNSL 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ LY +  G+ ++   +            +A +Y+    ++E+I I++ Y
Sbjct: 270 FSTNNFHLFRASLYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAIIVMY 318

Query: 238 YR 239
            +
Sbjct: 319 KK 320


>gi|156973875|ref|YP_001444782.1| hypothetical protein VIBHAR_01585 [Vibrio harveyi ATCC BAA-1116]
 gi|156525469|gb|ABU70555.1| hypothetical protein VIBHAR_01585 [Vibrio harveyi ATCC BAA-1116]
          Length = 268

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 110/232 (47%), Gaps = 35/232 (15%)

Query: 27  SCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            CF++LFSF+G     +  + T LL  L+  Y+  L        G +  +++LGNG  + 
Sbjct: 38  GCFVVLFSFVGIFLVAFQPVSTKLLMPLEREYKAFL-----PVSGTVDYVMVLGNGHVVD 92

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISG--GDPQKHGLAESIVYN 135
             IP     P+ Q  SR    MRL +  +   M+    +I+SG  G  +   ++ + +  
Sbjct: 93  NEIP-----PTSQ-LSRT-ALMRLTEGIRILRMYPGAKLILSGYAGGSE---ISHARMMA 142

Query: 136 NKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHF 195
           N  L  GV + DI L   + DT++ A+ +++ +K    K+I+LV+SA H+KR+   F   
Sbjct: 143 NVALSLGVAKSDIILLEDAKDTWEEARQAAAFVKQ---KDIVLVTSASHMKRALYEFNAA 199

Query: 196 GINTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
           GI    + ++++        +    P +     TEL   EY+G L    R N
Sbjct: 200 GIKPIPAPTNFMAIDDIEQPWQKYAPKARYLEQTELYWYEYLGGLWQKLRDN 251


>gi|254719238|ref|ZP_05181049.1| hypothetical protein Bru83_06801 [Brucella sp. 83/13]
 gi|265984234|ref|ZP_06096969.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306837987|ref|ZP_07470845.1| Hypothetical protein BROD_0794 [Brucella sp. NF 2653]
 gi|264662826|gb|EEZ33087.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306406911|gb|EFM63132.1| Hypothetical protein BROD_0794 [Brucella sp. NF 2653]
          Length = 264

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 72/154 (46%), Gaps = 11/154 (7%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLET 152
            RI ETMRL +          I++SGG+    +    E+      LL+ G   D    E 
Sbjct: 107 DRIVETMRLARLYPD----AKILVSGGEGTFFEKSAREAETTRALLLDLGFSGDRYIFEG 162

Query: 153 QSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYS 212
           +S +T +NA FS ++ +   G+  +LV+SAYH+ R+   F+  G +  A   DY      
Sbjct: 163 KSRNTVENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVTAWPVDYKTRTRE 222

Query: 213 IIPL---SANFYLTE--LALKEYIGILIAYYRGN 241
              L   S N  L+   +AL+E+ G+   ++ G 
Sbjct: 223 TFGLYLESPNDALSRFSMALREWTGLTAYWWTGR 256


>gi|207742828|ref|YP_002259220.1| hypothetical protein RSIPO_01011 [Ralstonia solanacearum IPO1609]
 gi|206594222|emb|CAQ61149.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 243

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 10/127 (7%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           ++ +GG P+  G+ E+ +    + + G  +D   +E +S  T +NA FS+ M++    + 
Sbjct: 110 VLATGGAPEGRGVPEAELMGRLVADLG--QDARWIEARSATTEENAAFSAPMLRAAGIQR 167

Query: 176 IILVSSAYHLKRSQLYFQHFG-INTKASCS-------DYLNAYYSIIPLSANFYLTELAL 227
           I LV+  +H+ R++ YF+  G I T A C               S++P +    LT  AL
Sbjct: 168 IYLVTHYWHMARARRYFEGQGLIVTPAPCGWGGELEERPAGGILSLLPRTDGLALTRSAL 227

Query: 228 KEYIGIL 234
           +E +G L
Sbjct: 228 REALGQL 234


>gi|229093911|ref|ZP_04225003.1| hypothetical protein bcere0021_46320 [Bacillus cereus Rock3-42]
 gi|228689472|gb|EEL43285.1| hypothetical protein bcere0021_46320 [Bacillus cereus Rock3-42]
          Length = 298

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 103/232 (44%), Gaps = 35/232 (15%)

Query: 9   IVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI 68
           I+S   L    +  IF     + ++ FI    +   L  +  + + RP      +++ + 
Sbjct: 69  IISPASLFSSHLAPIFAGISLITVYFFIH---LSNFLTAYFLYQFNRP------RRNQDF 119

Query: 69  IVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           I++LG+G     +P + A          SRI + +  Y      +   TII SGG     
Sbjct: 120 IIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQAAVNTPPTIIFSGGQGPDE 169

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK-NIILVSSAY 183
           GL E+       +E G+  +    E +S++T+QN  FS  ++ ++  +GK   I  ++ +
Sbjct: 170 GLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMSFSKEIMDSLKPEGKYRSIFTTNNF 229

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 230 HLFRAGIYAKQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIVV 270


>gi|218531176|ref|YP_002421992.1| hypothetical protein Mchl_3226 [Methylobacterium chloromethanicum
           CM4]
 gi|218523479|gb|ACK84064.1| protein of unknown function DUF218 [Methylobacterium
           chloromethanicum CM4]
          Length = 265

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 8/132 (6%)

Query: 113 HCTIIISGGD--PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
              ++ SGG    ++  ++E+ + +      GV R+ + LE QS +T +NA FS+ M++ 
Sbjct: 122 QARLVFSGGSGSTREDAVSEAEIVSRYADTLGVPRNRLILEQQSRNTHENAVFSARMVQP 181

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-----LNAYYSIIPLSANFYLTEL 225
             G+  +LV+SA+H+ RS   F+  G +  A   DY      +AY      S      ++
Sbjct: 182 KPGERWLLVTSAWHMPRSMGCFRKAGFDVTAYPVDYRTNWPRDAYRLASFASDGLGELDI 241

Query: 226 ALKEYIGILIAY 237
            +KE+IG +IAY
Sbjct: 242 GVKEWIG-MIAY 252


>gi|227524764|ref|ZP_03954813.1| integral membrane protein [Lactobacillus hilgardii ATCC 8290]
 gi|227088071|gb|EEI23383.1| integral membrane protein [Lactobacillus hilgardii ATCC 8290]
          Length = 351

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 99/223 (44%), Gaps = 36/223 (16%)

Query: 25  FMSCFMLLFSF----IGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIP 80
           F++ F+ LF F      W  + ++++ +L F        P++ KD   I++LG+G  +I 
Sbjct: 133 FITMFLTLFIFYILLTVWNTMVSMIVYNLYF--------PKYDKD--YIIVLGSG--LID 180

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYK-SCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL 139
                R+  +     RI + +  Y    K+ S H  +I SGG      + E +      L
Sbjct: 181 GYKVGRLLGN-----RINKGIEFYHLQLKKTSKHAKLIFSGGQGGDEKIPEGVAMKKYAL 235

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---IILVSSAYHLKRSQLYFQHFG 196
           + GV   D  +E +S++T QN  FS  +IKN  G++   I+ V++ +H  R  +     G
Sbjct: 236 DQGVPETDTLVEDKSINTRQNLIFSDRIIKNDSGRDDSKIVFVTNNFHTLRGGILAGKLG 295

Query: 197 INTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           I      +            +  +YL    ++EY+ + + + R
Sbjct: 296 IPATGIGAK-----------TPFYYLPNAVIREYLALFVMHKR 327


>gi|229141535|ref|ZP_04270069.1| hypothetical protein bcere0013_46290 [Bacillus cereus BDRD-ST26]
 gi|228641935|gb|EEK98232.1| hypothetical protein bcere0013_46290 [Bacillus cereus BDRD-ST26]
          Length = 277

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 106/240 (44%), Gaps = 35/240 (14%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +L   +FL +S         + IF     + ++ FI    +   L  +  + + RP    
Sbjct: 40  ILFCILFLFISPASFFSSHFQPIFAGISLITVYFFIH---LSNFLSAYFLYQFNRP---- 92

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
             +++ + I++LG+G     +P + A          SRI + +  Y      +   TII 
Sbjct: 93  --RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQATVNTPPTIIF 140

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ--GK-N 175
           SGG     GL E+       +E G+  +    E +S++T+QN  FS  ++ +++  GK  
Sbjct: 141 SGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPDGKYK 200

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 201 SIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIIV 249


>gi|39936223|ref|NP_948499.1| hypothetical protein RPA3160 [Rhodopseudomonas palustris CGA009]
 gi|39650078|emb|CAE28601.1| DUF218 [Rhodopseudomonas palustris CGA009]
          Length = 264

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 90/195 (46%), Gaps = 20/195 (10%)

Query: 60  PQWKKDG----NIIVLLGN-GTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC 114
           P W + G     IIVL G   + +     A+ ++ S +      +  R Y   +      
Sbjct: 70  PPWHEAGRAPDGIIVLGGAIASELSAARNALEVDASAERVLAALDLARRYPKAR------ 123

Query: 115 TIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
            I+ SGG     +  +AE+ +    L   G+  D + LE +S  T +NA ++ +++    
Sbjct: 124 -IVYSGGSGNLIQRSVAEAPLAGELLERFGLASDRLVLEDKSRTTAENAAYTRALVAPKP 182

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL-----NAYYSIIPLSANFYLTELAL 227
           G+  +LV+SA+H+ RS + F+  G +      D+      +A  +   L+A    T++A+
Sbjct: 183 GELWLLVTSAFHMPRSIIAFRAAGFDVVPYPVDWRTRGSEDAARTFSTLAAGLARTDVAV 242

Query: 228 KEYIGILIAYYRGNR 242
            E+ G L+AY  G +
Sbjct: 243 HEWAG-LLAYRLGGK 256


>gi|229163803|ref|ZP_04291746.1| hypothetical protein bcere0009_45690 [Bacillus cereus R309803]
 gi|228619623|gb|EEK76506.1| hypothetical protein bcere0009_45690 [Bacillus cereus R309803]
          Length = 344

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 91/198 (45%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 148 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 193

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+       +E G+  +    E +S++T+QN
Sbjct: 194 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAIEKGIPLEHTVQENRSVNTYQN 249

Query: 161 AQFSSSMIKNMQGKN---IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ +++ K     I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 250 MSFSKEIMDSLKPKGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 298

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 299 AFYYWPNAMIREYVAIIV 316


>gi|196032709|ref|ZP_03100122.1| conserved domain protein [Bacillus cereus W]
 gi|195994138|gb|EDX58093.1| conserved domain protein [Bacillus cereus W]
          Length = 291

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 103/232 (44%), Gaps = 35/232 (15%)

Query: 9   IVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI 68
           I+S   L    +  IF     + ++ FI    +   L  +  + + RP      +++ + 
Sbjct: 62  IISPASLFSSHLEPIFAGISLITVYFFIH---LSNFLTAYFLYQFNRP------RRNQDF 112

Query: 69  IVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           I++LG+G     +P + A          SRI + +  Y      +   TII SGG     
Sbjct: 113 IIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQAAVNTPPTIIFSGGQGPDE 162

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK-NIILVSSAY 183
           GL E+       +E G+  +    E +S++T+QN  FS  ++ ++  +GK   I  ++ +
Sbjct: 163 GLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGKYRSIFTTNNF 222

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 223 HLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIVV 263


>gi|315281729|ref|ZP_07870291.1| integral membrane protein [Listeria marthii FSL S4-120]
 gi|313614619|gb|EFR88201.1| integral membrane protein [Listeria marthii FSL S4-120]
          Length = 356

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 87/182 (47%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   ++ Y K   +     T I+
Sbjct: 171 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLNRAIKFYDKQYAKKGKRATFIV 221

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+      LL  G++ + I +E +S++T QN +FS + M   M   N +
Sbjct: 222 SGGQGANETISEAEAMRGYLLNQGIDENFIIMEDKSVNTLQNMKFSKAKMDAIMPSYNSL 281

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ +Y +  G+ ++   +            +A +Y+    ++E+I I + Y
Sbjct: 282 FSTNNFHLFRAGIYARKAGLKSQGIGAK-----------TALYYMPNALIREFIAITVMY 330

Query: 238 YR 239
            +
Sbjct: 331 KK 332


>gi|170719815|ref|YP_001747503.1| hypothetical protein PputW619_0629 [Pseudomonas putida W619]
 gi|169757818|gb|ACA71134.1| protein of unknown function DUF218 [Pseudomonas putida W619]
          Length = 253

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 88/197 (44%), Gaps = 26/197 (13%)

Query: 56  PLLSPQWKK---DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSM 112
           PL S  W +     + IV+LG G            +PS  +  R+    RL K+      
Sbjct: 67  PLASGDWARLAQRADAIVVLGAGRERGDPAWGGEDQPSATALERMRFAARLAKASG---- 122

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQ-----SLDTFQNAQFSSSM 167
              ++ SGG       +E+ +  ++L      R+D  +E +     S  T++NAQFS+ +
Sbjct: 123 -LPVLTSGGLHYGTPPSEAQLMADRL------REDFAVEVKWKEEASRTTWENAQFSAQL 175

Query: 168 IKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS-----CSDYLNAYYSIIPLSANFYL 222
           +K +    ++LV+ A+H++RS+  F+  G     +       D+   +  ++P S   + 
Sbjct: 176 LKPLGIGRVVLVTQAWHMQRSRWSFEQAGFEVIPAPMGFLGRDHARPFAGLLPESRAMWQ 235

Query: 223 TELALKEYIGILIAYYR 239
           +   L E +G  +A YR
Sbjct: 236 SGQLLNEAVG--LAGYR 250


>gi|108758987|ref|YP_633512.1| hypothetical protein MXAN_5362 [Myxococcus xanthus DK 1622]
 gi|15076969|gb|AAK83000.1|AF285783_5 unknown [Myxococcus xanthus]
 gi|108462867|gb|ABF88052.1| conserved hypothetical protein [Myxococcus xanthus DK 1622]
          Length = 258

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 70/134 (52%), Gaps = 11/134 (8%)

Query: 116 IIISGG--DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
           +++SGG  DP+   + E+ V   +L + G+ R+ I  E +S +T +NA  S+ +I+    
Sbjct: 123 VLLSGGSLDPRPEAVVEADVLLRQLQQWGIPRERIVTEGRSRNTRENAVESARIIQERGW 182

Query: 174 KNIILVSSAYHLKRSQLYFQHFG-------INTKASCSDYLNAYYSIIPLSANFYLTELA 226
           K+++LV+SA H+ R+   F   G       ++++AS +       S +P S    L+  A
Sbjct: 183 KSLLLVTSAAHMPRAAGCFAAVGLRPDLLPVDSRASNTPLRR--MSWLPRSGALNLSTDA 240

Query: 227 LKEYIGILIAYYRG 240
           L+E  G  +   RG
Sbjct: 241 LRELAGRAVYRVRG 254


>gi|65322167|ref|ZP_00395126.1| COG1434: Uncharacterized conserved protein [Bacillus anthracis str.
           A2012]
          Length = 257

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 103/232 (44%), Gaps = 35/232 (15%)

Query: 9   IVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI 68
           I+S   L    +  IF     + ++ FI    +   L  +  + + RP      +++ + 
Sbjct: 28  IISPASLFSSHLEPIFAGISLITVYFFIH---LSNFLTAYFLYQFNRP------RRNQDF 78

Query: 69  IVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           I++LG+G     +P + A          SRI + +  Y      +   TII SGG     
Sbjct: 79  IIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQAAVNTPPTIIFSGGQGPDE 128

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK-NIILVSSAY 183
           GL E+       +E G+  +    E +S++T+QN  FS  ++ ++  +GK   I  ++ +
Sbjct: 129 GLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGKYRSIFTTNNF 188

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 189 HLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIVV 229


>gi|187778517|ref|ZP_02994990.1| hypothetical protein CLOSPO_02112 [Clostridium sporogenes ATCC
           15579]
 gi|187772142|gb|EDU35944.1| hypothetical protein CLOSPO_02112 [Clostridium sporogenes ATCC
           15579]
          Length = 181

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 61/109 (55%), Gaps = 6/109 (5%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R+ E +RLY           II+SG       ++E+      L+E GV+++ I LE +S 
Sbjct: 49  RLDEGLRLY----NEGYGKYIIVSGAKGPGENISEAEAMEKYLVEKGVDKNFIILEDKSK 104

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
           +T +N +FS   +++   K+ I+VS+ YHLKR++L  Q  GI  KAS S
Sbjct: 105 NTLENIKFSKKKMEDNNLKSSIIVSNKYHLKRAELLCQKEGI--KASYS 151


>gi|163802067|ref|ZP_02195963.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio sp. AND4]
 gi|159174208|gb|EDP59016.1| predicted S-adenosyl-L-methionine-dependent methyltransferase
           [Vibrio sp. AND4]
          Length = 268

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 112/232 (48%), Gaps = 35/232 (15%)

Query: 27  SCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            CF++LFSF+G     +  + T LL  L+  Y+  L        G+I  +++LGNG  + 
Sbjct: 38  GCFVVLFSFVGIFLVAFQPVSTKLLMPLEREYKAFL-----PVSGSIDYVMVLGNGHVVD 92

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISG--GDPQKHGLAESIVYN 135
             IP     P+ Q  SR    MRL +  +   M+    +I+SG  G  +   ++ + +  
Sbjct: 93  NEIP-----PTSQ-LSRT-ALMRLTEGIRILRMYPGAKLILSGYAGGSE---ISHARMMA 142

Query: 136 NKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHF 195
           N  L  GV + DI L   + DT++ A+ +++ +K    K+I+LV+SA H+KR+   F   
Sbjct: 143 NVALSLGVAKSDIILLEDAEDTWEEARQAAAFVKQ---KDIVLVTSASHMKRALYEFHAA 199

Query: 196 GINTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
           GI    + ++++       ++    P +     TEL   E++G L    R N
Sbjct: 200 GIKPIPAPTNFMAIDEIEQSWQKYAPKARYLEQTELYWYEFLGGLWQKLRDN 251


>gi|163852418|ref|YP_001640461.1| hypothetical protein Mext_3001 [Methylobacterium extorquens PA1]
 gi|163664023|gb|ABY31390.1| protein of unknown function DUF218 [Methylobacterium extorquens
           PA1]
          Length = 278

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 8/132 (6%)

Query: 113 HCTIIISGG--DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
              ++ SGG    ++  ++E+ + +      GV R+ + LE QS +T +NA FS+ M++ 
Sbjct: 135 QARLVFSGGAGSTREDAVSEAEIVSRYADTLGVPRNRLILEQQSRNTHENAVFSARMVQP 194

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-----LNAYYSIIPLSANFYLTEL 225
             G+  +LV+SA+H+ RS   F+  G +  A   DY      +AY      S      ++
Sbjct: 195 KPGERWLLVTSAWHMPRSMGCFRKAGFDVTAYPVDYRTNWPRDAYRLASFASDGLGELDI 254

Query: 226 ALKEYIGILIAY 237
            +KE+IG +IAY
Sbjct: 255 GVKEWIG-MIAY 265


>gi|229198964|ref|ZP_04325651.1| hypothetical protein bcere0001_44800 [Bacillus cereus m1293]
 gi|228584510|gb|EEK42641.1| hypothetical protein bcere0001_44800 [Bacillus cereus m1293]
          Length = 277

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 106/240 (44%), Gaps = 35/240 (14%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +L   +FL +S         + IF     + ++ FI    +   L  +  + + RP    
Sbjct: 40  ILFCILFLFISPASFFSSHFQPIFAGISLITVYFFIH---LSNFLSAYFLYQFNRP---- 92

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
             +++ + I++LG+G     +P + A          SRI + +  Y      +   TII 
Sbjct: 93  --RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQAAVNTPPTIIF 140

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ--GK-N 175
           SGG     GL E+       +E G+  +    E +S++T+QN  FS  ++ +++  GK  
Sbjct: 141 SGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPDGKYK 200

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 201 SIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIVV 249


>gi|229020045|ref|ZP_04176829.1| hypothetical protein bcere0030_45390 [Bacillus cereus AH1273]
 gi|229026276|ref|ZP_04182635.1| hypothetical protein bcere0029_45540 [Bacillus cereus AH1272]
 gi|228734992|gb|EEL85628.1| hypothetical protein bcere0029_45540 [Bacillus cereus AH1272]
 gi|228741267|gb|EEL91481.1| hypothetical protein bcere0030_45390 [Bacillus cereus AH1273]
          Length = 344

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 92/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 148 LTAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 193

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+       +E G+  +    E +S++T+QN
Sbjct: 194 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQN 249

Query: 161 AQFSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 250 MSFSKKIMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 298

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 299 AFYYWPNAMIREYVAIVV 316


>gi|228929853|ref|ZP_04092868.1| hypothetical protein bthur0010_45360 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228948549|ref|ZP_04110829.1| hypothetical protein bthur0007_46750 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229124367|ref|ZP_04253555.1| hypothetical protein bcere0016_46510 [Bacillus cereus 95/8201]
 gi|228659019|gb|EEL14671.1| hypothetical protein bcere0016_46510 [Bacillus cereus 95/8201]
 gi|228811148|gb|EEM57489.1| hypothetical protein bthur0007_46750 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228829769|gb|EEM75391.1| hypothetical protein bthur0010_45360 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 298

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 103/232 (44%), Gaps = 35/232 (15%)

Query: 9   IVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI 68
           I+S   L    +  IF     + ++ FI    +   L  +  + + RP      +++ + 
Sbjct: 69  IISPASLFSSHLEPIFAGISLITVYFFIH---LSNFLTAYFLYQFNRP------RRNQDF 119

Query: 69  IVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           I++LG+G     +P + A          SRI + +  Y      +   TII SGG     
Sbjct: 120 IIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQAAVNTPPTIIFSGGQGPDE 169

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK-NIILVSSAY 183
           GL E+       +E G+  +    E +S++T+QN  FS  ++ ++  +GK   I  ++ +
Sbjct: 170 GLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGKYRSIFTTNNF 229

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 230 HLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIVV 270


>gi|52140703|ref|YP_086126.1| membrane spanning protein [Bacillus cereus E33L]
 gi|51974172|gb|AAU15722.1| conserved hypothetical protein; possible membrane spanning protein
           [Bacillus cereus E33L]
          Length = 345

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 90/196 (45%), Gaps = 32/196 (16%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A          SRI + + 
Sbjct: 149 LTAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAID 192

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
            Y      +   TII SGG     GL E+       +E G+  +    E +S++T+QN  
Sbjct: 193 FYWKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPIEHTVQENRSVNTYQNMS 252

Query: 163 FSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSAN 219
           FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +A 
Sbjct: 253 FSKEIMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAF 301

Query: 220 FYLTELALKEYIGILI 235
           +Y     ++EY+ I++
Sbjct: 302 YYWPNAMIREYVAIVV 317


>gi|229158416|ref|ZP_04286478.1| hypothetical protein bcere0010_45910 [Bacillus cereus ATCC 4342]
 gi|228625023|gb|EEK81788.1| hypothetical protein bcere0010_45910 [Bacillus cereus ATCC 4342]
          Length = 298

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 90/196 (45%), Gaps = 32/196 (16%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A          SRI + + 
Sbjct: 102 LTAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAID 145

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
            Y      +   TII SGG     GL E+       +E G+  +    E +S++T+QN  
Sbjct: 146 FYWKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMS 205

Query: 163 FSSSMIKNMQ--GK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSAN 219
           FS  ++ +++  GK   I  ++ +HL R+ +Y +  G+N++   S            +A 
Sbjct: 206 FSKDIMDSLKPDGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAF 254

Query: 220 FYLTELALKEYIGILI 235
           +Y     ++EY+ I++
Sbjct: 255 YYWPNAMIREYVAIVV 270


>gi|323439958|gb|EGA97673.1| hypothetical protein SAO11_1094 [Staphylococcus aureus O11]
          Length = 322

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 83/180 (46%), Gaps = 28/180 (15%)

Query: 62  WKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           + K+ +II++LG G  T  +  + A R++ +   Y             +Q +    II+S
Sbjct: 143 YNKEVDIIIVLGAGIFTEFVTPMLAARLDRALDIY-------------QQQASATKIIVS 189

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK--NII 177
           G       + E++     L+  GV++ DI +E+ S++T+ N  +S  +I N+  K   I+
Sbjct: 190 GRQGPDEPIPEALAMQRYLIAHGVDKTDILMESHSINTYTNFLYSKQIINNLYHKAVKIV 249

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            V+S +H+ R+    Q  G++     S            +   +   + +K+Y+G++  Y
Sbjct: 250 CVTSQFHVLRALRLAQKLGLSIDGVGSH-----------TPYHFFLHVLIKDYLGVMYQY 298


>gi|229062493|ref|ZP_04199806.1| hypothetical protein bcere0026_45600 [Bacillus cereus AH603]
 gi|228716776|gb|EEL68467.1| hypothetical protein bcere0026_45600 [Bacillus cereus AH603]
          Length = 344

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 92/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 148 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 193

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+       +E G+  +    E +S++T+QN
Sbjct: 194 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPPEHTVQENRSVNTYQN 249

Query: 161 AQFSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 250 MSFSKEIMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 298

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 299 AFYYWPNAMIREYVAIVV 316


>gi|257883084|ref|ZP_05662737.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257818742|gb|EEV46070.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
          Length = 368

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 100/227 (44%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 146 LPQWINALFFCVPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 196

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y++  + +++  I++ SGG      + E
Sbjct: 197 LINGETVSPLLA-----------KRINKAIAFYRAQSRATLNPPILLMSGGQGADEKVPE 245

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N  +S   M + M+G    I  S+ YH+ R+
Sbjct: 246 AIAMKQYAMEQGIPERDILVETNSTTTLENMLYSKEIMDQQMKGPYRAIFSSNNYHIFRA 305

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY   +    KA+      A+Y         YL    L+EYI IL+
Sbjct: 306 GLY--AWQAKLKANGIGAKTAFY---------YLPNAFLREYIAILM 341


>gi|206978334|ref|ZP_03239209.1| conserved domain protein [Bacillus cereus H3081.97]
 gi|217962290|ref|YP_002340860.1| hypothetical protein BCAH187_A4938 [Bacillus cereus AH187]
 gi|222098272|ref|YP_002532329.1| hypothetical protein BCQ_4614 [Bacillus cereus Q1]
 gi|206743465|gb|EDZ54897.1| conserved domain protein [Bacillus cereus H3081.97]
 gi|217064139|gb|ACJ78389.1| conserved domain protein [Bacillus cereus AH187]
 gi|221242330|gb|ACM15040.1| conserved hypothetical protein [Bacillus cereus Q1]
          Length = 344

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 104/238 (43%), Gaps = 31/238 (13%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +L   +FL +S         + IF     + ++ FI    +   L  +  + + RP    
Sbjct: 107 ILFCILFLFISPASFFSSHFQPIFAGISLITVYFFIH---LSNFLSAYFLYQFNRP---- 159

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
             +++ + I++LG+G       P +         SRI + +  Y      +   TII SG
Sbjct: 160 --RRNQDFIIVLGSGLINDKVPPLLA--------SRIHKAIDFYWKQATVNTPPTIIFSG 209

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ--GK-NII 177
           G     GL E+       +E G+  +    E +S++T+QN  FS  ++ +++  GK   I
Sbjct: 210 GQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPDGKYKSI 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
             ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 270 FTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIIV 316


>gi|300769543|ref|ZP_07079429.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|300492958|gb|EFK28140.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
          Length = 361

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 77/179 (43%), Gaps = 23/179 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH-CTIII 118
           P+ ++D   I++LG G      +   R+ P      RI   +R Y+  ++ + H   +I 
Sbjct: 173 PRLRQD--YIIVLGAGL-----LDGDRVSPLLGQ--RIMRGLRFYQKQQRKTHHRAVMIF 223

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN--I 176
           SGG      + E        +  G+   D   ETQS  T QN QFS  +I     KN   
Sbjct: 224 SGGQGGDETVPEGQAMLEYAIAHGLPATDGWAETQSKTTLQNMQFSKQLIAQGPVKNPRT 283

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           I V++ YH  R+ ++ +  G+      +            +A F+L +  ++EYI I +
Sbjct: 284 IFVTNNYHTFRAGMFAKQAGLKADGIGAR-----------TARFFLPDAIIREYIAIFV 331


>gi|254557746|ref|YP_003064163.1| integral membrane protein [Lactobacillus plantarum JDM1]
 gi|308181833|ref|YP_003925961.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|254046673|gb|ACT63466.1| integral membrane protein [Lactobacillus plantarum JDM1]
 gi|308047324|gb|ADN99867.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 361

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 77/179 (43%), Gaps = 23/179 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH-CTIII 118
           P+ ++D   I++LG G      +   R+ P      RI   +R Y+  ++ + H   +I 
Sbjct: 173 PRLRQD--YIIVLGAGL-----LDGDRVSPLLGQ--RIMRGLRFYQKQQRKTHHRAVMIF 223

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN--I 176
           SGG      + E        +  G+   D   ETQS  T QN QFS  +I     KN   
Sbjct: 224 SGGQGGDETVPEGQAMLEYAIAHGLPATDGWAETQSKTTLQNMQFSKQLIAQGPVKNPRT 283

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           I V++ YH  R+ ++ +  G+      +            +A F+L +  ++EYI I +
Sbjct: 284 IFVTNNYHTFRAGMFAKQAGLKADGIGAR-----------TARFFLPDAIIREYIAIFV 331


>gi|227551940|ref|ZP_03981989.1| integral membrane protein [Enterococcus faecium TX1330]
 gi|293378333|ref|ZP_06624502.1| putative membrane protein [Enterococcus faecium PC4.1]
 gi|293571655|ref|ZP_06682676.1| integral membrane protein [Enterococcus faecium E980]
 gi|227178941|gb|EEI59913.1| integral membrane protein [Enterococcus faecium TX1330]
 gi|291608325|gb|EFF37626.1| integral membrane protein [Enterococcus faecium E980]
 gi|292643197|gb|EFF61338.1| putative membrane protein [Enterococcus faecium PC4.1]
          Length = 399

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 177 LPQWINALFFCIPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 227

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y +  + +++  I++ SGG      + E
Sbjct: 228 LINGETVSPLLA-----------KRINKAIAFYWAQSRATLNPPILLMSGGQGADEKVPE 276

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N ++S   M + M+G    I  S+ YH+ R+
Sbjct: 277 AIAMKQYAMEQGIPERDILVETNSTTTLENMRYSKEIMDQQMKGPYRAIFSSNNYHIFRA 336

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 337 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 372


>gi|261209456|ref|ZP_05923819.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289567586|ref|ZP_06447918.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|260076584|gb|EEW64348.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289160620|gb|EFD08588.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
          Length = 349

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 127 LPQWINALFFCVPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 177

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y++  + +++  I++ SGG      + E
Sbjct: 178 LINGETVSPLLA-----------KRINKAIAFYRAQSRATLNPPILLMSGGQGADEKVPE 226

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N  +S   M + M+G    I  S+ YH+ R+
Sbjct: 227 AIAMKQYAMEQGIPERDILVETNSTTTLENMLYSKEIMDQQMKGPYRAIFSSNNYHIFRA 286

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EY+ IL+
Sbjct: 287 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYLAILM 322


>gi|28379603|ref|NP_786495.1| integral membrane protein [Lactobacillus plantarum WCFS1]
 gi|28272443|emb|CAD65367.1| integral membrane protein [Lactobacillus plantarum WCFS1]
          Length = 361

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 77/179 (43%), Gaps = 23/179 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH-CTIII 118
           P+ ++D   I++LG G      +   R+ P      RI   +R Y+  ++ + H   +I 
Sbjct: 173 PRLRQD--YIIVLGAGL-----LDGDRVSPLLGQ--RIMRGLRFYQKQQRKTHHRAVMIF 223

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN--I 176
           SGG      + E        +  G+   D   ETQS  T QN QFS  +I     KN   
Sbjct: 224 SGGQGGDETVPEGQAMLEYAIAHGLPATDGWAETQSKTTLQNMQFSKQLIAQGPVKNPRT 283

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           I V++ YH  R+ ++ +  G+      +            +A F+L +  ++EYI I +
Sbjct: 284 IFVTNNYHTFRAGMFAKQAGLKADGIGAR-----------TARFFLPDAIIREYIAIFV 331


>gi|257879975|ref|ZP_05659628.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257893086|ref|ZP_05672739.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|257814203|gb|EEV42961.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257829465|gb|EEV56072.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
          Length = 368

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 146 LPQWINALFFCVPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 196

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y++  + +++  I++ SGG      + E
Sbjct: 197 LINGETVSPLLA-----------KRINKAIAFYRAQSRATLNPPILLMSGGQGADEKVPE 245

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N  +S   M + M+G    I  S+ YH+ R+
Sbjct: 246 AIAMKQYAMEQGIPERDILVETNSTTTLENMLYSKEIMDQQMKGPYRAIFSSNNYHIFRA 305

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EY+ IL+
Sbjct: 306 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYLAILM 341


>gi|69249391|ref|ZP_00604956.1| Protein of unknown function DUF218 [Enterococcus faecium DO]
 gi|258614355|ref|ZP_05712125.1| hypothetical protein EfaeD_01478 [Enterococcus faecium DO]
 gi|68194178|gb|EAN08708.1| Protein of unknown function DUF218 [Enterococcus faecium DO]
          Length = 399

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 177 LPQWINALFFCVPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 227

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y++  + +++  I++ SGG      + E
Sbjct: 228 LINGETVSPLLA-----------KRINKAIAFYRAQSRATLNPPILLMSGGQGADEKVPE 276

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N  +S   M + M+G    I  S+ YH+ R+
Sbjct: 277 AIAMKQYAMEQGIPERDILVETNSTTTLENMLYSKEIMDQQMKGPYRAIFSSNNYHIFRA 336

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EY+ IL+
Sbjct: 337 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYLAILM 372


>gi|227513619|ref|ZP_03943668.1| integral membrane protein [Lactobacillus buchneri ATCC 11577]
 gi|227083135|gb|EEI18447.1| integral membrane protein [Lactobacillus buchneri ATCC 11577]
          Length = 351

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 99/223 (44%), Gaps = 36/223 (16%)

Query: 25  FMSCFMLLFSF----IGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIP 80
           F++ F+ LF F      W  + ++++ +L F        P++ KD   I++LG+G  +I 
Sbjct: 133 FITMFLTLFIFYILLTVWNTMVSMIVYNLYF--------PKYDKD--YIIVLGSG--LID 180

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYK-SCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL 139
                R+  +     RI + +  Y    K+ S H  +I SGG      + E +      L
Sbjct: 181 GYKVGRLLGN-----RINKGIEFYHLQLKKTSKHAKLIFSGGQGGDEKIPEGVAMKKYAL 235

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---IILVSSAYHLKRSQLYFQHFG 196
           + GV   D  +E +S++T QN  FS  +IKN  G++   I+ V++ +H  R  +     G
Sbjct: 236 DQGVPETDTLVEDKSINTRQNLIFSDRIIKNDSGRDDSKIVFVTNNFHTLRGGILAGKLG 295

Query: 197 INTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           I      +            +  +YL    ++EY+ + + + R
Sbjct: 296 IPATEIGAK-----------TPFYYLPNAVIREYLALFVMHKR 327


>gi|30264869|ref|NP_847246.1| hypothetical protein BA_5055 [Bacillus anthracis str. Ames]
 gi|47530355|ref|YP_021704.1| hypothetical protein GBAA_5055 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49187685|ref|YP_030938.1| hypothetical protein BAS4694 [Bacillus anthracis str. Sterne]
 gi|165869591|ref|ZP_02214249.1| conserved domain protein [Bacillus anthracis str. A0488]
 gi|167633993|ref|ZP_02392316.1| conserved domain protein [Bacillus anthracis str. A0442]
 gi|167638097|ref|ZP_02396375.1| conserved domain protein [Bacillus anthracis str. A0193]
 gi|170685702|ref|ZP_02876925.1| conserved domain protein [Bacillus anthracis str. A0465]
 gi|170705528|ref|ZP_02895992.1| conserved domain protein [Bacillus anthracis str. A0389]
 gi|177651307|ref|ZP_02934138.1| conserved domain protein [Bacillus anthracis str. A0174]
 gi|190567172|ref|ZP_03020087.1| conserved domain protein [Bacillus anthracis Tsiankovskii-I]
 gi|227817596|ref|YP_002817605.1| hypothetical protein BAMEG_5089 [Bacillus anthracis str. CDC 684]
 gi|229602236|ref|YP_002869074.1| hypothetical protein BAA_5066 [Bacillus anthracis str. A0248]
 gi|254687608|ref|ZP_05151464.1| hypothetical protein BantC_27690 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254725174|ref|ZP_05186957.1| hypothetical protein BantA1_22344 [Bacillus anthracis str. A1055]
 gi|254736912|ref|ZP_05194618.1| hypothetical protein BantWNA_17226 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254741947|ref|ZP_05199634.1| hypothetical protein BantKB_13153 [Bacillus anthracis str. Kruger
           B]
 gi|254754455|ref|ZP_05206490.1| hypothetical protein BantV_18392 [Bacillus anthracis str. Vollum]
 gi|254757288|ref|ZP_05209315.1| hypothetical protein BantA9_03186 [Bacillus anthracis str.
           Australia 94]
 gi|30259544|gb|AAP28732.1| conserved domain protein [Bacillus anthracis str. Ames]
 gi|47505503|gb|AAT34179.1| conserved domain protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49181612|gb|AAT56988.1| conserved domain protein [Bacillus anthracis str. Sterne]
 gi|164714420|gb|EDR19939.1| conserved domain protein [Bacillus anthracis str. A0488]
 gi|167513914|gb|EDR89282.1| conserved domain protein [Bacillus anthracis str. A0193]
 gi|167530794|gb|EDR93496.1| conserved domain protein [Bacillus anthracis str. A0442]
 gi|170129653|gb|EDS98516.1| conserved domain protein [Bacillus anthracis str. A0389]
 gi|170670166|gb|EDT20906.1| conserved domain protein [Bacillus anthracis str. A0465]
 gi|172083133|gb|EDT68195.1| conserved domain protein [Bacillus anthracis str. A0174]
 gi|190561676|gb|EDV15646.1| conserved domain protein [Bacillus anthracis Tsiankovskii-I]
 gi|227003708|gb|ACP13451.1| conserved domain protein [Bacillus anthracis str. CDC 684]
 gi|229266644|gb|ACQ48281.1| conserved domain protein [Bacillus anthracis str. A0248]
          Length = 345

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 90/196 (45%), Gaps = 32/196 (16%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A          SRI + + 
Sbjct: 149 LTAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAID 192

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
            Y      +   TII SGG     GL E+       +E G+  +    E +S++T+QN  
Sbjct: 193 FYWKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNML 252

Query: 163 FSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSAN 219
           FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +A 
Sbjct: 253 FSKEIMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAF 301

Query: 220 FYLTELALKEYIGILI 235
           +Y     ++EY+ I++
Sbjct: 302 YYWPNAMIREYVAIVV 317


>gi|49481369|ref|YP_038846.1| hypothetical protein BT9727_4534 [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|49332925|gb|AAT63571.1| conserved hypothetical protein, possible membrane spanning protein
           [Bacillus thuringiensis serovar konkukian str. 97-27]
          Length = 344

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 90/196 (45%), Gaps = 32/196 (16%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A          SRI + + 
Sbjct: 148 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAID 191

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
            Y      +   TII SGG     GL E+       +E G+  +    E +S++T+QN  
Sbjct: 192 FYWKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPIEHTVQENRSVNTYQNMS 251

Query: 163 FSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSAN 219
           FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +A 
Sbjct: 252 FSKEIMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAF 300

Query: 220 FYLTELALKEYIGILI 235
           +Y     ++EY+ I++
Sbjct: 301 YYWPNAMIREYVAIVV 316


>gi|47565235|ref|ZP_00236278.1| hypothetical protein membrane Spanning protein [Bacillus cereus
           G9241]
 gi|47558021|gb|EAL16346.1| hypothetical protein membrane Spanning protein [Bacillus cereus
           G9241]
          Length = 333

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 92/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 137 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 182

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+       +E G+  +    E +S++T+QN
Sbjct: 183 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQN 238

Query: 161 AQFSSSMIKNMQ--GK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ +++  GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 239 MSFSKEIMDSLKPNGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 287

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 288 AFYYWPNAMIREYVAIVV 305


>gi|309390074|gb|ADO77954.1| protein of unknown function DUF218 [Halanaerobium praevalens DSM
           2228]
          Length = 253

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 71/253 (28%), Positives = 118/253 (46%), Gaps = 34/253 (13%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFS-FIGWGIIPTILLKHLQFSYQRPLLS 59
           ++L+++FLI  + +   + IR     + F L+F  F+   +   +L+  L+   +R L+ 
Sbjct: 20  IVLNFVFLIYLFKNKSSKLIR---LTAVFSLIFLIFLATAVGARVLVHPLENYAERNLVE 76

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
              K     IV+LG G+       A +  PS  S  R+ +   L++S K       +I S
Sbjct: 77  VSQKYP---IVVLGGGSNYYS---AKKTTPSTHSLQRLVKGYELHRSLK-----TPLIYS 125

Query: 120 GGDP-QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
           GG    +  ++E+   +  L + G++ +    ET++  TF+NA +    IK  Q K + L
Sbjct: 126 GGVAIGQQNISEADAASEFLQDLGMDLEFYFSETKAQTTFENAAYLRKWIKQHQVKKVYL 185

Query: 179 VSSAYHLKRSQLYFQ---------HFGI--NTKASCSDYLNAYYSIIPLSANFYLTELAL 227
            +SAYH+ RS   F+         H G   N K S  DY   + S   L+AN      AL
Sbjct: 186 FTSAYHMLRSMTVFKAQQIEVLPVHSGFIYNHKLSWLDY---FPSRGALNANL----TAL 238

Query: 228 KEYIGILIAYYRG 240
            E+IG+   Y +G
Sbjct: 239 HEWIGLFWYYLKG 251


>gi|257886897|ref|ZP_05666550.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257895468|ref|ZP_05675121.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257822951|gb|EEV49883.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257832033|gb|EEV58454.1| conserved hypothetical protein [Enterococcus faecium Com12]
          Length = 368

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 146 LPQWINALFFCIPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 196

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y +  + +++  I++ SGG      + E
Sbjct: 197 LINGETVSPLLA-----------KRINKAIAFYWAQSRATLNPPILLMSGGQGADEKVPE 245

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +E G+   DI +ET S  T +N ++S   M + M+G    I  S+ YH+ R+
Sbjct: 246 AIAMKQYAMEQGIPERDILVETNSTTTLENMRYSKEIMDQQMKGPYRAIFSSNNYHIFRA 305

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 306 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 341


>gi|110800807|ref|YP_695894.1| hypothetical protein CPF_1451 [Clostridium perfringens ATCC 13124]
 gi|110675454|gb|ABG84441.1| conserved hypothetical protein [Clostridium perfringens ATCC 13124]
          Length = 257

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 53/96 (55%), Gaps = 5/96 (5%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           ++   +  I++SGG      + E+      L+E+GV +D I LE ++  T++N  +S  +
Sbjct: 127 EKTGFNGEIVVSGGQGPGESITEAYAMEKYLVENGVPKDKIVLENKATSTYENLNYSKKI 186

Query: 168 IKNMQGK-----NIILVSSAYHLKRSQLYFQHFGIN 198
           I+N+ GK     +I++V++ +H  RS L  +  G N
Sbjct: 187 IENLSGKPIKDLDILIVTTDFHAMRSNLLAKRNGYN 222


>gi|228917456|ref|ZP_04081005.1| hypothetical protein bthur0012_46660 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228842128|gb|EEM87227.1| hypothetical protein bthur0012_46660 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 298

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 103/232 (44%), Gaps = 35/232 (15%)

Query: 9   IVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI 68
           I+S   L    +  IF     + ++ FI    +   L  +  + + RP      +++ + 
Sbjct: 69  IISPASLFSSHLEPIFAGISLITVYFFIH---LSNFLTAYFLYQFNRP------RRNQDF 119

Query: 69  IVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           I++LG+G     +P + A          SRI + +  Y      +   TII SGG     
Sbjct: 120 IIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQAAVNTPPTIIFSGGQGPDE 169

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ--GK-NIILVSSAY 183
           GL E+       +E G+  +    E +S++T+QN  FS  ++ +++  GK   I  ++ +
Sbjct: 170 GLPEAEAMQKYAVEKGIPIEHTVQENRSVNTYQNMLFSKEIMDSLKPNGKYKSIFTTNNF 229

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I++
Sbjct: 230 HLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIVV 270


>gi|222100068|ref|YP_002534636.1| hypothetical protein CTN_1094 [Thermotoga neapolitana DSM 4359]
 gi|221572458|gb|ACM23270.1| Putative uncharacterized protein [Thermotoga neapolitana DSM 4359]
          Length = 252

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 97/202 (48%), Gaps = 27/202 (13%)

Query: 50  QFSYQRPL----LSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETM--RL 103
           +F + RPL    + P       +IV+LG G           +E + ++   + ++   R+
Sbjct: 66  EFLFLRPLEEDLIVPDGLPQNGVIVILGGG-----------VERNTKTGDSLSDSTLRRI 114

Query: 104 YKSCKQH-SMHCTIIISGGDPQKHGL-AESIVYNNKLLESGVERDDIKLETQSLDTFQNA 161
               + H      I+++GG     GL  E+I+    L+  GV   ++ +E +S +T++NA
Sbjct: 115 LTGFQVHRKTGLPILVTGG--SLSGLEPEAIIMKEYLVSLGVPEKNVLVENRSRNTYENA 172

Query: 162 QFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHF---GINTKASCSDYLNAYYSIIPLSA 218
            F+ ++I ++    I+LV+ + H++R+   F+ F    +   A C      +   +P + 
Sbjct: 173 FFTKNLIGDVP---IVLVTDSIHMRRALYTFKKFFSEVVPYPAGCYFGTPEFVDFLPSAT 229

Query: 219 NFYLTELALKEYIGILIAYYRG 240
           +FYL   A+ E+IG++    RG
Sbjct: 230 SFYLNSRAIYEWIGLVWYNLRG 251


>gi|229175521|ref|ZP_04303031.1| hypothetical protein bcere0006_45990 [Bacillus cereus MM3]
 gi|228607917|gb|EEK65229.1| hypothetical protein bcere0006_45990 [Bacillus cereus MM3]
          Length = 344

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 90/196 (45%), Gaps = 32/196 (16%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A          SRI + + 
Sbjct: 148 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAID 191

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
            Y      +   TII SGG     GL E+       +E G+  +    E +S++T+QN  
Sbjct: 192 FYWKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPIEHTVQENRSVNTYQNMS 251

Query: 163 FSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSAN 219
           FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +A 
Sbjct: 252 FSKEIMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAF 300

Query: 220 FYLTELALKEYIGILI 235
           +Y     ++EY+ I++
Sbjct: 301 YYWPNAMIREYVAIVV 316


>gi|229193086|ref|ZP_04320041.1| hypothetical protein bcere0002_47360 [Bacillus cereus ATCC 10876]
 gi|228590350|gb|EEK48214.1| hypothetical protein bcere0002_47360 [Bacillus cereus ATCC 10876]
          Length = 345

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 108/242 (44%), Gaps = 39/242 (16%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           ML   +  I++   L+   +  IF     +  + FI    +   L  +  + + RP    
Sbjct: 108 MLFFMLLPIINPASLVSSHLEPIFAAISLISFYFFIH---LSNFLSAYFLYQFNRP---- 160

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCT--I 116
             +++ + I++LG+G     +P + A RI  +   Y             KQ +++    I
Sbjct: 161 --RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPII 206

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK 174
           I SGG     GL E+    N  +E G+  +    E +S++T+QN  FS  ++ ++  +GK
Sbjct: 207 IFSGGQGPDEGLPEAEAMQNYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGK 266

Query: 175 -NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I
Sbjct: 267 YKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAI 315

Query: 234 LI 235
           ++
Sbjct: 316 VV 317


>gi|229048503|ref|ZP_04194066.1| hypothetical protein bcere0027_44660 [Bacillus cereus AH676]
 gi|229112264|ref|ZP_04241804.1| hypothetical protein bcere0018_45060 [Bacillus cereus Rock1-15]
 gi|229147372|ref|ZP_04275721.1| hypothetical protein bcere0012_45020 [Bacillus cereus BDRD-ST24]
 gi|296505264|ref|YP_003666964.1| hypothetical protein BMB171_C4436 [Bacillus thuringiensis BMB171]
 gi|228636054|gb|EEK92535.1| hypothetical protein bcere0012_45020 [Bacillus cereus BDRD-ST24]
 gi|228671248|gb|EEL26552.1| hypothetical protein bcere0018_45060 [Bacillus cereus Rock1-15]
 gi|228722868|gb|EEL74250.1| hypothetical protein bcere0027_44660 [Bacillus cereus AH676]
 gi|296326316|gb|ADH09244.1| hypothetical protein BMB171_C4436 [Bacillus thuringiensis BMB171]
          Length = 345

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 110/242 (45%), Gaps = 39/242 (16%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           ML   +  I++   L+   +  IF     + ++ FI    +   L  +  + + RP    
Sbjct: 108 MLFFMLLPIINPASLVSSHLEPIFAAISLISIYFFIH---LSNFLSAYFLYQFNRP---- 160

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC--TI 116
             +++ + I++LG+G     +P + A RI  +   Y             KQ +++   TI
Sbjct: 161 --RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPTI 206

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK 174
           I SGG     GL E+    +  +E G+  +    E +S++T+QN  FS  ++ ++  +GK
Sbjct: 207 IFSGGQGPDEGLPEAEAMQSYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGK 266

Query: 175 -NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I
Sbjct: 267 YKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAI 315

Query: 234 LI 235
           ++
Sbjct: 316 VV 317


>gi|168213058|ref|ZP_02638683.1| conserved hypothetical protein [Clostridium perfringens CPE str.
           F4969]
 gi|170715436|gb|EDT27618.1| conserved hypothetical protein [Clostridium perfringens CPE str.
           F4969]
          Length = 257

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 53/96 (55%), Gaps = 5/96 (5%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           ++   +  I++SGG      + E+      L+E+GV +D I LE ++  T++N  +S  +
Sbjct: 127 EKTGFNGEIVVSGGQGPGESITEAYAMEKYLVENGVPKDKIVLENKATSTYENLNYSKKI 186

Query: 168 IKNMQGK-----NIILVSSAYHLKRSQLYFQHFGIN 198
           I+N+ GK     +I++V++ +H  RS L  +  G N
Sbjct: 187 IENLSGKPIKDLDILIVTTDFHAMRSNLLAKRNGYN 222


>gi|162449133|ref|YP_001611500.1| hypothetical protein sce0863 [Sorangium cellulosum 'So ce 56']
 gi|161159715|emb|CAN91020.1| hypothetical protein sce0863 [Sorangium cellulosum 'So ce 56']
          Length = 253

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 64/123 (52%), Gaps = 4/123 (3%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           +I+SG D +      +    + L+E GV R  I LET+S DT +NA  S+ + + +    
Sbjct: 129 VIVSGKDVRGAPTQLASAMADLLVELGVPRKKIILETESRDTRENALHSTRIARGLSADA 188

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLN----AYYSIIPLSANFYLTELALKEYI 231
           +++V+SA H+ RS   F+  G++   +   + +        ++P S +   ++ A+ E +
Sbjct: 189 VVVVTSALHMPRSLRMFERAGLDVLPAPVRFQSLPPEGPERLLPESLSLRRSQRAVHELV 248

Query: 232 GIL 234
           G+L
Sbjct: 249 GLL 251


>gi|146341164|ref|YP_001206212.1| hypothetical protein BRADO4236 [Bradyrhizobium sp. ORS278]
 gi|146193970|emb|CAL77987.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 262

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 101/222 (45%), Gaps = 14/222 (6%)

Query: 25  FMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPA 84
            ++  MLL + +G   + +++L  L+  +  P   P       IIVL G   + +  I  
Sbjct: 41  LVASAMLLLAIVGLTPLGSLMLYPLESRF--PKWDPAKGAPDGIIVLGGPVDSDLSAIYG 98

Query: 85  IRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL-AESIVYNNKLLES-G 142
           + +  +     R+ +   L +       +  ++ +GG        A+      ++LES G
Sbjct: 99  MPV--TVAGADRVIQAAVLARRYP----NARVLFTGGSANLIATDAKEADVGAEILESLG 152

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
           V +  + LE QS +T++NA FS +MI    G+  +LV+SAYH+ RS   F+  G   +  
Sbjct: 153 VAKQRLLLERQSRNTYENAIFSKAMIAPKPGERWLLVTSAYHMPRSVGLFRKAGFPVEPY 212

Query: 203 CSDYLNAY---YSIIPLSANFYLTELALKEYIGILIAYYRGN 241
             D+       +  + L       ++A++E++G++    RG 
Sbjct: 213 PVDWRVGRVLDFDGVSLQ-GLRRADIAVREWVGLVAYRLRGR 253


>gi|255019747|ref|ZP_05291824.1| hypothetical protein ACA_2404 [Acidithiobacillus caldus ATCC 51756]
 gi|254970815|gb|EET28300.1| hypothetical protein ACA_2404 [Acidithiobacillus caldus ATCC 51756]
          Length = 267

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 79/185 (42%), Gaps = 16/185 (8%)

Query: 56  PLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC- 114
           PLL PQ       IV+LG G    P       +    + +R    MRL  + K       
Sbjct: 73  PLLHPQ--PGVGAIVVLGGGEVARPPG-----DGGDMANARTL--MRLEAAAKLAKQSAL 123

Query: 115 TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK 174
            I+ SGG P+     E+      L ES    + I +E +S +T  NA  SS ++      
Sbjct: 124 PIVTSGGAPRFGAPPEATTMARLLRESFAVHNPIWIEGRSFNTAANAFDSSKLLAQKGIH 183

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDY------LNAYYSIIPLSANFYLTELALK 228
            + LV+SA H+ R+  +F+  G++      DY       + Y S +P +     +  A+ 
Sbjct: 184 RVYLVTSALHMPRAMAWFRRAGLDPVPVPCDYRLDRGLTSGYESWLPRAIYLEASSEAIH 243

Query: 229 EYIGI 233
           EY+G+
Sbjct: 244 EYLGL 248


>gi|148544180|ref|YP_001271550.1| hypothetical protein Lreu_0951 [Lactobacillus reuteri DSM 20016]
 gi|184153552|ref|YP_001841893.1| hypothetical protein LAR_0897 [Lactobacillus reuteri JCM 1112]
 gi|227364609|ref|ZP_03848669.1| conserved hypothetical protein [Lactobacillus reuteri MM2-3]
 gi|325682276|ref|ZP_08161793.1| hypothetical protein HMPREF0536_10714 [Lactobacillus reuteri
           MM4-1A]
 gi|148531214|gb|ABQ83213.1| protein of unknown function DUF218 [Lactobacillus reuteri DSM
           20016]
 gi|183224896|dbj|BAG25413.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|227070353|gb|EEI08716.1| conserved hypothetical protein [Lactobacillus reuteri MM2-3]
 gi|324978115|gb|EGC15065.1| hypothetical protein HMPREF0536_10714 [Lactobacillus reuteri
           MM4-1A]
          Length = 271

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 56/99 (56%), Gaps = 4/99 (4%)

Query: 102 RLYKS--CKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQ 159
           RL K+  C +      II+SGG  QK   +E+ V    L+  G+    I  ETQ+L+T+Q
Sbjct: 128 RLDKAINCWKTHQSAKIIVSGGIVQKAKESEAEVMAAYLIAHGIPARKIICETQALNTWQ 187

Query: 160 NAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           N  F+  +IK  +   I++V+S +H+ R++ Y +  G+N
Sbjct: 188 NLTFARQLIKPQE--TIVVVTSDFHVLRARAYARKMGLN 224


>gi|300312046|ref|YP_003776138.1| hypothetical protein Hsero_2734 [Herbaspirillum seropedicae SmR1]
 gi|300074831|gb|ADJ64230.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 263

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 103/217 (47%), Gaps = 22/217 (10%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSF 91
           L + I    +  ++++ L+  Y  P+LS +  +    IV+L  G+         R +P +
Sbjct: 48  LLTLICMPAVADLMVRPLEQGY--PVLSAEAARQAQAIVVLAAGSLDQAPEYEGRDQPDY 105

Query: 92  QSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIK-- 149
            + +R+    RL     QH     +++SGG+ ++    E+   N  L  +   R+D +  
Sbjct: 106 VALARLRYAARL-----QHQTGLPVLVSGGNARE----ETPEQNKALAMAEALREDFRTP 156

Query: 150 ---LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
              +E  S +T +NA  S+++++    + ++LV+ A H+ R+ L F   G+   A+ + +
Sbjct: 157 VRWIEGGSENTEENALRSAALLRADGVQRVLLVTDAMHMPRAMLAFAQAGLVPTAAPTAF 216

Query: 207 LN----AYYSIIPLSANFYLTELALKEYIGILIAYYR 239
            +     + +++P +     +  A  E++G  + +YR
Sbjct: 217 FSLPRWRWPALLPSAEGLRRSWYASYEWLG--LGWYR 251


>gi|228941987|ref|ZP_04104530.1| hypothetical protein bthur0008_46210 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228974918|ref|ZP_04135479.1| hypothetical protein bthur0003_46680 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228981511|ref|ZP_04141808.1| hypothetical protein bthur0002_46720 [Bacillus thuringiensis Bt407]
 gi|228778190|gb|EEM26460.1| hypothetical protein bthur0002_46720 [Bacillus thuringiensis Bt407]
 gi|228784771|gb|EEM32789.1| hypothetical protein bthur0003_46680 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228817656|gb|EEM63738.1| hypothetical protein bthur0008_46210 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 345

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 109/242 (45%), Gaps = 39/242 (16%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           ML   +  I++   L+   +  IF     +  + FI    +   L  +  + + RP    
Sbjct: 108 MLFFMLLPIINPASLVSSHLEPIFAAISLISFYFFIH---LSNFLSAYFLYQFNRP---- 160

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC--TI 116
             +++ + I++LG+G     +P + A RI  +   Y             KQ +++   TI
Sbjct: 161 --RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY------------WKQAAVNTPPTI 206

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK 174
           I SGG     GL E+    +  +E G+  +    E +S++T+QN  FS  ++ ++  +GK
Sbjct: 207 IFSGGQGPDEGLPEAEAMQSYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGK 266

Query: 175 -NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I
Sbjct: 267 YKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAI 315

Query: 234 LI 235
           ++
Sbjct: 316 VV 317


>gi|188582432|ref|YP_001925877.1| hypothetical protein Mpop_3190 [Methylobacterium populi BJ001]
 gi|179345930|gb|ACB81342.1| protein of unknown function DUF218 [Methylobacterium populi BJ001]
          Length = 278

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 70/132 (53%), Gaps = 8/132 (6%)

Query: 113 HCTIIISGGDP--QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
              ++ SGG    ++  ++E+ + +      GV R+ + LE QS +T +NA FS+ M++ 
Sbjct: 135 QARLVFSGGAGSLREDAVSEAEIVSRYADTLGVPRNRLILEQQSRNTHENAVFSARMVQP 194

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFY---LTEL-- 225
             G+  +LV+SA+H+ R+   F+  G +  A   DY   +       A+F    L EL  
Sbjct: 195 KPGERWLLVTSAWHMPRAVGCFRRAGFDVTAYPVDYRTNWPRDATRFASFASDGLGELDI 254

Query: 226 ALKEYIGILIAY 237
            +KE+IG LIAY
Sbjct: 255 GVKEWIG-LIAY 265


>gi|168217115|ref|ZP_02642740.1| conserved hypothetical protein [Clostridium perfringens NCTC 8239]
 gi|182624176|ref|ZP_02951962.1| conserved hypothetical protein [Clostridium perfringens D str.
           JGS1721]
 gi|177910590|gb|EDT72958.1| conserved hypothetical protein [Clostridium perfringens D str.
           JGS1721]
 gi|182380858|gb|EDT78337.1| conserved hypothetical protein [Clostridium perfringens NCTC 8239]
          Length = 257

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 53/96 (55%), Gaps = 5/96 (5%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           ++   +  I++SGG      + E+      L+E+GV +D I LE ++  T++N  +S  +
Sbjct: 127 EKTGFNGEIVVSGGQGPGESITEAYAMEKYLVENGVPKDKIVLENKATSTYENLNYSKKI 186

Query: 168 IKNMQGK-----NIILVSSAYHLKRSQLYFQHFGIN 198
           I+N+ GK     +I++V++ +H  RS L  +  G N
Sbjct: 187 IENLSGKPIKDLDILVVTTDFHAMRSNLLAKRNGYN 222


>gi|169343962|ref|ZP_02864953.1| conserved hypothetical protein [Clostridium perfringens C str.
           JGS1495]
 gi|169297870|gb|EDS79965.1| conserved hypothetical protein [Clostridium perfringens C str.
           JGS1495]
          Length = 262

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 50/88 (56%), Gaps = 5/88 (5%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK- 174
           I++SGG      + E+      L+E+GV +D I LE ++  T++N  +S  +I+N+ GK 
Sbjct: 135 IVVSGGQGPGESITEAYAMEKYLVENGVPKDKIVLENKATSTYENLNYSKKIIENLSGKP 194

Query: 175 ----NIILVSSAYHLKRSQLYFQHFGIN 198
               +I++V++ +H  RS L  +  G N
Sbjct: 195 IKDLDILVVTTDFHAMRSNLLAKRNGYN 222


>gi|218906031|ref|YP_002453865.1| hypothetical protein BCAH820_4919 [Bacillus cereus AH820]
 gi|218540175|gb|ACK92573.1| conserved domain protein [Bacillus cereus AH820]
          Length = 344

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 88/194 (45%), Gaps = 28/194 (14%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY 104
           L  +  + + RP      +++ + I++LG+G       P +         SRI + +  Y
Sbjct: 148 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLA--------SRIHKAIDFY 193

Query: 105 KSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS 164
                 +   TII SGG     GL E+       +E G+  +    E +S++T+QN  FS
Sbjct: 194 WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMLFS 253

Query: 165 SSMIKNMQ--GK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFY 221
             ++ +++  GK   I  ++ +HL R+ +Y +  G+N++   S            +A +Y
Sbjct: 254 KEIMDSLKPDGKYKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYY 302

Query: 222 LTELALKEYIGILI 235
                ++EY+ I++
Sbjct: 303 WPNAMIREYVAIVV 316


>gi|301056307|ref|YP_003794518.1| hypothetical protein BACI_c47980 [Bacillus anthracis CI]
 gi|300378476|gb|ADK07380.1| conserved hypothetical protein [Bacillus cereus biovar anthracis
           str. CI]
          Length = 345

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 90/196 (45%), Gaps = 32/196 (16%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A          SRI + + 
Sbjct: 149 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLA----------SRIHKAID 192

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
            Y      +   TII SGG     GL E+       +E G+  +    E +S++T+QN  
Sbjct: 193 FYWKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNML 252

Query: 163 FSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSAN 219
           FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +A 
Sbjct: 253 FSKEIMDSLKPEGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAF 301

Query: 220 FYLTELALKEYIGILI 235
           +Y     ++EY+ I++
Sbjct: 302 YYWPNAMIREYVAIVV 317


>gi|282900121|ref|ZP_06308078.1| protein of unknown function DUF218 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195003|gb|EFA69943.1| protein of unknown function DUF218 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 263

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 20/165 (12%)

Query: 92  QSYSRIFETMRLYKSCKQHSMHCTIIISGG--DPQKHGLAESIVYNNKLLESGVERDDIK 149
           +S  R+    +LY   K       II+SGG  D +  G  ES      L+  G+  + I 
Sbjct: 101 ESGDRVIYAAQLYGQKKAP----LIILSGGRIDWRGGGTPESADMATILISLGIPPEVII 156

Query: 150 LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL-- 207
            E  SL+T++NA     ++++   K ++LV+SA H  RS   FQ  G+    + +D++  
Sbjct: 157 EEPNSLNTYENAVNVKKILESRGIKKVLLVTSAMHTPRSLKIFQRQGVEVIPAPTDFIVS 216

Query: 208 ------------NAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
                       +   ++ P + N      ALKEYIG L+   RG
Sbjct: 217 RSDLEELIATPKSTILNLFPSADNLNDFTNALKEYIGYLVYALRG 261


>gi|228988059|ref|ZP_04148160.1| hypothetical protein bthur0001_47210 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228771693|gb|EEM20158.1| hypothetical protein bthur0001_47210 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 344

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 92/198 (46%), Gaps = 36/198 (18%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A RI  +   Y        
Sbjct: 148 LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLASRINKAIDFY-------- 193

Query: 103 LYKSCKQHSMHC--TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQN 160
                KQ +++   TII SGG     GL E+       +E G+  +    E +S++T+QN
Sbjct: 194 ----WKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQN 249

Query: 161 AQFSSSMIKNMQ--GK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
             FS  ++ +++  GK   I  ++ +HL R+ +Y +  G+N++   S            +
Sbjct: 250 MSFSKDIMDSLKPDGKYRSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------T 298

Query: 218 ANFYLTELALKEYIGILI 235
           A +Y     ++EY+ I++
Sbjct: 299 AFYYWPNAMIREYVAIVV 316


>gi|326942590|gb|AEA18486.1| hypothetical protein CT43_CH4827 [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 234

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 91/196 (46%), Gaps = 32/196 (16%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMR 102
           L  +  + + RP      +++ + I++LG+G     +P + A          SRI + + 
Sbjct: 38  LSAYFLYQFNRP------RRNQDFIIVLGSGLINDKVPPLLA----------SRINKAID 81

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
            Y      +   TII SGG     GL E+    +  +E G+  +    E +S++T+QN  
Sbjct: 82  FYWKQAAVNTPPTIIFSGGQGPDEGLPEAEAMQSYAVEKGIPLEHTVQENRSVNTYQNML 141

Query: 163 FSSSMIKNM--QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSAN 219
           FS  ++ ++  +GK   I  ++ +HL R+ +Y +  G+N++   S            +A 
Sbjct: 142 FSKEIMDSLKPEGKYKSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAF 190

Query: 220 FYLTELALKEYIGILI 235
           +Y     ++EY+ I++
Sbjct: 191 YYWPNAMIREYVAIVV 206


>gi|269963112|ref|ZP_06177447.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832076|gb|EEZ86200.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 268

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 109/232 (46%), Gaps = 35/232 (15%)

Query: 27  SCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            CF++LFSF+G     +  + T LL  L+  Y+  L        G +  +++LG G  + 
Sbjct: 38  GCFVVLFSFVGIFLVAFQPVSTKLLMPLEREYKAFL-----PVSGTVDYVMVLGAGHVVD 92

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISG--GDPQKHGLAESIVYN 135
             IP     P+ Q  SR    MRL +  +   M+    +I+SG  G  +   ++ + +  
Sbjct: 93  DEIP-----PTSQ-LSRT-ALMRLTEGIRILRMYPGAKLILSGYAGGSE---ISHARMMA 142

Query: 136 NKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHF 195
           N  L  GV + DI L   + DT++ A+ +++ +K    K+I+LV+SA H+KR+   F   
Sbjct: 143 NVALSLGVAKSDIILLEDAKDTWEEARQAAAFVKQ---KDIVLVTSASHMKRALYEFNAA 199

Query: 196 GINTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
           GI    + ++++        +    P +     TEL   EY+G L    R N
Sbjct: 200 GIKPIPAPTNFMAIDDIEQPWQKYAPKARYLEQTELYWHEYLGGLWQKLRDN 251


>gi|169828730|ref|YP_001698888.1| hypothetical protein Bsph_3253 [Lysinibacillus sphaericus C3-41]
 gi|168993218|gb|ACA40758.1| conserved hypothetical protein [Lysinibacillus sphaericus C3-41]
          Length = 289

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 82/181 (45%), Gaps = 28/181 (15%)

Query: 60  PQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTII 117
           P++ +D   I++LG+G     +P + A          SRI + +  Y      S   TII
Sbjct: 104 PKYNQD--FIIVLGSGLINDKVPPLLA----------SRIQKAIDFYHKQATVSTPPTII 151

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM---IKNMQGK 174
            SGG      L E+       +E G+  +    E +S++T+QN  FS  +   IK  +  
Sbjct: 152 FSGGQGSDENLPEAEAMQRYAIEKGIPIEHTLQENRSVNTYQNMLFSKQIMDDIKQGEAY 211

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           N I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I+
Sbjct: 212 NSIFTTNNFHLFRAGIYARLAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIV 260

Query: 235 I 235
           +
Sbjct: 261 V 261


>gi|306844040|ref|ZP_07476635.1| Hypothetical protein BIBO1_0705 [Brucella sp. BO1]
 gi|306275795|gb|EFM57519.1| Hypothetical protein BIBO1_0705 [Brucella sp. BO1]
          Length = 264

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 72/156 (46%), Gaps = 11/156 (7%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKL 150
           +  RI ETMRL +          II+SGG+    +    E+      L + G   D    
Sbjct: 105 AADRIVETMRLARLYPD----AKIIVSGGEGTFFEKSAREAETTRALLSDLGFSGDRYIF 160

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E +S +T +NA FS ++ +   G+  +LV+SAYH+ R+   F+  G +  A   DY    
Sbjct: 161 EGKSRNTVENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVTAWPVDYKTRT 220

Query: 211 YSIIPL---SANFYLTE--LALKEYIGILIAYYRGN 241
                L   S N  L+   +AL+E+ G+   ++ G 
Sbjct: 221 RETFGLYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|270157480|ref|ZP_06186137.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|289164131|ref|YP_003454269.1| hypothetical protein LLO_0787 [Legionella longbeachae NSW150]
 gi|269989505|gb|EEZ95759.1| conserved hypothetical protein [Legionella longbeachae D-4968]
 gi|288857304|emb|CBJ11131.1| hypothetical protein LLO_0787 [Legionella longbeachae NSW150]
          Length = 197

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 68/144 (47%), Gaps = 19/144 (13%)

Query: 63  KKDGNIIVLLG----NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
           KK  ++I++LG    +G    P + A           R+   + LYK+    +    ++ 
Sbjct: 35  KKHADVIIVLGTKSYHGDKYNPCLVA-----------RVQHAVDLYKA----NYAPKLLF 79

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
           SGG   K+G +E+ V     L  GV   DI LE+ S  T++N  FS  ++   +  +I+L
Sbjct: 80  SGGKDTKNGPSEAQVMKEIALHLGVSEQDILLESASASTYENLLFSEKIVSAKKFNSILL 139

Query: 179 VSSAYHLKRSQLYFQHFGINTKAS 202
           V+  +HL R+ L  Q  G+    S
Sbjct: 140 VTEPFHLPRAILVAQKLGLKVSGS 163


>gi|319939407|ref|ZP_08013767.1| GdmH protein [Streptococcus anginosus 1_2_62CV]
 gi|319811393|gb|EFW07688.1| GdmH protein [Streptococcus anginosus 1_2_62CV]
          Length = 332

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 87/180 (48%), Gaps = 28/180 (15%)

Query: 64  KDGNIIVLLGNGTT--IIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
           K  + I++LG+G     +P + A R+E     Y             K H+ H  I++SGG
Sbjct: 159 KHPDYIIILGSGLIGDKVPPLLAQRLEKGKTMYE------------KFHN-HPKIVVSGG 205

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN--IILV 179
                 + E+      L +  + ++DI +E QS +T +N QFS +++     +N   ++V
Sbjct: 206 QGVDEPITEAEAMAQYLRQVCIPQEDIIIEQQSTNTLENLQFSKTILDQKSKENYYCLVV 265

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           ++++H  R+ +Y +  GI  ++  S            +A ++L    ++E IG+++ Y++
Sbjct: 266 TNSFHSLRAGIYMRKLGIKGRSIGSR-----------TALYFLPSAWIRETIGLIVLYWK 314


>gi|293559773|ref|ZP_06676293.1| integral membrane protein [Enterococcus faecium E1162]
 gi|314950188|ref|ZP_07853473.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0082]
 gi|291606256|gb|EFF35670.1| integral membrane protein [Enterococcus faecium E1162]
 gi|313643498|gb|EFS08078.1| integral membrane protein with DUF218 domain protein [Enterococcus
           faecium TX0082]
          Length = 399

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 177 LPQWINALFFCIPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 227

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y +  + +++  I++ SGG      + E
Sbjct: 228 LINGETVSPLLA-----------KRINKAIAFYWAQSRATLNPPILLMSGGQGADEKVPE 276

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           ++      +E G+   DI +ET S  T +N ++S   M + M+G    I  S+ YH+ R+
Sbjct: 277 AMAMKQYAMEQGIPERDILVETNSTTTLENMRYSKEIMDQQMKGPYRAIFSSNNYHIFRA 336

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 337 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 372


>gi|322385255|ref|ZP_08058902.1| hypothetical protein HMPREF9422_0267 [Streptococcus cristatus ATCC
           51100]
 gi|321270879|gb|EFX53792.1| hypothetical protein HMPREF9422_0267 [Streptococcus cristatus ATCC
           51100]
          Length = 337

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 84/181 (46%), Gaps = 28/181 (15%)

Query: 63  KKDGNIIVLLGNGT--TIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           KK+   I++LG G     +P + A R++     Y             ++ +    II+SG
Sbjct: 157 KKEPQTIIILGAGLFGDKVPPLLAQRLDKGIAIY-------------EKFNRKPVIIVSG 203

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI--KNMQGKNIIL 178
           G      ++E+      L+E GV  D I LE +S  T +N  FS  ++  + ++   ++L
Sbjct: 204 GQGDDEWISEAEAMAGYLMEKGVPADSIFLENKSRTTLENLIFSKELMLSQGLEQDRVLL 263

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYY 238
           V++++H  R+ +Y +  G+  ++  S            +A ++L    ++E  G++  Y+
Sbjct: 264 VTNSFHALRAGIYMRQVGLKGRSIGSR-----------TAFYFLPSAWIRETAGLIRIYW 312

Query: 239 R 239
           +
Sbjct: 313 K 313


>gi|315640651|ref|ZP_07895756.1| integral membrane protein [Enterococcus italicus DSM 15952]
 gi|315483590|gb|EFU74081.1| integral membrane protein [Enterococcus italicus DSM 15952]
          Length = 399

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 82/184 (44%), Gaps = 25/184 (13%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH-CTIII 118
           P++ +D   +++LG G      I   R+ P      RI   +  Y + +  S H   +I+
Sbjct: 214 PKYNQD--FLIVLGAGL-----INGERVTPLLAK--RIDRAILFYHTQRTKSGHPLKLIM 264

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN--MQGKNI 176
           SGG      + E++       E GV   D+ LE  S  T++N +FS  +I+   +     
Sbjct: 265 SGGQGADEKVPEAVAMKQYACEQGVPESDVLLEANSSTTYENMRFSKELIEQSAVNDPKA 324

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKA-SCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           I VS+ YH+ R+ ++ +   ++ +   C             +A +YL    L+E+  IL+
Sbjct: 325 IFVSNNYHIFRAGIFARQAKLSAEGIGCK------------TALYYLPNATLREFAAILV 372

Query: 236 AYYR 239
            + R
Sbjct: 373 MHKR 376


>gi|167039302|ref|YP_001662287.1| hypothetical protein Teth514_0643 [Thermoanaerobacter sp. X514]
 gi|256752180|ref|ZP_05493045.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300913942|ref|ZP_07131259.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X561]
 gi|307725373|ref|YP_003905124.1| hypothetical protein Thet_2282 [Thermoanaerobacter sp. X513]
 gi|166853542|gb|ABY91951.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X514]
 gi|256748908|gb|EEU61947.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300890627|gb|EFK85772.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X561]
 gi|307582434|gb|ADN55833.1| protein of unknown function DUF218 [Thermoanaerobacter sp. X513]
          Length = 192

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 85/179 (47%), Gaps = 26/179 (14%)

Query: 31  LLFSFIGW------GIIPTILLKHLQFS-YQRPLLSPQWKKDGNIIVLLGNGTTIIPTIP 83
           LL  FIG        ++ T+  + + F+ Y++P      KK   IIVL   G  +    P
Sbjct: 3   LLLRFIGVLIVIFVTVVITLEYQIISFALYEKP------KKSDVIIVL---GCAVYGKTP 53

Query: 84  AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
           +    P F+   R+ E +RLYK          II+SGG      ++E+      LL++G+
Sbjct: 54  S----PFFKE--RLDEALRLYK----EGYGKYIIVSGGKGPGENISEAEAGKEYLLKNGI 103

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
               I  + +SL T++N  FS  ++     K  I++S+ +HLKR+ +  +  GI+   S
Sbjct: 104 PEKIILTDNKSLSTYENLFFSKEIMDKNSLKTAIIISNKFHLKRASVIAKRIGIDASYS 162


>gi|289549962|ref|YP_003470866.1| hypothetical protein SLGD_00591 [Staphylococcus lugdunensis
           HKU09-01]
 gi|289179494|gb|ADC86739.1| hypothetical protein SLGD_00591 [Staphylococcus lugdunensis
           HKU09-01]
          Length = 334

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 87/190 (45%), Gaps = 29/190 (15%)

Query: 40  IIPTILLKHLQFSYQRPLLSPQW-----------KKDGNIIVLLGNGTTIIPTIPAIRIE 88
           I  T L   L F+Y   L+   W            K  +I ++LG+G       P +   
Sbjct: 122 IFVTYLFTTLIFTYFFGLILSCWLLAIFYSTLNSNKSIDIFLVLGSGLINNKVTPLLA-- 179

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
                 SRI   + +Y+  KQ++     ++SGG        ES+     L++ G+  D+I
Sbjct: 180 ------SRINAGLEIYQ--KQNNKQHLFLVSGGQGDDELRPESVAMKEYLVDKGIVEDEI 231

Query: 149 KLETQSLDTFQNAQFSSSMIKN--MQGKNIILVSSAYHLKRS-----QLYFQHF-GINTK 200
             E QS  T++N  FS  MI+N  +   NI++ ++ +H+ R+     +L+F++F  + +K
Sbjct: 232 ICEQQSKTTYENLYFSKKMIENLPLNKPNILICTNDFHILRAMFLAKKLHFKNFYSVGSK 291

Query: 201 ASCSDYLNAY 210
                + NA+
Sbjct: 292 TKSYFFTNAF 301


>gi|260558934|ref|ZP_05831121.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|260075042|gb|EEW63357.1| conserved hypothetical protein [Enterococcus faecium C68]
          Length = 350

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 128 LPQWINALFFCIPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 178

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y +  + +++  I++ SGG      + E
Sbjct: 179 LINGETVSPLLA-----------KRINKAIAFYWAQSRATLNPPILLMSGGQGADEKVPE 227

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           ++      +E G+   DI +ET S  T +N ++S   M + M+G    I  S+ YH+ R+
Sbjct: 228 AMAMKQYAMEQGIPERDILVETNSTTTLENMRYSKEIMDQQMKGPYRAIFSSNNYHIFRA 287

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 288 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 323


>gi|18310223|ref|NP_562157.1| hypothetical protein CPE1241 [Clostridium perfringens str. 13]
 gi|18144902|dbj|BAB80947.1| conserved hypothetical protein [Clostridium perfringens str. 13]
          Length = 257

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 53/96 (55%), Gaps = 5/96 (5%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           ++   +  I++SGG      + E+      L+E+GV +D I LE ++  T++N  +S  +
Sbjct: 127 EKTGFNGEIVVSGGQGPGESITEAYAMEKYLVENGVPKDKIVLENKATSTYENLNYSKKI 186

Query: 168 IKNMQGK-----NIILVSSAYHLKRSQLYFQHFGIN 198
           I+N+ GK     +I+++++ +H  RS L  +  G N
Sbjct: 187 IENLSGKPIKDLDILVITTDFHAMRSNLLAKRNGYN 222


>gi|257898082|ref|ZP_05677735.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|257835994|gb|EEV61068.1| conserved hypothetical protein [Enterococcus faecium Com15]
          Length = 368

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 146 LPQWINALFFCIPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 196

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y +  + +++  I++ SGG      + E
Sbjct: 197 LINGETVSPLLA-----------KRINKAIAFYWAQSRATLNPPILLMSGGQGADEKVPE 245

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           ++      +E G+   DI +ET S  T +N ++S   M + M+G    I  S+ YH+ R+
Sbjct: 246 AMAMKQYAMEQGIPERDILVETNSTTTLENMRYSKEIMDQQMKGPYRAIFSSNNYHIFRA 305

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 306 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 341


>gi|257890483|ref|ZP_05670136.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257826843|gb|EEV53469.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
          Length = 368

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 99/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 146 LPQWINALFFCIPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 196

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y +  + +++  I++ SGG      + E
Sbjct: 197 LINGETVSPLLA-----------KRINKAIAFYWAQSRATLNPPILLMSGGQGADEKVPE 245

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           ++      +E G+   DI +ET S  T +N ++S   M + M+G    I  S+ YH+ R+
Sbjct: 246 AMAMKQYAMEQGIPERDILVETNSTTTLENMRYSKEIMDQQMKGPYRAIFSSNNYHIFRA 305

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 306 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 341


>gi|118474006|ref|YP_889974.1| hypothetical protein MSMEG_5741 [Mycobacterium smegmatis str. MC2
           155]
 gi|118175293|gb|ABK76189.1| conserved hypothetical protein [Mycobacterium smegmatis str. MC2
           155]
          Length = 211

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
              +I++GG+PQ+ G+ E+    N LL  G   + I +E ++  T QNAQFS  + K   
Sbjct: 96  QSPVIVTGGNPQR-GVTEAAAMRNLLLMLGFPANRIIVEDRANSTVQNAQFSVPLAKKAG 154

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
              IILV+S+ H  R+   F   G N  A+ S
Sbjct: 155 TTGIILVTSSSHQGRADQNFADAGGNILATVS 186


>gi|34496963|ref|NP_901178.1| transmembrane protein [Chromobacterium violaceum ATCC 12472]
 gi|34102819|gb|AAQ59183.1| probable transmembrane protein [Chromobacterium violaceum ATCC
           12472]
          Length = 254

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 86/208 (41%), Gaps = 25/208 (12%)

Query: 41  IPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET 100
           IP   +   Q   + P + P      + IV+LG G    P        PS  + +R+   
Sbjct: 58  IPQTAIWLAQGVERYPPIRPADLAAADAIVVLGGGKRPAPEFGGN--APSSDTLARLRYA 115

Query: 101 MRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL-----ETQSL 155
             L +   +      ++++GG P   G  E  V  + L       DD  +     E +S 
Sbjct: 116 AYLARQSGK-----PVLVTGGSPLG-GEPEGKVMASAL------HDDYGIRARWVEDRSD 163

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN----AYY 211
            T  NA+ S+ M+K      I LVS  +HL R+  +FQ  G+    + + ++     A+ 
Sbjct: 164 TTLDNARLSAEMLKAAGATRIALVSQGWHLGRAVPFFQSQGLQVSPAPTGFVRYEGPAFT 223

Query: 212 SIIPLSANFYLTELALKEYIGILIAYYR 239
             +P         + L+EYIG+L  YYR
Sbjct: 224 RYLPSGKAMGDCHVLLREYIGLL--YYR 249


>gi|304392434|ref|ZP_07374375.1| periplasmic protein [Ahrensia sp. R2A130]
 gi|303295538|gb|EFL89897.1| periplasmic protein [Ahrensia sp. R2A130]
          Length = 189

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 69/133 (51%), Gaps = 14/133 (10%)

Query: 109 QHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI 168
           Q  +   +++SGG   +H   E+       +  GV +  + LE +S +TF+N  FS++++
Sbjct: 38  QQGLAPILVLSGGL-GRHPPTEAKAMAEICMGEGVPQAALLLEGRSTNTFENVAFSAALL 96

Query: 169 KNMQGKNIILVSSAYHLKRSQLYFQHFG--INTKASCSDYLNAYYSIIPLSANFYLTELA 226
           +  +  ++++VS AYHL R+++ F++ G      A+ +     +Y     +A ++L E+ 
Sbjct: 97  REKRVNSVLVVSDAYHLPRAKMCFRYLGFIATGSAAVAGPTTPWYR----TARYWLREI- 151

Query: 227 LKEYIGILIAYYR 239
                 + I YYR
Sbjct: 152 ------VAIPYYR 158


>gi|282896704|ref|ZP_06304712.1| hypothetical protein CRD_01413 [Raphidiopsis brookii D9]
 gi|281198422|gb|EFA73310.1| hypothetical protein CRD_01413 [Raphidiopsis brookii D9]
          Length = 263

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 101/230 (43%), Gaps = 28/230 (12%)

Query: 27  SCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIR 86
           S  +L+ +  GW      + K L  S +   + P    +   IV+LG G T     P   
Sbjct: 44  SLAILMIAGNGW------VSKALVGSLEWQNIPPGKIPEAEAIVVLG-GATKPAAWPRST 96

Query: 87  IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG--DPQKHGLAESIVYNNKLLESGVE 144
           ++ + +S  R+    +LY   K       II+SGG  D +  G  ES      L+  G+ 
Sbjct: 97  VDLN-ESGDRVIYAAQLYGQKKAP----LIILSGGRIDWRGSGPPESADMAAILISLGIP 151

Query: 145 RDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
            + I  E  SL+T++NA     ++++   K ++LV+SA H  RS   FQ  G+    + +
Sbjct: 152 PEVIIEEPNSLNTYENAVNVRKILESRGIKKVLLVTSAMHTPRSLKIFQRQGVEVIPAPT 211

Query: 205 DYL--------------NAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           D++              +   ++ P + N      ALKEYIG L+   RG
Sbjct: 212 DFIVSRSDLEELIATPKSTILNLFPSADNLNDFTNALKEYIGYLVYALRG 261


>gi|23502055|ref|NP_698182.1| hypothetical protein BR1177 [Brucella suis 1330]
 gi|62290089|ref|YP_221882.1| hypothetical protein BruAb1_1183 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700013|ref|YP_414587.1| hypothetical protein BAB1_1199 [Brucella melitensis biovar Abortus
           2308]
 gi|225627645|ref|ZP_03785682.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237815595|ref|ZP_04594592.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|256369602|ref|YP_003107112.1| hypothetical protein BMI_I1188 [Brucella microti CCM 4915]
 gi|297248487|ref|ZP_06932205.1| hypothetical protein BAYG_01444 [Brucella abortus bv. 5 str. B3196]
 gi|23348011|gb|AAN30097.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196221|gb|AAX74521.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616114|emb|CAJ11155.1| Protein of unknown function DUF218 [Brucella melitensis biovar
           Abortus 2308]
 gi|225617650|gb|EEH14695.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237788893|gb|EEP63104.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|255999764|gb|ACU48163.1| hypothetical protein BMI_I1188 [Brucella microti CCM 4915]
 gi|297175656|gb|EFH35003.1| hypothetical protein BAYG_01444 [Brucella abortus bv. 5 str. B3196]
          Length = 268

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 73/156 (46%), Gaps = 11/156 (7%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKL 150
           +  RI ETMRL +          I++SGG+    +    E+      LL+ G   +    
Sbjct: 109 AADRIVETMRLARLYPD----AKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIF 164

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E +S +T +NA FS ++ +   G+  +LV+SAYH+ R+   F+  G +  A   DY    
Sbjct: 165 EGKSRNTVENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVTAWPVDYKTRT 224

Query: 211 YSIIPL---SANFYLTE--LALKEYIGILIAYYRGN 241
                L   S N  L+   +AL+E+ G+   ++ G 
Sbjct: 225 RETFGLYLESPNDALSRFSMALREWTGLAAYWWTGR 260


>gi|256159910|ref|ZP_05457632.1| hypothetical protein BcetM4_13019 [Brucella ceti M490/95/1]
 gi|256255144|ref|ZP_05460680.1| hypothetical protein BcetB_12801 [Brucella ceti B1/94]
 gi|261222341|ref|ZP_05936622.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265998306|ref|ZP_06110863.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260920925|gb|EEX87578.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262552774|gb|EEZ08764.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 264

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 73/156 (46%), Gaps = 11/156 (7%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKL 150
           +  RI ETMRL +          I++SGG+    +    E+      LL+ G   +    
Sbjct: 105 AADRIVETMRLARLYPD----AKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIF 160

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E +S +T +NA FS ++ +   G+  +LV+SAYH+ R+   F+  G +  A   DY    
Sbjct: 161 EGKSRNTVENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVTAWPVDYKTRT 220

Query: 211 YSIIPL---SANFYLTE--LALKEYIGILIAYYRGN 241
                L   S N  L+   +AL+E+ G+   ++ G 
Sbjct: 221 RETFGLYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|161619130|ref|YP_001593017.1| hypothetical protein BCAN_A1197 [Brucella canis ATCC 23365]
 gi|260566292|ref|ZP_05836762.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161335941|gb|ABX62246.1| protein of unknown function DUF218 [Brucella canis ATCC 23365]
 gi|260155810|gb|EEW90890.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 264

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 73/156 (46%), Gaps = 11/156 (7%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKL 150
           +  RI ETMRL +          I++SGG+    +    E+      LL+ G   +    
Sbjct: 105 AADRIVETMRLARLYPD----AKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIF 160

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E +S +T +NA FS ++ +   G+  +LV+SAYH+ R+   F+  G +  A   DY    
Sbjct: 161 EGKSRNTVENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVTAWPVDYKTRT 220

Query: 211 YSIIPL---SANFYLTE--LALKEYIGILIAYYRGN 241
                L   S N  L+   +AL+E+ G+   ++ G 
Sbjct: 221 RETFGLYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|223982522|ref|ZP_03632760.1| hypothetical protein HOLDEFILI_00034 [Holdemania filiformis DSM
           12042]
 gi|223965497|gb|EEF69771.1| hypothetical protein HOLDEFILI_00034 [Holdemania filiformis DSM
           12042]
          Length = 246

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK-NM 171
            CT+I++GG       AES +  N L+E+G+E + I  E Q+ +T +N ++S  +++ N 
Sbjct: 127 ECTVIVTGGQGNGEDYAESTIMKNWLVENGLETNRILEENQARNTGENLKYSLKLLRQNN 186

Query: 172 QGKNIILVSSAYHLKRSQLYFQHFGI 197
             +N+++V+ ++H  R+ +  +  GI
Sbjct: 187 LSENVVIVTDSFHQLRASILAKQLGI 212


>gi|254430947|ref|ZP_05044650.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
 gi|197625400|gb|EDY37959.1| conserved hypothetical protein [Cyanobium sp. PCC 7001]
          Length = 265

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 88/201 (43%), Gaps = 24/201 (11%)

Query: 58  LSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTII 117
           L P      + +V+LG G  + P  P  R     ++  R+   +RL +  K      T++
Sbjct: 69  LEPASLPAADAVVVLGGG--LRPAQPPRRGVEVGEAGDRLLTGVRLLRQGKAP----TLV 122

Query: 118 ISGG----DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
            SGG       K    E+    +  +E G+  + I L  ++  T + A+   +M +    
Sbjct: 123 TSGGRVHFTAGKPPPPEAEWARDLAVELGIAPERILLAREARTTAEEARDLGAMGRTRGW 182

Query: 174 KNIILVSSAYHLKRSQLYFQHF-GINTKASCSDYL-------------NAYYSIIPLSAN 219
             ++LV+SA H+ R+   FQ   G+   A  +D+              +A  S+ P +  
Sbjct: 183 SRVLLVTSASHMPRALATFQRRSGLEVVAVPTDFQLPQRASYGAPTLGSALLSVAPDAEA 242

Query: 220 FYLTELALKEYIGILIAYYRG 240
            YL+ + LKE++G+L+   RG
Sbjct: 243 LYLSTVMLKEHLGLLVYRLRG 263


>gi|253582533|ref|ZP_04859755.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
 gi|251835678|gb|EES64217.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
          Length = 351

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 1/103 (0%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
           +  II++GG P K G+ E+ +    L+E GV    + +E Q+ DT  NA +S  ++K + 
Sbjct: 216 NAEIIVTGGVP-KGGVTEAYLMKKWLVEKGVNPSKVHIEDQAKDTVGNALYSVEIMKKLG 274

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIP 215
            +N+ L+SSA H++R    F+   ++   + S   N  Y   P
Sbjct: 275 TENMTLISSASHMRRGLAVFKEMAVSEGLNLSVMDNLVYLDYP 317


>gi|170017164|ref|YP_001728083.1| integral membrane protein [Leuconostoc citreum KM20]
 gi|169804021|gb|ACA82639.1| Integral membrane protein [Leuconostoc citreum KM20]
          Length = 353

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 95/199 (47%), Gaps = 25/199 (12%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLG--NGTTIIPTIPAIRIEPSFQSYSRIFETMR 102
           +L  L   +   ++ P++ K+  I++  G  NG T+ P + + RI  + +     F+  +
Sbjct: 157 VLAFLASYFLTKIVKPKYNKEYAIVLGSGLINGDTVSPLLGS-RILVAAK-----FKAKQ 210

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
           L KS K+      +I+SGG      L ES+      +++GV   DI ++ QS +T+QN  
Sbjct: 211 LAKSKKK----MILIMSGGQGSDEKLPESVAMKAYAIKNGVPESDILVDDQSKNTYQNML 266

Query: 163 FSSSMI--KNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANF 220
           FS  +I    +  +  I  ++ YH+ R+  + +  G+N     S            ++ +
Sbjct: 267 FSKQVIIDNGLDLQKGIFTTNDYHVFRAAGFARLVGLNIDGIGSK-----------TSKY 315

Query: 221 YLTELALKEYIGILIAYYR 239
           +L    ++EYI IL+ + +
Sbjct: 316 FLPNALIREYIAILVKHKK 334


>gi|256061258|ref|ZP_05451408.1| hypothetical protein Bneo5_12948 [Brucella neotomae 5K33]
 gi|261325265|ref|ZP_05964462.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301245|gb|EEY04742.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 264

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 73/156 (46%), Gaps = 11/156 (7%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKL 150
           +  RI ETMRL +          I++SGG+    +    E+      LL+ G   +    
Sbjct: 105 AADRIVETMRLARLYPD----AKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIF 160

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E +S +T +NA FS ++ +   G+  +LV+SAYH+ R+   F+  G +  A   DY    
Sbjct: 161 EGKSRNTVENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVTAWPVDYKTRT 220

Query: 211 YSIIPL---SANFYLTE--LALKEYIGILIAYYRGN 241
                L   S N  L+   +AL+E+ G+   ++ G 
Sbjct: 221 RETFGLYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|110801440|ref|YP_698578.1| hypothetical protein CPR_1256 [Clostridium perfringens SM101]
 gi|110681941|gb|ABG85311.1| conserved hypothetical protein [Clostridium perfringens SM101]
          Length = 257

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 52/94 (55%), Gaps = 5/94 (5%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           ++   +  II+SGG      + E+      L+E+GV +D I LE ++  T++N  +S  +
Sbjct: 127 EKTGFNGEIIVSGGQGPGESITEAYAMEKYLVENGVPKDKIVLENKATSTYENLNYSKKI 186

Query: 168 IKNMQGK-----NIILVSSAYHLKRSQLYFQHFG 196
           I+N+ GK     +I++V++ +H  RS L  +  G
Sbjct: 187 IENLSGKPIKDLDILVVTTDFHAMRSNLLAKRNG 220


>gi|294852515|ref|ZP_06793188.1| hypothetical protein BAZG_01442 [Brucella sp. NVSL 07-0026]
 gi|294821104|gb|EFG38103.1| hypothetical protein BAZG_01442 [Brucella sp. NVSL 07-0026]
          Length = 264

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 73/156 (46%), Gaps = 11/156 (7%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKL 150
           +  RI ETMRL +          I++SGG+    +    E+      LL+ G   +    
Sbjct: 105 AADRIVETMRLARLYPD----AKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIF 160

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E +S +T +NA FS ++ +   G+  +LV+SAYH+ R+   F+  G +  A   DY    
Sbjct: 161 EGKSRNTVENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVTAWPVDYKTRT 220

Query: 211 YSIIPL---SANFYLTE--LALKEYIGILIAYYRGN 241
                L   S N  L+   +AL+E+ G+   ++ G 
Sbjct: 221 RETFGLYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|17987093|ref|NP_539727.1| hypothetical protein BMEI0810 [Brucella melitensis bv. 1 str. 16M]
 gi|163843442|ref|YP_001627846.1| hypothetical protein BSUIS_A1225 [Brucella suis ATCC 23445]
 gi|189024327|ref|YP_001935095.1| hypothetical protein BAbS19_I11160 [Brucella abortus S19]
 gi|225852674|ref|YP_002732907.1| hypothetical protein BMEA_A1222 [Brucella melitensis ATCC 23457]
 gi|254689399|ref|ZP_05152653.1| hypothetical protein Babob68_04337 [Brucella abortus bv. 6 str.
           870]
 gi|254693883|ref|ZP_05155711.1| hypothetical protein Babob3T_04332 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697533|ref|ZP_05159361.1| hypothetical protein Babob28_07456 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701918|ref|ZP_05163746.1| hypothetical protein Bsuib55_13827 [Brucella suis bv. 5 str. 513]
 gi|254704463|ref|ZP_05166291.1| hypothetical protein Bsuib36_11145 [Brucella suis bv. 3 str. 686]
 gi|254710250|ref|ZP_05172061.1| hypothetical protein BpinB_08247 [Brucella pinnipedialis B2/94]
 gi|254714246|ref|ZP_05176057.1| hypothetical protein BcetM6_13021 [Brucella ceti M644/93/1]
 gi|254717682|ref|ZP_05179493.1| hypothetical protein BcetM_15020 [Brucella ceti M13/05/1]
 gi|254730428|ref|ZP_05189006.1| hypothetical protein Babob42_04352 [Brucella abortus bv. 4 str.
           292]
 gi|256031744|ref|ZP_05445358.1| hypothetical protein BpinM2_14019 [Brucella pinnipedialis
           M292/94/1]
 gi|256044830|ref|ZP_05447734.1| hypothetical protein Bmelb1R_10074 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113736|ref|ZP_05454540.1| hypothetical protein Bmelb3E_13258 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256257645|ref|ZP_05463181.1| hypothetical protein Babob9C_09914 [Brucella abortus bv. 9 str.
           C68]
 gi|256263835|ref|ZP_05466367.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260168877|ref|ZP_05755688.1| hypothetical protein BruF5_11021 [Brucella sp. F5/99]
 gi|260546638|ref|ZP_05822377.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565570|ref|ZP_05836054.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260754918|ref|ZP_05867266.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758135|ref|ZP_05870483.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761961|ref|ZP_05874304.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883930|ref|ZP_05895544.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214170|ref|ZP_05928451.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261219524|ref|ZP_05933805.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261317810|ref|ZP_05957007.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261322019|ref|ZP_05961216.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261752483|ref|ZP_05996192.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755142|ref|ZP_05998851.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758366|ref|ZP_06002075.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265988841|ref|ZP_06101398.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991256|ref|ZP_06103813.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995092|ref|ZP_06107649.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|17982753|gb|AAL51991.1| putative membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|163674165|gb|ABY38276.1| protein of unknown function DUF218 [Brucella suis ATCC 23445]
 gi|189019899|gb|ACD72621.1| Protein of unknown function DUF218 [Brucella abortus S19]
 gi|225641039|gb|ACO00953.1| protein of unknown function DUF218 [Brucella melitensis ATCC 23457]
 gi|260095688|gb|EEW79565.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151638|gb|EEW86732.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668453|gb|EEX55393.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672393|gb|EEX59214.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675026|gb|EEX61847.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873458|gb|EEX80527.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915777|gb|EEX82638.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260924613|gb|EEX91181.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294709|gb|EEX98205.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261297033|gb|EEY00530.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261738350|gb|EEY26346.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261742236|gb|EEY30162.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261744895|gb|EEY32821.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262766205|gb|EEZ11994.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002040|gb|EEZ14615.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093964|gb|EEZ17898.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661038|gb|EEZ31299.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|326409195|gb|ADZ66260.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538905|gb|ADZ87120.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 264

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 73/156 (46%), Gaps = 11/156 (7%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKL 150
           +  RI ETMRL +          I++SGG+    +    E+      LL+ G   +    
Sbjct: 105 AADRIVETMRLARLYPD----AKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIF 160

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E +S +T +NA FS ++ +   G+  +LV+SAYH+ R+   F+  G +  A   DY    
Sbjct: 161 EGKSRNTVENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVTAWPVDYKTRT 220

Query: 211 YSIIPL---SANFYLTE--LALKEYIGILIAYYRGN 241
                L   S N  L+   +AL+E+ G+   ++ G 
Sbjct: 221 RETFGLYLESPNDALSRFSMALREWTGLAAYWWTGR 256


>gi|325524355|gb|EGD02447.1| hypothetical protein B1M_21438 [Burkholderia sp. TJI49]
          Length = 97

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%)

Query: 150 LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA 209
           LE  S  T++NA+F++S++++      ILV+S+Y ++R+ L F  FGI+ +   ++  +A
Sbjct: 2   LEPDSRTTYENAKFTASILRSRHDDARILVTSSYQMRRALLDFHRFGIDPQPVYANRRDA 61

Query: 210 YYSIIPLSANFYLTELALKEYIGI 233
               +P   N    E AL E +GI
Sbjct: 62  QTGWLPRWRNIVNAEQALHELVGI 85


>gi|190889771|ref|YP_001976313.1| hypothetical protein RHECIAT_CH0000139 [Rhizobium etli CIAT 652]
 gi|190695050|gb|ACE89135.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 262

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 105/265 (39%), Gaps = 38/265 (14%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIP--------------------TIL 45
           +FLI     + CQ +   F +  F L+   + W ++                      +L
Sbjct: 1   MFLISKLVWIFCQPLSLAFLLVFFALIAGLLRWRVLSILGTGASALILFVTLYTTAGNLL 60

Query: 46  LKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS-RIFETMRLY 104
           ++ L+  + +P   P+     N+  ++  G      +   R    F   + R  E +RL 
Sbjct: 61  MQGLEQRFAKPAADPE-----NLQCMIVLGGAFENEVNTARHGIEFNGGADRFVEALRLA 115

Query: 105 KSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES--GVERDDIKLETQSLDTFQNAQ 162
           +   Q      I++SGGD    G+ E     ++      G+ RD +  ETQS  TF+NA 
Sbjct: 116 QKFPQSR----ILVSGGDGSMSGIYEGDAAASERFFPLFGIGRDRLIEETQSRTTFENAV 171

Query: 163 FSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-----LNAYYSIIPLS 217
            +   +      + +L++S +H+ RS   F+  GI+     +DY     +         +
Sbjct: 172 NTRDFLAGQGLSHCLLITSGFHMPRSVGIFRKLGIDIVPWPTDYRTDGQVRPGLDFTQPN 231

Query: 218 ANFYLTELALKEYIGILIAYYRGNR 242
            N      A++E+ G L+ YY   R
Sbjct: 232 LNAQNMATAIREWYG-LVGYYLAGR 255


>gi|116872406|ref|YP_849187.1| hypothetical protein lwe0988 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116741284|emb|CAK20406.1| putative membrane protein [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 344

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 87/190 (45%), Gaps = 34/190 (17%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQH-------SM 112
           P++ +D   +++LG+G      I   R+ P   S        RL ++ K H         
Sbjct: 159 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--------RLNRAIKFHEKQYLKKGK 203

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNM 171
             T I+SGG      ++E+      L+E G++ + I +E +S++T QN +FS   M   M
Sbjct: 204 RATFIVSGGQGANETISEAEAMRAYLIEKGIDENFIIMEDKSVNTLQNMKFSKEKMDAIM 263

Query: 172 QGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYI 231
              N +  ++ +HL R+ +Y +  G+ ++   +            +A +Y+    ++E+I
Sbjct: 264 PTYNSLFATNNFHLFRAGIYARKAGLKSQGIGAK-----------TALYYMPNALIREFI 312

Query: 232 GILIAYYRGN 241
            I + Y + +
Sbjct: 313 AITVMYKKAH 322


>gi|294616357|ref|ZP_06696150.1| integral membrane protein [Enterococcus faecium E1636]
 gi|291590871|gb|EFF22587.1| integral membrane protein [Enterococcus faecium E1636]
          Length = 399

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 98/227 (43%), Gaps = 38/227 (16%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG-- 73
           L Q I  +FF    +L++ FI       +    L  S+      P++ +D   IV+LG  
Sbjct: 177 LPQWINALFFCVPLILIYLFI-------VFYNFLTVSFLYQFNRPRYNQD--FIVVLGAG 227

Query: 74  --NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII-SGGDPQKHGLAE 130
             NG T+ P +             RI + +  Y++  + +++  I++ SGG      + E
Sbjct: 228 LINGETVSPLLA-----------KRINKAIAFYRAQSRATLNPPILLMSGGQGADEKVPE 276

Query: 131 SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGK-NIILVSSAYHLKRS 188
           +I      +  G+   DI +ET S  T +N  +S   M + M+G    I  S+ YH+ R+
Sbjct: 277 AIAMKQYAMGQGIPERDILVETNSTTTLENMLYSKEIMDQQMKGPYRAIFSSNNYHIFRA 336

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            LY +   +      +            +A +YL    L+EYI IL+
Sbjct: 337 GLYARQAKLKANGIGAK-----------TAFYYLPNAFLREYIAILM 372


>gi|189500837|ref|YP_001960307.1| hypothetical protein Cphamn1_1910 [Chlorobium phaeobacteroides BS1]
 gi|189496278|gb|ACE04826.1| protein of unknown function DUF218 [Chlorobium phaeobacteroides
           BS1]
          Length = 251

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 86/189 (45%), Gaps = 27/189 (14%)

Query: 64  KDGNIIVLLGNGTTIIPTI-------PAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTI 116
           + G+ +V+LG     +P++        A R E   + +      + ++   K   M  T 
Sbjct: 70  EQGDAVVVLGGVLWQVPSVRYGEWGEAADRFEGGVEVFRAGKAPLLIFMGAKMPWMPDT- 128

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI 176
                 P+   LAE      + +  GV  + +++  +  +T   A+    ++  ++   +
Sbjct: 129 -----RPEGEILAE------RAIRLGVPEEAVRVTERVGNTADEARAVKELLAGIERPEV 177

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYS------IIPLSANFYLTELALKEY 230
           ILV+SA+H+ R+ + F++ GI  +    D+  +YY+       +P +     +E+A+KE 
Sbjct: 178 ILVTSAFHMNRASMLFRNAGIEVQPFPVDFRTSYYNELTLIDFLPSADGVENSEIAMKEM 237

Query: 231 IGILIAYYR 239
           +G L  YY+
Sbjct: 238 LGTL--YYK 244


>gi|204929871|ref|ZP_03220892.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320865|gb|EDZ06066.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 258

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 104/224 (46%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGAKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+DI     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   +
Sbjct: 152 PRNDII----TLDKPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQHAGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|322616420|gb|EFY13329.1| hypothetical protein SEEM315_12463 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619670|gb|EFY16545.1| hypothetical protein SEEM971_17457 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622634|gb|EFY19479.1| hypothetical protein SEEM973_13500 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629783|gb|EFY26558.1| hypothetical protein SEEM974_05201 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632495|gb|EFY29241.1| hypothetical protein SEEM201_14830 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322637010|gb|EFY33713.1| hypothetical protein SEEM202_02105 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641450|gb|EFY38088.1| hypothetical protein SEEM954_01478 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646084|gb|EFY42600.1| hypothetical protein SEEM054_01055 [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649614|gb|EFY46045.1| hypothetical protein SEEM675_15999 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654084|gb|EFY50407.1| hypothetical protein SEEM965_12752 [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658616|gb|EFY54878.1| hypothetical protein SEEM19N_16617 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663473|gb|EFY59675.1| hypothetical protein SEEM801_11907 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322670209|gb|EFY66349.1| hypothetical protein SEEM507_18684 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671445|gb|EFY67567.1| hypothetical protein SEEM877_09693 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676801|gb|EFY72868.1| hypothetical protein SEEM867_07841 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682726|gb|EFY78745.1| hypothetical protein SEEM180_06892 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686405|gb|EFY82387.1| hypothetical protein SEEM600_05870 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195928|gb|EFZ81095.1| hypothetical protein SEEM581_13156 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199784|gb|EFZ84873.1| hypothetical protein SEEM501_09338 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202777|gb|EFZ87813.1| hypothetical protein SEEM460_08274 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209048|gb|EFZ93985.1| hypothetical protein SEEM020_20040 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211524|gb|EFZ96363.1| hypothetical protein SEEM6152_19328 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217991|gb|EGA02706.1| hypothetical protein SEEM0077_06149 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222903|gb|EGA07253.1| hypothetical protein SEEM0047_13265 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226597|gb|EGA10802.1| hypothetical protein SEEM0055_10125 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229793|gb|EGA13916.1| hypothetical protein SEEM0052_13182 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233018|gb|EGA17114.1| hypothetical protein SEEM3312_03134 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240753|gb|EGA24795.1| hypothetical protein SEEM5258_12744 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243069|gb|EGA27090.1| hypothetical protein SEEM1156_20594 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249768|gb|EGA33670.1| hypothetical protein SEEM9199_12237 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252759|gb|EGA36597.1| hypothetical protein SEEM8282_16778 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257198|gb|EGA40899.1| hypothetical protein SEEM8283_02209 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323259996|gb|EGA43624.1| hypothetical protein SEEM8284_18093 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323268003|gb|EGA51482.1| hypothetical protein SEEM8285_13226 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269851|gb|EGA53300.1| hypothetical protein SEEM8287_20649 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 258

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 104/224 (46%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGAKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+DI     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   +
Sbjct: 152 PRNDII----TLDKPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQHAGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|269120765|ref|YP_003308942.1| hypothetical protein Sterm_2157 [Sebaldella termitidis ATCC 33386]
 gi|268614643|gb|ACZ09011.1| protein of unknown function DUF218 [Sebaldella termitidis ATCC
           33386]
          Length = 243

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (52%), Gaps = 7/116 (6%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK--N 170
           H  + ++GG      + ES++     LE+G++ + I LE +S +T +N +F    +K  +
Sbjct: 123 HLNVFLTGGQGIDEKVPESVIMKEYFLENGIDENRIFLEDKSTNTNENIKFYIDALKDTD 182

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELA 226
           M+  NI+LV+S +H+ R+ +  +H+ +     CS   N   S IP   N    ELA
Sbjct: 183 MEYHNILLVTSDFHMPRAGVIARHYNLTVYPLCSKTRNI--SFIP---NIMREELA 233


>gi|296118003|ref|ZP_06836585.1| putative integral membrane protein with DUF218 domain protein
           [Corynebacterium ammoniagenes DSM 20306]
 gi|295968889|gb|EFG82132.1| putative integral membrane protein with DUF218 domain protein
           [Corynebacterium ammoniagenes DSM 20306]
          Length = 359

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 79/176 (44%), Gaps = 27/176 (15%)

Query: 61  QWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
           +++ +   +++LG+G     +P + A R++ S +               K+ S H  II 
Sbjct: 175 RYRTEPEAVIVLGSGLINGEVPPLLAARLDKSLEVQ-------------KKFSNHPVIIT 221

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
           SGG        E     + LL  GVE   +  ET+S +T +N  FS  ++ +     +++
Sbjct: 222 SGGQGSDEPRPEGEAMRDYLLSKGVEPARVVAETESRNTEENLHFSRKLLTD-PSDQVVV 280

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
            +S+YH+ R+ L  +  G+  +A       A+Y         Y     L+E++GI+
Sbjct: 281 ATSSYHVFRAALLTRTLGM--RAHVVGARTAWY---------YFPSALLREFVGII 325


>gi|161503883|ref|YP_001570995.1| hypothetical protein SARI_01972 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865230|gb|ABX21853.1| hypothetical protein SARI_01972 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 258

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 96/209 (45%), Gaps = 32/209 (15%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIF 98
           LL+ ++ SY      P W+    +  IV+LG G T  P     +  PS      S  R+ 
Sbjct: 62  LLRPIENSY------PTWQGPQKVEYIVVLGGGYTWNP-----QWAPSSNLINNSLPRLA 110

Query: 99  ETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTF 158
           E +RL+++    +    +I +GG  + + ++ + V        GV R DI     +LD  
Sbjct: 111 EGIRLWRA----NPGAKLIFTGGVAKTNTVSTAEVGARVAQSLGVPRSDII----TLDKP 162

Query: 159 QNAQFSSSMIKNMQGKN-IILVSSAYHLKRSQLYFQHFGINTKASCSDY------LNAYY 211
           ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   + ++       LN + 
Sbjct: 163 KDTEEEAAAVKQAIGDTPFLLVTSASHLPRAMIFFQHAGLNPLPAPANQLAIDSPLNPWE 222

Query: 212 SIIPLSANFYLTELALKEYIGILIAYYRG 240
             IP       ++ A  E +G +  + +G
Sbjct: 223 QAIPSPVWLMHSDRASYEALGRIWQWLKG 251


>gi|33240920|ref|NP_875862.1| hypothetical protein Pro1471 [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|33238449|gb|AAQ00515.1| Uncharacterized conserved protein with signal peptide
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
          Length = 241

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 102/226 (45%), Gaps = 22/226 (9%)

Query: 26  MSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAI 85
           +S F+ L++F   G++  +L K ++  +QR   S     D  I+VL   G ++ P I  I
Sbjct: 24  LSIFIFLWTF-SIGLVSQMLWKFVEHPWQRIDESHAPTADA-IVVLSSGGRSLAPGISNI 81

Query: 86  RIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL-AESIVYNNKLLESGVE 144
            IE  +    R    ++L+K  K   +  T    G  P +  L  E  +Y  + +  G+ 
Sbjct: 82  -IE--WNDPDRFLAGVKLFKEKKAPKLFFT---GGASPYRKALKTEGDLYKEEAISLGIP 135

Query: 145 RDDIKLETQSLDTFQNA-QFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASC 203
           +  I    +  +T + A Q   ++        I+LV+SA+H++R++  F+  G   +   
Sbjct: 136 KKAISTTGRVFNTAEEAFQIRRNIKDKGSPSKILLVTSAFHMQRAKRQFERQGFIVQPFP 195

Query: 204 SD----------YLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
            D          Y    Y+ IP S + +++  AL+E +G   A YR
Sbjct: 196 VDFKTERKFRKTYWKNPYNWIPNSESLFMSSKALRELLG--RAVYR 239


>gi|52080430|ref|YP_079221.1| hypothetical protein BL02952 [Bacillus licheniformis ATCC 14580]
 gi|52785809|ref|YP_091638.1| hypothetical protein BLi02055 [Bacillus licheniformis ATCC 14580]
 gi|319645611|ref|ZP_07999843.1| hypothetical protein HMPREF1012_00876 [Bacillus sp. BT1B_CT2]
 gi|52003641|gb|AAU23583.1| conserved hypothetical membrane protein [Bacillus licheniformis
           ATCC 14580]
 gi|52348311|gb|AAU40945.1| conserved hypothetical protein [Bacillus licheniformis ATCC 14580]
 gi|317392497|gb|EFV73292.1| hypothetical protein HMPREF1012_00876 [Bacillus sp. BT1B_CT2]
          Length = 343

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 89/193 (46%), Gaps = 27/193 (13%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY 104
           L  +  + + RP L+  +      I++LG+G  I  T+P +         SRI + +  Y
Sbjct: 148 LTAYFLYQFNRPKLNQDY------IIVLGSGL-INDTVPPLLA-------SRIDKAVDFY 193

Query: 105 KSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS 164
           +     +    II SGG      L+E+       L+ G+  +    E +S++T+QN  FS
Sbjct: 194 RKQAAVAPPPKIIFSGGQGPDENLSEAEAMQRYALKKGIPEEHTFKEDRSVNTYQNMLFS 253

Query: 165 SSMIKNM-QGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYL 222
             ++ ++  GK N I  ++ +HL R+ LY +  G+ ++   S            +A +Y 
Sbjct: 254 KQLMDSLSDGKYNSIFTTNNFHLFRASLYAKRAGLKSQGIGSK-----------TAFYYW 302

Query: 223 TELALKEYIGILI 235
               ++EYI +++
Sbjct: 303 PNAMIREYIAVVV 315


>gi|17229308|ref|NP_485856.1| hypothetical protein all1816 [Nostoc sp. PCC 7120]
 gi|17130906|dbj|BAB73515.1| all1816 [Nostoc sp. PCC 7120]
          Length = 215

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 60/116 (51%), Gaps = 5/116 (4%)

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
           EPS     RI   + LYK    +     II +GG  + + LAE+IV  N  +  GV+  D
Sbjct: 72  EPSPVFRERINHAINLYK----NGAISKIIFTGGVGEINELAEAIVGRNYAIARGVKAAD 127

Query: 148 IKLETQSLDTFQNAQFSSSMI-KNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
           +  ETQS  T+QN + +  ++  N +    +++S   HLKR+ L  ++ GI+   S
Sbjct: 128 VLTETQSRTTYQNLKNAIEVVGTNEKPTKFLIISDPLHLKRAVLMARNLGIDAYPS 183


>gi|149915963|ref|ZP_01904486.1| hypothetical protein RAZWK3B_00010 [Roseobacter sp. AzwK-3b]
 gi|149810037|gb|EDM69885.1| hypothetical protein RAZWK3B_00010 [Roseobacter sp. AzwK-3b]
          Length = 266

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 107/249 (42%), Gaps = 23/249 (9%)

Query: 4   SWI--FLIVSYWHLLCQSIRKIFFMSCFMLLFS-FIGWGIIPTILLKHLQFSYQRPLLSP 60
           SWI  FL+ +   +  Q +  I F     LLF  F+G+  +  ++++ L+   QR   +P
Sbjct: 21  SWIVFFLLFARRAVRAQRMAAIGFWVNGTLLFVLFMGFVPLGQLIMRPLE---QRYPSAP 77

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
                  IIVL G          A+         +   + M    +         +I +G
Sbjct: 78  DIAPPAGIIVLGGGEDG------AMSAASGLPETNGAGDRMSAGVALALAYPDAKLIFTG 131

Query: 121 GDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
           G  Q    G++ +IV        GV+ + I LE ++ +T +NA FS  ++ + +    +L
Sbjct: 132 GSGQFLAGGVSGAIVAKAYFESLGVDPERIILEGRARNTAENAAFSRELVDDPRIGPWVL 191

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPL------SANFYLTELALKEYIG 232
           V+SA+H+ RS   F   G       + +   Y SI  L      + NF    L++KE+IG
Sbjct: 192 VTSAFHMPRSLATFCAAGWR---DITPFPVDYRSITDLEFKWDPTGNFEKLNLSIKEWIG 248

Query: 233 ILIAYYRGN 241
           +L   + G 
Sbjct: 249 LLAYEWTGR 257


>gi|37680486|ref|NP_935095.1| hypothetical protein VV2302 [Vibrio vulnificus YJ016]
 gi|320155855|ref|YP_004188234.1| membrane protein [Vibrio vulnificus MO6-24/O]
 gi|326423949|ref|NP_760999.2| membrane protein [Vibrio vulnificus CMCP6]
 gi|37199234|dbj|BAC95066.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
 gi|319931167|gb|ADV86031.1| membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio vulnificus MO6-24/O]
 gi|319999327|gb|AAO10526.2| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio vulnificus CMCP6]
          Length = 266

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 89/188 (47%), Gaps = 23/188 (12%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTI 82
           CF++LFSF+G     +  + + LL  L+  Y   L   Q     + +++LGNG  +   I
Sbjct: 39  CFIILFSFLGIFLVSFQPVASKLLMPLERQYSVFLPEVQ---TVDYVMVLGNGHVVDDQI 95

Query: 83  PAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG---GDPQKHGLAESIVYNNKLL 139
           P    E S  S  R+ E +R+ K          +I+SG   G    H      +  N  L
Sbjct: 96  PPTS-ELSRASLMRLTEGIRILKMYP----GSKLILSGYAGGSETSHAR----MMANVAL 146

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
             GV + DI L   + DT++ A+ +++ ++    K ++LV+SA H+ R+   F   GI  
Sbjct: 147 ALGVAKSDIILLEDAKDTWEEARQAAAFVRQ---KQLVLVTSASHMARAMKEFHDAGITP 203

Query: 200 KASCSDYL 207
             + ++YL
Sbjct: 204 LPAPTNYL 211


>gi|237808220|ref|YP_002892660.1| hypothetical protein Tola_1459 [Tolumonas auensis DSM 9187]
 gi|237500481|gb|ACQ93074.1| protein of unknown function DUF218 [Tolumonas auensis DSM 9187]
          Length = 251

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 95/207 (45%), Gaps = 28/207 (13%)

Query: 43  TILLKHLQFSYQRPL--LSPQWKKDGNI--IVLLGNGTTIIPTIPAIRIEPSFQSYSRIF 98
           T  L+ +     RPL  L P + +   +  I++LG+G    P++P +  + +  + +RI 
Sbjct: 52  TFSLRPVSVGLNRPLEQLYPPFPEGQTVDFIIVLGHGHVSDPSVP-LNSQLTEAASARIQ 110

Query: 99  ETMRLYK-SCKQHSMHCTIIISG---GDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           E +R+ + + K H     +I SG   GDP    ++ + +Y      +G+ R+D+ L   +
Sbjct: 111 EALRIKRLNPKAH-----MIFSGSIAGDP----VSGAQMYARVAEANGISRNDMTLIENA 161

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN------ 208
            DT +     S +I N       LV+SA H+ R+   F+    N   + + Y+       
Sbjct: 162 RDTEEEVALDSQLISN---HPTALVTSASHMPRAMSLFRDTAANVIPAPAQYVGRLVQGD 218

Query: 209 -AYYSIIPLSANFYLTELALKEYIGIL 234
              Y  +P       +E+AL E+IG L
Sbjct: 219 IPLYGYLPSGRYLMYSEMALHEWIGTL 245


>gi|289434272|ref|YP_003464144.1| hypothetical protein lse_0905 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289170516|emb|CBH27056.1| membrane protein, putative [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 344

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 83/182 (45%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   +  Y K   +     T I+
Sbjct: 159 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLDRAIAFYEKQLAKKGKRATFIV 209

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+      L+  G++   I +E +S++T QN QFS   M   M   N +
Sbjct: 210 SGGQGDNETISEAEAMRGYLISKGIDETFIIMENKSVNTLQNMQFSKKKMDAIMPEYNSL 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ LY +  G+ ++   +            +A +Y+    ++E+I  +  Y
Sbjct: 270 FSTNNFHLFRASLYARKAGLKSQGIGAK-----------TALYYMPNALIREFIATIFMY 318

Query: 238 YR 239
            +
Sbjct: 319 KK 320


>gi|56413961|ref|YP_151036.1| hypothetical protein SPA1808 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197362884|ref|YP_002142521.1| hypothetical protein SSPA1681 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56128218|gb|AAV77724.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197094361|emb|CAR59873.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 258

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 103/224 (45%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQQVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGAKLIFTGGVAKTNTVSTAEVSARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R DI     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   +
Sbjct: 152 PRSDII----TLDKPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQHAGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|28897807|ref|NP_797412.1| hypothetical protein VP1033 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838515|ref|ZP_01991182.1| integral membrane protein [Vibrio parahaemolyticus AQ3810]
 gi|260876969|ref|ZP_05889324.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|260898706|ref|ZP_05907202.1| conserved inner membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|260900663|ref|ZP_05909058.1| conserved inner membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|28806020|dbj|BAC59296.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748082|gb|EDM58941.1| integral membrane protein [Vibrio parahaemolyticus AQ3810]
 gi|308089504|gb|EFO39199.1| conserved inner membrane protein [Vibrio parahaemolyticus Peru-466]
 gi|308093685|gb|EFO43380.1| conserved hypothetical protein [Vibrio parahaemolyticus AN-5034]
 gi|308106719|gb|EFO44259.1| conserved inner membrane protein [Vibrio parahaemolyticus AQ4037]
 gi|328473218|gb|EGF44066.1| hypothetical protein VP10329_21110 [Vibrio parahaemolyticus 10329]
          Length = 261

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 104/220 (47%), Gaps = 31/220 (14%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           CF++LFSF+G     +  + T LL  L+  ++  L        G I  +++LGNG  +  
Sbjct: 39  CFVVLFSFVGLFLVAFQPVSTKLLMPLEREHKAFL-----PVSGTIDYVMVLGNGHVVDD 93

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISGGDPQKHGLAESIVYNNKL 138
            IP     P+ Q  SR    MRL +  +   M+    +I+SG D     ++ + +  N  
Sbjct: 94  EIP-----PTSQ-LSRA-ALMRLTEGIRILRMYPGAKLILSGYDGGSE-ISHARMMANVA 145

Query: 139 LESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           L  GV + DI L   + DT++ A+ +++ +   Q K I+LV+SA H+ R+   F   GI 
Sbjct: 146 LALGVAKSDIILLEDAKDTWEEARQAAAFV---QQKEIVLVTSASHMSRALYEFNAAGIK 202

Query: 199 TKASCSDYL------NAYYSIIPLSANFYLTELALKEYIG 232
              + +++L        +    P +     TEL   EY+G
Sbjct: 203 PIPAPTNFLAIDEVSQPWDKYSPKARYLEQTELFWHEYLG 242


>gi|126463807|ref|YP_001044920.1| hypothetical protein Rsph17029_3048 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105618|gb|ABN78148.1| protein of unknown function DUF218 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 280

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 67/128 (52%), Gaps = 6/128 (4%)

Query: 113 HCTIIISGGDPQKHG--LAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
              ++ +GG  +  G  + E+ +    L+ +GV+   + LE QS +T +NA+F+ +++ N
Sbjct: 136 EARVLFTGGSGRLFGAEIPEARIAREILVSAGVDPARLILEGQSRNTAENARFAKALVAN 195

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGI-NTKASCSDYLNAYYSI---IPLSANFYLTELA 226
               + +LV+SA+H+ RS   F   G  N     +DY  A         L+ N  L  +A
Sbjct: 196 QGQGSWLLVTSAFHMPRSVETFCAAGWQNLVPWPTDYRTASLRDGIGWDLARNLDLLNVA 255

Query: 227 LKEYIGIL 234
           ++E+IGIL
Sbjct: 256 VREWIGIL 263


>gi|90413116|ref|ZP_01221113.1| hypothetical protein P3TCK_00775 [Photobacterium profundum 3TCK]
 gi|90325959|gb|EAS42405.1| hypothetical protein P3TCK_00775 [Photobacterium profundum 3TCK]
          Length = 284

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 94/192 (48%), Gaps = 18/192 (9%)

Query: 21  RKIFFMSCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG 75
           R+    SCF + F+F+G     +  I T LL+ L+   Q P +      D   I++LG+G
Sbjct: 33  RRKGLASCF-IAFAFLGIFMVAFQPIATSLLRPLETENQ-PFVPSSTPVD--YIMVLGSG 88

Query: 76  TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYN 135
             I   +P I  E S  +  R+ E MR+Y+      +  +    G D     ++++ +  
Sbjct: 89  HVIDKAMP-ITSELSRTALMRLSEGMRIYRLFPGAKLILSGYGGGSD-----ISQARMMA 142

Query: 136 NKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHF 195
              L  GV + DI L   + DT++ A  ++S++ N   KN++LV+SA H+ R+   F   
Sbjct: 143 KVALALGVNKSDILLLETARDTWEEAFQAASVVGN---KNLVLVTSASHMTRALYEFNQA 199

Query: 196 GINTKASCSDYL 207
           G+    + +++L
Sbjct: 200 GLTPTPAPTNFL 211


>gi|74316470|ref|YP_314210.1| transmembrane protein [Thiobacillus denitrificans ATCC 25259]
 gi|74055965|gb|AAZ96405.1| probable transmembrane protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 251

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 73/158 (46%), Gaps = 20/158 (12%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLET 152
           S  R+   +RL+++         ++++GG+P    LAE  +    L      RDD  +E 
Sbjct: 104 SLERLRYAVRLHRATG-----LPLLVTGGNPGGGTLAEGQILAQVL------RDDYGIEP 152

Query: 153 Q-----SLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS----C 203
           +     +L T+ NA+ S+ ++K      I LV+ A+HL+R+   F+   +    +     
Sbjct: 153 RWVEDAALTTWDNARLSAPLLKKSGVHRIALVTHAWHLRRAVPLFEAQELEVIPAGIQFA 212

Query: 204 SDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
           S  L+    ++P  A    +  AL E++GIL    R N
Sbjct: 213 STDLDRILDLLPTPAGLRDSSFALHEWLGILWYKLRSN 250


>gi|71906187|ref|YP_283774.1| hypothetical protein Daro_0547 [Dechloromonas aromatica RCB]
 gi|71845808|gb|AAZ45304.1| Protein of unknown function DUF218 [Dechloromonas aromatica RCB]
          Length = 252

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 88/190 (46%), Gaps = 25/190 (13%)

Query: 56  PLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRL-----YKSCKQH 110
           P+L  Q    G +IV+LG+G           +E + + Y     T R      Y +    
Sbjct: 70  PVL--QDAAGGQVIVVLGSG-----------LELNAEEYGGDTATDRTLLRTRYGATLAR 116

Query: 111 SMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
                +++SGG P     +E+ V  + +LE+  +      E QS+DT QNA  S++++K 
Sbjct: 117 RFDLPVLVSGGRPVNATRSEAEVMAD-ILENEFKVPVRWREMQSMDTIQNAALSAAILKK 175

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN------AYYSIIPLSANFYLTE 224
              + I+LV+ A+H+ R+   F+  G+    + + +            I+P ++  + + 
Sbjct: 176 SGVRRIVLVTQAFHMPRAVRLFRAAGLEVIPAPTHFKTGGVGTIGVADILPSASALHNSF 235

Query: 225 LALKEYIGIL 234
            AL E++GI+
Sbjct: 236 YALHEWLGIV 245


>gi|315659410|ref|ZP_07912273.1| membrane protein [Staphylococcus lugdunensis M23590]
 gi|315495529|gb|EFU83861.1| membrane protein [Staphylococcus lugdunensis M23590]
          Length = 334

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 86/192 (44%), Gaps = 33/192 (17%)

Query: 40  IIPTILLKHLQFSYQRPLLSPQW-----------KKDGNIIVLLGNGTTIIPTIP--AIR 86
           I  T L   L F+Y   L+   W            K  +I ++LG+G       P  A R
Sbjct: 122 IFVTYLFTTLIFTYFFGLILSCWLLAIFYSTLNSNKSIDIFLVLGSGLINNKVTPLLASR 181

Query: 87  IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERD 146
           I+   + Y +        ++ KQH      ++SGG        ES+     L++ G+  D
Sbjct: 182 IDAGLEIYQK--------QNNKQH----LFLVSGGQGDDELRPESVAMKEYLVDKGIVED 229

Query: 147 DIKLETQSLDTFQNAQFSSSMIKN--MQGKNIILVSSAYHLKRS-----QLYFQHF-GIN 198
           +I  E QS  T++N  FS  MI+N  +   NI++ ++ +H+ R+     +L+F++F  + 
Sbjct: 230 EIICEQQSKTTYENLYFSKEMIENLPLNKPNILICTNDFHILRAMFLAKKLHFKNFYSVG 289

Query: 199 TKASCSDYLNAY 210
            K     + NA+
Sbjct: 290 GKTKSYFFTNAF 301


>gi|316933607|ref|YP_004108589.1| hypothetical protein Rpdx1_2264 [Rhodopseudomonas palustris DX-1]
 gi|315601321|gb|ADU43856.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           DX-1]
          Length = 264

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 84/195 (43%), Gaps = 20/195 (10%)

Query: 60  PQWKKDG----NIIVLLGNGTTIIPTIPAIRIEPSFQ-SYSRIFETMRLYKSCKQHSMHC 114
           P W   G     IIVL   G  I   + A R       S  R+  T+ L +   Q     
Sbjct: 70  PPWHDTGRAPDGIIVL---GGAINSEVSAARNTVELDASAERVLATLDLARRYPQ----A 122

Query: 115 TIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
            I+ SGG     +   AE+ +    L   G+    + LE QS  T +NA  + +++    
Sbjct: 123 RIVYSGGSGNLIQRSAAEAPLAGELLERFGLAAGRVVLEDQSRTTAENAANTRALVSPKP 182

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL-----NAYYSIIPLSANFYLTELAL 227
           G+  +LV+S++H+ RS + FQ  G +  A   D+      +       L+A    T++A 
Sbjct: 183 GELWLLVTSSFHMPRSIMAFQAAGFDVVAYPVDWRTRGREDVALPFATLAAGLARTDVAA 242

Query: 228 KEYIGILIAYYRGNR 242
            E+ G L+AY  G +
Sbjct: 243 HEWAG-LLAYRLGGK 256


>gi|332528861|ref|ZP_08404835.1| hypothetical protein HGR_03097 [Hylemonella gracilis ATCC 19624]
 gi|332041720|gb|EGI78072.1| hypothetical protein HGR_03097 [Hylemonella gracilis ATCC 19624]
          Length = 255

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 93/210 (44%), Gaps = 13/210 (6%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSP-QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS 95
           GW  +P  +L+ L+   Q+P   P    +   +IVL   G+T    +     +P+  S +
Sbjct: 51  GWEPLPDAVLRQLE--AQQPAPDPLDLSRYAGVIVL--GGSTESSYVWEGHAQPALNSAA 106

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQ 153
              E +       Q      ++ +GG+ +    G +E+       +E GV    + LE+ 
Sbjct: 107 ---ERLTAALPLLQREPRLVLLYTGGEGELLASGPSEAERARRFYVEQGVPPARLLLESA 163

Query: 154 SLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY---LNAY 210
           S +T  NA FS+++    + +  +L++SA+H+ RS   F+  G N     +DY   L   
Sbjct: 164 SRNTHDNAVFSAALPGVDRTRPWLLITSAWHMPRSLRTFRKAGWNVTPWPTDYRAGLTTP 223

Query: 211 YSIIPLSANFYLTELALKEYIGILIAYYRG 240
           +    LS      +LAL E +G+     RG
Sbjct: 224 WHQYSLSQGAAKWQLALHELLGLAAYRLRG 253


>gi|126737417|ref|ZP_01753152.1| hypothetical protein RSK20926_13319 [Roseobacter sp. SK209-2-6]
 gi|126722002|gb|EBA18705.1| hypothetical protein RSK20926_13319 [Roseobacter sp. SK209-2-6]
          Length = 197

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 67/147 (45%), Gaps = 15/147 (10%)

Query: 83  PAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESG 142
           P     P+ +   R    + L+K+ K   + C+     G   KH  +E+ V     L  G
Sbjct: 48  PGGEASPTLRR--RTLHGVALFKAGKISQLICS-----GGLGKHPPSEAAVMREICLAEG 100

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
           +  D I LE +S  T +N   + ++I++ +  +I++V+  YH  R+ L  +H G+ T+ S
Sbjct: 101 LPTDAILLEDRSHSTLENLTNAKALIEDPETTDIVIVTDHYHKWRALLTARHLGLRTRVS 160

Query: 203 CSD--------YLNAYYSIIPLSANFY 221
           C           L ++   IP  A +Y
Sbjct: 161 CPSTTGTTWHRVLKSWLREIPALAYYY 187


>gi|241207055|ref|YP_002978151.1| hypothetical protein Rleg_4373 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860945|gb|ACS58612.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 262

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 108/266 (40%), Gaps = 40/266 (15%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIP--------------------TIL 45
           +FLI     +  Q +   FF+    LL   + W I+                      +L
Sbjct: 1   MFLISKLVWIFAQPLSLAFFLVFLALLAGLLRWRILSILGAAGSALILFVTLYTTAGNLL 60

Query: 46  LKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYK 105
           ++ L+  + +P   P   +    +++LG G           IE +     R  E +RL +
Sbjct: 61  MQGLEQRFAKPAADPDSLQ---CMIVLGGGFENEVNTARHGIEFN-GGADRFIEALRLAQ 116

Query: 106 SCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES--GVERDDIKLETQSLDTFQNAQF 163
              Q      I++SGGD    G+ E     ++      GV RD +  E QS  TF+NA  
Sbjct: 117 KFPQ----SRILVSGGDGSMSGIYEGDAAASERFFPLFGVGRDRLIEERQSRTTFENAVN 172

Query: 164 SSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-------LNAYYSIIPL 216
           +   + +    N +L++S +H+ RS   F+  GI+     +DY       L   ++   L
Sbjct: 173 TKEFLASQGLSNCLLITSGFHMPRSVGIFRKLGIDIVPWPTDYRTDGQVRLGLDFTQPNL 232

Query: 217 SANFYLTELALKEYIGILIAYYRGNR 242
           +A    T  A++E+ G L+ YY   R
Sbjct: 233 NAQNMAT--AIREWYG-LVGYYLAGR 255


>gi|209964476|ref|YP_002297391.1| hypothetical protein RC1_1164 [Rhodospirillum centenum SW]
 gi|209957942|gb|ACI98578.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 271

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 92/204 (45%), Gaps = 20/204 (9%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY 104
           +L  L+  +  P   P  + DG IIVL   G  + P + A R +P+   ++   E +   
Sbjct: 61  MLWSLESRFPSPATLPG-RVDG-IIVL---GGAVRPILTADRGQPALNEHA---ERLTEI 112

Query: 105 KSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
            +  +      I+ +GG     +  L E+ V        G +   +  E +S +T++NA 
Sbjct: 113 PALARRYPDARIVFTGGSGLVFEQDLKEAPVARAAWERMGFDTARVLFEQESRNTWENAL 172

Query: 163 FSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYL 222
            S  +   ++G+  +LV+SA H+ RS   F+  G N      D+     S+  +   F L
Sbjct: 173 LSRDLAHPVEGEAWLLVTSAMHMPRSVGIFRRIGWNVVPYPVDFHVPDRSLYRI--GFDL 230

Query: 223 TE------LALKEYIGILIAYYRG 240
           T+       AL EYIG+++  YRG
Sbjct: 231 TDGLRSLSYALHEYIGLVV--YRG 252


>gi|187933235|ref|YP_001885962.1| hypothetical protein CLL_A1769 [Clostridium botulinum B str. Eklund
           17B]
 gi|187721388|gb|ACD22609.1| conserved hypothetical protein [Clostridium botulinum B str. Eklund
           17B]
          Length = 253

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 98/203 (48%), Gaps = 33/203 (16%)

Query: 8   LIVSYWHLLCQSIRKIFFMSCFM----LLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWK 63
           +I+  +H + Q   K+FF  CF+    ++  FI  GI+  I ++ +  S  +       K
Sbjct: 39  IILVLYHFIKQ---KLFFNRCFIKINKIIKFFICIGIVLFIAVEIVIISCPKS-----NK 90

Query: 64  KDGNIIVLLGNGTTIIPTIPAI---RIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           ++ + IV+LG G      +  I   R++ + Q  +             + + +  I++SG
Sbjct: 91  ENTDYIVVLGAGLNNGDQLSYILKSRLDSALQCIN-------------EFNNNSYIVVSG 137

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII--- 177
           G      ++E++     LLE G+  D+I +E +S +TF+N ++S  +I+    KNI    
Sbjct: 138 GKGNDERISEAMAMKKYLLEQGISEDEILMEDKSKNTFENFKYSKKIIEEHSNKNIDDLS 197

Query: 178 --LVSSAYHLKRSQLYFQHFGIN 198
             +V++ +H  RS++  +  G N
Sbjct: 198 VKIVTTDFHGFRSKMLAKRNGYN 220


>gi|91793951|ref|YP_563602.1| hypothetical protein Sden_2600 [Shewanella denitrificans OS217]
 gi|91715953|gb|ABE55879.1| protein of unknown function DUF218 [Shewanella denitrificans OS217]
          Length = 264

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 99/206 (48%), Gaps = 15/206 (7%)

Query: 40  IIPTILLKHLQFSY-------QRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQ 92
           ++  +LL  LQ S+       QR   + Q  +    +++LG+G ++   + A + + S  
Sbjct: 53  MLAIVLLSQLQISHLLGGSLEQRYSANHQAIQGECTVMVLGSGHSLTLGLSATQ-QLSPT 111

Query: 93  SYSRIFETMR---LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIK 149
           + +R+ E +R   L +   +    C +++SG +  + G + + V      E GV +  I 
Sbjct: 112 ALARLVEGIRQLKLSEPTTEAPHSCRLVVSGWNGGREGASHAEVMALAAQELGVSKAQIT 171

Query: 150 LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA 209
              ++ DT +      SM + M      LV+SA H+ R+    +  G+N +A+ S++L  
Sbjct: 172 TFPEARDTIEELM---SMKQIMGEAPFRLVTSATHMSRAMRIARSLGLNPEAAPSNFLAG 228

Query: 210 YYSIIPLSA-NFYLTELALKEYIGIL 234
                 LSA N  L++ +L EY+G+L
Sbjct: 229 DGYWWRLSADNLILSQASLHEYVGML 254


>gi|15644422|ref|NP_229474.1| hypothetical protein TM1674 [Thermotoga maritima MSB8]
 gi|4982249|gb|AAD36741.1|AE001808_16 conserved hypothetical protein [Thermotoga maritima MSB8]
          Length = 237

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 79/152 (51%), Gaps = 22/152 (14%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL-AESIVYNNKLLESGVERDDIKLETQS 154
           R+   +++Y+  K       I+++GG     GL +E+++  + L+  GV  + I +E +S
Sbjct: 98  RLLTGVQIYQKTK-----MPILVTGG--SLTGLRSEAMIMKDYLVSLGVPEEKITVEDRS 150

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYY--- 211
            +T++NA F+   I ++    IILV+ + H++R+   F+ F      S + Y   +Y   
Sbjct: 151 RNTYENALFTREKIGDVP---IILVTDSIHMRRAVFTFKRF----FQSVTPYPAGFYFGD 203

Query: 212 ----SIIPLSANFYLTELALKEYIGILIAYYR 239
                 +P + +FYL   A+ E+IG++   +R
Sbjct: 204 PEFVDFLPNATSFYLNSRAIYEWIGLVWYNFR 235


>gi|2194196|gb|AAB61133.1| GdmH [Staphylococcus gallinarum]
 gi|86371663|gb|ABC94900.1| GdmH [Staphylococcus gallinarum]
          Length = 330

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 85/184 (46%), Gaps = 30/184 (16%)

Query: 56  PLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCT 115
            L   + K + NI  +L  G+ +I      ++ P  QS  RI      + S K   +   
Sbjct: 147 SLFYSRRKVNNNIRYILVLGSGLIED----KVPPLLQS--RIDIGKNFFDSKKDADIK-- 198

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
            ++SGG  +   ++E+    N L+  GV  + I  E +S  T++N QFS  +IK  +  N
Sbjct: 199 FLLSGGQGKDERISEAQAMKNYLISQGVNENKIICENKSQSTYENLQFSKKLIK--KNTN 256

Query: 176 IILVSSAYHLKRS-----QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEY 230
           I++ S+ +H+ R+     +L +QHF               YS+   + N++ T   ++E 
Sbjct: 257 ILICSNNFHILRAVFIAKKLKYQHF---------------YSLGSKTKNYFFTNAFIREL 301

Query: 231 IGIL 234
           I IL
Sbjct: 302 IAIL 305


>gi|118479923|ref|YP_897074.1| hypothetical protein BALH_4367 [Bacillus thuringiensis str. Al
           Hakam]
 gi|118419148|gb|ABK87567.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
          Length = 350

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 84/181 (46%), Gaps = 28/181 (15%)

Query: 60  PQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTII 117
           P+  +D   I++LG+G     +P + A          SRI + +  Y      +   TII
Sbjct: 165 PRCNQD--FIIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQAAVNTPPTII 212

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK- 174
            SGG     GL E+       +E G+  +    E +S++T+QN  FS  ++ ++  +GK 
Sbjct: 213 FSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGKY 272

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
             I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I+
Sbjct: 273 RSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIV 321

Query: 235 I 235
           +
Sbjct: 322 V 322


>gi|168233410|ref|ZP_02658468.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168237094|ref|ZP_02662152.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168243758|ref|ZP_02668690.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194447573|ref|YP_002044982.1| hypothetical protein SeHA_C1088 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472169|ref|ZP_03078153.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194737227|ref|YP_002114042.1| hypothetical protein SeSA_A1104 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194405877|gb|ACF66096.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194458533|gb|EDX47372.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194712729|gb|ACF91950.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197289831|gb|EDY29192.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|205332431|gb|EDZ19195.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205337158|gb|EDZ23922.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 258

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 103/224 (45%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGARLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R DI     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   +
Sbjct: 152 PRSDII----TLDKPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQHAGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|238913237|ref|ZP_04657074.1| hypothetical protein SentesTe_19229 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 258

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 103/224 (45%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGAKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R DI     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   +
Sbjct: 152 PRSDII----TLDKPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQHAGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|218133156|ref|ZP_03461960.1| hypothetical protein BACPEC_01018 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992029|gb|EEC58033.1| hypothetical protein BACPEC_01018 [Bacteroides pectinophilus ATCC
           43243]
          Length = 256

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 60/136 (44%), Gaps = 10/136 (7%)

Query: 106 SCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSS 165
           +C +    CTII++GG  +   + E+      L E G+  D I +E +S DT  N + S 
Sbjct: 125 ACSEDGKECTIIVAGGKGKGESVTEAFAMKRYLTEKGINPDRILMEDKSTDTQLNIKLSR 184

Query: 166 SMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTEL 225
            +  +    ++++ SS++H+ R+           K + +  LN    +   S    L   
Sbjct: 185 ELYIDDTASDVVIASSSFHIFRA----------LKLANAQGLNNVQGLAAPSNKILLVNY 234

Query: 226 ALKEYIGILIAYYRGN 241
            L+E +GI      GN
Sbjct: 235 MLREAVGITKEIVFGN 250


>gi|196043859|ref|ZP_03111096.1| conserved domain protein [Bacillus cereus 03BB108]
 gi|225866795|ref|YP_002752173.1| hypothetical protein BCA_4930 [Bacillus cereus 03BB102]
 gi|229187061|ref|ZP_04314210.1| hypothetical protein bcere0004_46000 [Bacillus cereus BGSC 6E1]
 gi|196025195|gb|EDX63865.1| conserved domain protein [Bacillus cereus 03BB108]
 gi|225789384|gb|ACO29601.1| conserved domain protein [Bacillus cereus 03BB102]
 gi|228596370|gb|EEK54041.1| hypothetical protein bcere0004_46000 [Bacillus cereus BGSC 6E1]
          Length = 344

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 84/181 (46%), Gaps = 28/181 (15%)

Query: 60  PQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTII 117
           P+  +D   I++LG+G     +P + A          SRI + +  Y      +   TII
Sbjct: 159 PRCNQD--FIIVLGSGLINDKVPPLLA----------SRIHKAIDFYWKQAAVNTPPTII 206

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGK- 174
            SGG     GL E+       +E G+  +    E +S++T+QN  FS  ++ ++  +GK 
Sbjct: 207 FSGGQGPDEGLPEAEAMQKYAVEKGIPLEHTVQENRSVNTYQNMLFSKEIMDSLKPEGKY 266

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
             I  ++ +HL R+ +Y +  G+N++   S            +A +Y     ++EY+ I+
Sbjct: 267 RSIFTTNNFHLFRAGIYARQAGLNSQGIGSK-----------TAFYYWPNAMIREYVAIV 315

Query: 235 I 235
           +
Sbjct: 316 V 316


>gi|16764350|ref|NP_459965.1| hypothetical protein STM0990 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|161614771|ref|YP_001588736.1| hypothetical protein SPAB_02523 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167994940|ref|ZP_02576030.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168263514|ref|ZP_02685487.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168466584|ref|ZP_02700446.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|16419502|gb|AAL19924.1| putative KicA protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|161364135|gb|ABX67903.1| hypothetical protein SPAB_02523 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|195630934|gb|EDX49520.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205327272|gb|EDZ14036.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205347829|gb|EDZ34460.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|261246206|emb|CBG24010.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992729|gb|ACY87614.1| hypothetical protein STM14_1120 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301157533|emb|CBW17023.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911976|dbj|BAJ35950.1| hypothetical protein STMDT12_C10070 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321223313|gb|EFX48382.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|323129255|gb|ADX16685.1| hypothetical protein STM474_0976 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332987881|gb|AEF06864.1| hypothetical protein STMUK_0956 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 258

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 103/224 (45%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGARLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R DI     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   +
Sbjct: 152 PRSDII----TLDKPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQHAGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|167553009|ref|ZP_02346759.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205322470|gb|EDZ10309.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 258

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 103/224 (45%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGARLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R DI     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   +
Sbjct: 152 PRSDII----TLDKPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQHAGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|227544579|ref|ZP_03974628.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
 gi|300910291|ref|ZP_07127751.1| conserved hypothetical protein [Lactobacillus reuteri SD2112]
 gi|227185458|gb|EEI65529.1| conserved hypothetical protein [Lactobacillus reuteri CF48-3A]
 gi|300892939|gb|EFK86299.1| conserved hypothetical protein [Lactobacillus reuteri SD2112]
          Length = 271

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 56/99 (56%), Gaps = 4/99 (4%)

Query: 102 RLYKS--CKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQ 159
           RL K+  C +      II+SGG  QK   +E+ V    L+  G+    I  E ++L+T+Q
Sbjct: 128 RLDKAINCWKTHQSAKIIVSGGIVQKAKESEAEVMAAYLIAHGIPARKIIRENKALNTWQ 187

Query: 160 NAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           N  F+S +IK  +   +++V+S +H+ R++ Y +  G+N
Sbjct: 188 NLAFASQLIKPQE--TVVVVTSDFHVLRARAYARKMGLN 224


>gi|16759859|ref|NP_455476.1| hypothetical protein STY0992 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29142368|ref|NP_805710.1| hypothetical protein t1944 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213052381|ref|ZP_03345259.1| hypothetical protein Salmoneentericaenterica_05289 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213424605|ref|ZP_03357388.1| hypothetical protein SentesTyphi_02341 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213581562|ref|ZP_03363388.1| hypothetical protein SentesTyph_10282 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213613211|ref|ZP_03371037.1| hypothetical protein SentesTyp_12289 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213650532|ref|ZP_03380585.1| hypothetical protein SentesTy_26823 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213857895|ref|ZP_03384866.1| hypothetical protein SentesT_22570 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|25347649|pir||AD0615 probable membrane protein STY0992 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16502152|emb|CAD05390.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137998|gb|AAO69559.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 258

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 103/224 (45%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGARLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R DI     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   +
Sbjct: 152 PRSDII----TLDKPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQHAGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|146284078|ref|YP_001174231.1| transmembrane protein [Pseudomonas stutzeri A1501]
 gi|145572283|gb|ABP81389.1| probable transmembrane protein [Pseudomonas stutzeri A1501]
          Length = 257

 Score = 55.8 bits (133), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 100/218 (45%), Gaps = 18/218 (8%)

Query: 28  CFMLLFSFIGWGIIPTILLKHLQFSYQRP-LLSPQWKK---DGNIIVLLGNGTTIIPTIP 83
           CF+  F+ +    +P ++    +   + P L+  +W +       IV+LG G       P
Sbjct: 38  CFVTGFTGLWLMSLPIVVEWTARAVEREPALVEARWSQLSGQAGAIVVLGAGREQ--NDP 95

Query: 84  AIR-IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESG 142
           A    +P + +  R+    RL K+         I+ SGG       +E+++   ++L+  
Sbjct: 96  AWGGDQPGYTALERLRYAARLAKASG-----LPILTSGGLHYGQPPSEAML-GAEVLQRD 149

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
                  LE +S  T++NA FS+ M++    + ++LV+SA H+ RS+  F+  GI   A+
Sbjct: 150 FGVATRWLEERSRTTWENALFSAEMLRAAGVERVVLVTSAAHMPRSRWCFEQNGIEVIAA 209

Query: 203 CSDYLNAYYS-----IIPLSANFYLTELALKEYIGILI 235
              ++  + +      +P S  F+   L L E +G+ +
Sbjct: 210 PVGFMGGHNARPLDGWLPESKAFWQNGLLLNEVVGMAV 247


>gi|327482395|gb|AEA85705.1| transmembrane protein [Pseudomonas stutzeri DSM 4166]
          Length = 257

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 100/218 (45%), Gaps = 18/218 (8%)

Query: 28  CFMLLFSFIGWGIIPTILLKHLQFSYQRP-LLSPQWKK---DGNIIVLLGNGTTIIPTIP 83
           CF+  F+ +    +P ++    +   + P L+  +W +       IV+LG G       P
Sbjct: 38  CFVTGFTGLWLMSLPIVVEWTARAVEREPALVEARWSQLSGQAGAIVVLGAGREQ--NDP 95

Query: 84  AIR-IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESG 142
           A    +P + +  R+    RL K+         I+ SGG       +E+++   ++L+  
Sbjct: 96  AWGGDQPGYTALERLRYAARLAKASG-----LPILTSGGLHYGQPPSEAML-GAEVLQRD 149

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
                  LE +S  T++NA FS+ M++    + ++LV+SA H+ RS+  F+  GI   A+
Sbjct: 150 FGVATRWLEERSRTTWENALFSAEMLRAAGVERVVLVTSAAHMPRSRWCFEQNGIEVIAA 209

Query: 203 CSDYLNAYYS-----IIPLSANFYLTELALKEYIGILI 235
              ++  + +      +P S  F+   L L E +G+ +
Sbjct: 210 PVGFMGGHNARPLNGWLPESKAFWQNGLLLNEVVGMAV 247


>gi|312864360|ref|ZP_07724593.1| putative membrane protein [Streptococcus downei F0415]
 gi|311100081|gb|EFQ58292.1| putative membrane protein [Streptococcus downei F0415]
          Length = 338

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 72/154 (46%), Gaps = 19/154 (12%)

Query: 62  WKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
           +K+  + +++LG+G       P +         SRI + + +Y    Q    C +I+SGG
Sbjct: 163 FKRPIDYVLVLGSGLMGDKVTPLLA--------SRIKKGIEIY----QKHPDCRLILSGG 210

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
             +   +AE        L  GV   DI +E +S +T +N QFSS ++ N    N+ +V++
Sbjct: 211 QGKDELIAEGQAMAKYALSQGVPEKDIIIEDRSKNTRENLQFSSHLMAN--KANLAIVTN 268

Query: 182 AYHLKRSQLYFQHFGI-----NTKASCSDYLNAY 210
            YHL R+ L  +  GI       K      LNAY
Sbjct: 269 YYHLFRALLIARDLGIPCIGYGAKTKFYFSLNAY 302


>gi|313638523|gb|EFS03686.1| integral membrane protein [Listeria seeligeri FSL S4-171]
          Length = 344

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 81/179 (45%), Gaps = 20/179 (11%)

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIIISGG 121
           + + + +++LG+G      I   R+ P   S  R+   +  Y K   +     T I+SGG
Sbjct: 160 RNNQDFLIVLGSGL-----IGGDRVPPLLAS--RLDRAIAFYEKQLAKKGKRATFIVSGG 212

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNIILVS 180
                 ++E+      L+  G+E   I +E +S++T QN QFS   M   M   N +  +
Sbjct: 213 KGDNETISEAEAMRGYLISKGIEETFIIMENKSVNTLQNMQFSKKKMDAIMPEYNSLFST 272

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           + +HL R+ LY +  G+ ++   +            +A +Y+    ++E+I  +  Y +
Sbjct: 273 NNFHLFRASLYARKAGLKSQGIGAK-----------TALYYMPNALIREFIATIFMYKK 320


>gi|194468048|ref|ZP_03074034.1| protein of unknown function DUF218 [Lactobacillus reuteri 100-23]
 gi|194452901|gb|EDX41799.1| protein of unknown function DUF218 [Lactobacillus reuteri 100-23]
          Length = 271

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 56/99 (56%), Gaps = 4/99 (4%)

Query: 102 RLYKS--CKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQ 159
           RL K+  C +      II+SGG  QK   +E+ V    L+  G+    I  E ++L+T+Q
Sbjct: 128 RLDKAINCWKTHQSAKIIVSGGIVQKAKESEAEVMAAYLIAHGIPARKIIRENKALNTWQ 187

Query: 160 NAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           N  F+S +IK  +   +++V+S +H+ R++ Y +  G+N
Sbjct: 188 NLAFASQLIKPQE--TVVVVTSDFHVLRARAYARKMGLN 224


>gi|62179518|ref|YP_215935.1| hypothetical protein SC0948 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|198245262|ref|YP_002214914.1| hypothetical protein SeD_A1055 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389922|ref|ZP_03216533.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205352197|ref|YP_002225998.1| hypothetical protein SG0932 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856381|ref|YP_002243032.1| hypothetical protein SEN0894 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224582800|ref|YP_002636598.1| hypothetical protein SPC_0991 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|62127151|gb|AAX64854.1| putative KicA protein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|197939778|gb|ACH77111.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199602367|gb|EDZ00913.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205271978|emb|CAR36822.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206708184|emb|CAR32477.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224467327|gb|ACN45157.1| hypothetical protein SPC_0991 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322713985|gb|EFZ05556.1| Uncharacterized protein ycbC [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|326622667|gb|EGE29012.1| hypothetical protein SD3246_1028 [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326627241|gb|EGE33584.1| hypothetical protein SG9_0953 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 258

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 103/224 (45%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGARLIFTGGIAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R DI     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   +
Sbjct: 152 PRSDII----TLDKPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQHAGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|149197614|ref|ZP_01874664.1| hypothetical protein LNTAR_20313 [Lentisphaera araneosa HTCC2155]
 gi|149139184|gb|EDM27587.1| hypothetical protein LNTAR_20313 [Lentisphaera araneosa HTCC2155]
          Length = 247

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 80/176 (45%), Gaps = 18/176 (10%)

Query: 65  DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG---G 121
           D   I +LG+G +     P   ++ S  + SR+ E +R     KQ +     I  G    
Sbjct: 77  DAKYIAVLGSGHSSQKHWPD-SLKLSRTARSRLMEGLR----QKQLNPEAKFIFFGFGVN 131

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
             Q HG     +     +  GV  +DI    Q  DT + AQF+  +      + ++LV+ 
Sbjct: 132 GKQPHGE----IMTQAAISLGVNPEDISFSVQPRDTNEEAQFAKEVCGT---EKLLLVTD 184

Query: 182 AYHLKRSQLYFQHFGIN---TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           A H  R+   F+ +G+N   T A+   Y +A++  +P +    LT  ++ EY+G++
Sbjct: 185 ATHTPRAMKLFKSYGLNVFATPANYESYGDAWFVPMPSAEALELTRKSIYEYVGLI 240


>gi|331004989|ref|ZP_08328398.1| hypothetical protein IMCC1989_103 [gamma proteobacterium IMCC1989]
 gi|330421202|gb|EGG95459.1| hypothetical protein IMCC1989_103 [gamma proteobacterium IMCC1989]
          Length = 144

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 64/129 (49%), Gaps = 14/129 (10%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           +I+SGG+ +   +          L++ +  D    E +S +T++NA F+  M+      +
Sbjct: 15  VIVSGGNVRSFDVVSEADMGVYFLQNELNVDIAWPEGESRNTWENAHFTKKMLDKQSIHH 74

Query: 176 IILVSSAYHLKRSQLYFQHFGINT----------KASCSDYLNAYYSIIPLSANFYLTEL 225
           + LV+ AYH+ RS   FQ  G+            ++S S +LN     +P +   +++ L
Sbjct: 75  VALVTHAYHMPRSVYAFQQAGLTVSPMPTGQLSQQSSTSYWLN----WLPSAGALHISRL 130

Query: 226 ALKEYIGIL 234
           AL EY+G+L
Sbjct: 131 ALHEYLGLL 139


>gi|188534261|ref|YP_001908058.1| hypothetical protein ETA_21340 [Erwinia tasmaniensis Et1/99]
 gi|188029303|emb|CAO97180.1| Conserved hypothetical protein YcbC [Erwinia tasmaniensis Et1/99]
          Length = 262

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 84/183 (45%), Gaps = 26/183 (14%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
           IV+LG G T  P     +  PS      S  R+ E +R++      +    +I +GG  Q
Sbjct: 82  IVVLGGGYTWNP-----QWAPSSNMLNNSLPRLAEGIRIW----HENPRAKLIFTGGKAQ 132

Query: 125 KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYH 184
            + L+ + V  N     G+    + +  +  DT Q A   + ++ N   +   LV+SA H
Sbjct: 133 GNPLSSAAVTANTARSLGIPDGAMIILDRPRDTEQEAHEVAKIVTN---RPFALVTSANH 189

Query: 185 LKRSQLYFQHFGINTKASCSDY------LNAYYSIIPLSANFYL--TELALKEYIGILIA 236
           L R+ LYFQ  G+    + ++       LN +  ++P S  F+L  +E AL E IG +  
Sbjct: 190 LPRAMLYFQQEGLQPWPAPANQLAIASPLNLWERVLPSS--FWLGHSERALYESIGRMWQ 247

Query: 237 YYR 239
           + +
Sbjct: 248 WLK 250


>gi|313633948|gb|EFS00656.1| integral membrane protein [Listeria seeligeri FSL N1-067]
          Length = 344

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 83/182 (45%), Gaps = 22/182 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY-KSCKQHSMHCTIII 118
           P++ +D   +++LG+G      I   R+ P   S  R+   +  Y K   +     T I+
Sbjct: 159 PRYNQD--FLIVLGSGL-----IGGDRVPPLLAS--RLDRAIAFYEKQLAKKGKRATFIV 209

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS-SSMIKNMQGKNII 177
           SGG      ++E+      L+  G++   I +E +S++T QN QFS   M   M   N +
Sbjct: 210 SGGQGDNEIISEAEAMRGYLISKGIDETFIIMENKSVNTLQNMQFSKKKMDAIMPEYNSL 269

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
             ++ +HL R+ LY +  G+ ++   +            +A +Y+    ++E+I  +  Y
Sbjct: 270 FSTNNFHLFRASLYARKAGLKSQGIGAK-----------TALYYMPNALIREFIATIFMY 318

Query: 238 YR 239
            +
Sbjct: 319 KK 320


>gi|229035448|ref|ZP_04189344.1| hypothetical protein bcere0028_54330 [Bacillus cereus AH1271]
 gi|228727867|gb|EEL78947.1| hypothetical protein bcere0028_54330 [Bacillus cereus AH1271]
          Length = 176

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 72/147 (48%), Gaps = 13/147 (8%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SRI + +  Y    + +     I SGG      ++E+       +E G+  +  + E QS
Sbjct: 17  SRINKGIEFYHRQAEVTSPPIFIFSGGQGADELVSEAHAMQAYAVEKGIPIEHTRKEDQS 76

Query: 155 LDTFQNAQFSSSMIKNMQGK--NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYS 212
           ++T+QN  FS  ++ +++G   N I  ++ +HL R+ L+ +  G+N++   S        
Sbjct: 77  VNTYQNMLFSKRIMDSLKGATYNSIFTTNNFHLFRAGLFAKQSGLNSQGIGSK------- 129

Query: 213 IIPLSANFYLTELALKEYIGILIAYYR 239
               +A +Y     ++EYI +++ Y++
Sbjct: 130 ----TAFYYWPNAMIREYIAVVVMYHK 152


>gi|197265841|ref|ZP_03165915.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197244096|gb|EDY26716.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
          Length = 258

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 89/194 (45%), Gaps = 26/194 (13%)

Query: 60  PQWKKDGNI--IVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLYKSCKQHSMH 113
           P W+    +  IV+LG G T  P     +  PS      S  R+ E +RL+++    +  
Sbjct: 71  PTWQGPQKVEYIVVLGGGYTWNP-----QWAPSSNLINNSLPRLAEGIRLWRA----NPG 121

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I +GG  + + ++ + V        GV R DI     +LD  ++ +  ++ +K   G
Sbjct: 122 ARLIFTGGVAKTNTVSTAEVGARVAQSLGVPRSDII----TLDKPKDTEEEAAAVKQAIG 177

Query: 174 K-NIILVSSAYHLKRSQLYFQHFGINTKASCSDY------LNAYYSIIPLSANFYLTELA 226
               +LV+SA HL R+ ++FQH G+N   + ++       LN +   IP       ++ A
Sbjct: 178 DAPFLLVTSASHLPRAMIFFQHAGLNPLPAPANQLAIDSPLNPWERAIPSPVWLMHSDRA 237

Query: 227 LKEYIGILIAYYRG 240
             E +G L  + +G
Sbjct: 238 GYETLGRLWQWLKG 251


>gi|170288947|ref|YP_001739185.1| hypothetical protein TRQ2_1158 [Thermotoga sp. RQ2]
 gi|170176450|gb|ACB09502.1| protein of unknown function DUF218 [Thermotoga sp. RQ2]
          Length = 237

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 95/197 (48%), Gaps = 25/197 (12%)

Query: 51  FSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQH 110
           +S ++ L  P    +  +IV+LG G   +          S  +  R+   +++Y+  K  
Sbjct: 56  WSLEKNLDVPATLPNDAVIVVLGGG---VERNTKAGDNLSDATLRRLLTGVQIYQKTK-- 110

Query: 111 SMHCTIIISGGDPQKHGL-AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK 169
                I+++GG     GL  E+++  + L+  GV  + I +E +S +T++NA F+   I 
Sbjct: 111 ---MPILVTGG--SLTGLRPEAMIMKDYLVSLGVPEEKITVEDRSRNTYENAFFTREKIG 165

Query: 170 NMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYY-------SIIPLSANFYL 222
           ++    IILV+ + H++R+   F+ F      S + Y   +Y         +P + +FYL
Sbjct: 166 DVP---IILVTDSIHMRRAVFTFKSF----FQSVTPYPAGFYFGDPEFVDFLPNATSFYL 218

Query: 223 TELALKEYIGILIAYYR 239
              A+ E+IG++   +R
Sbjct: 219 NSRAIYEWIGLVWYNFR 235


>gi|283455426|ref|YP_003359990.1| hypothetical protein BDP_0493 [Bifidobacterium dentium Bd1]
 gi|283102060|gb|ADB09166.1| hypothetical protein BDP_0493 [Bifidobacterium dentium Bd1]
          Length = 346

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           +Q     TII SGG      ++ES    N LL  GV    I LE +S  T +N +FS ++
Sbjct: 198 EQGGRRATIITSGGQGHDEVISESRAMANYLLSQGVPESSILLEDKSSTTEENLKFSHAI 257

Query: 168 IKNMQG-KNIILVSSAYHLKRSQLYFQHFGINTKASC 203
           +    G  +  + +S+YH  R+ ++ +  GIN  ASC
Sbjct: 258 MDARGGAAHCTIATSSYHCLRAAMFARRLGIN--ASC 292


>gi|192291940|ref|YP_001992545.1| hypothetical protein Rpal_3570 [Rhodopseudomonas palustris TIE-1]
 gi|192285689|gb|ACF02070.1| protein of unknown function DUF218 [Rhodopseudomonas palustris
           TIE-1]
          Length = 264

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 89/193 (46%), Gaps = 16/193 (8%)

Query: 60  PQWKKDGNI---IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTI 116
           P W + G     I++LG       ++    +E    S  R+   + L +   +      I
Sbjct: 70  PPWHEAGRAPDGIIVLGGAIDSELSVARNTLEVD-ASAERVLAALDLARRYPK----ARI 124

Query: 117 IISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK 174
           + SGG     +  +AE+ +    L   G+  D + LE +S  T +NA ++ +++    G+
Sbjct: 125 VYSGGSGNLIQRSVAEAPLAGELLERFGLASDRLVLEDKSRTTAENAAYTRALVVPKPGE 184

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDYL-----NAYYSIIPLSANFYLTELALKE 229
             +LV+SA+H+ RS + F+  G +      D+      +A  +   L+A    T++A+ E
Sbjct: 185 LWLLVTSAFHMPRSIIAFRAAGFDVVPYPVDWRTRGSEDAARTFSTLAAGLARTDVAVHE 244

Query: 230 YIGILIAYYRGNR 242
           + G L+AY  G +
Sbjct: 245 WAG-LLAYRLGGK 256


>gi|309802755|ref|ZP_07696859.1| putative membrane protein [Bifidobacterium dentium JCVIHMP022]
 gi|308220819|gb|EFO77127.1| putative membrane protein [Bifidobacterium dentium JCVIHMP022]
          Length = 346

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           +Q     TII SGG      ++ES    N LL  GV    I LE +S  T +N +FS ++
Sbjct: 198 EQGGRRATIITSGGQGHDEVISESRAMANYLLSQGVPESSILLEDKSSTTEENLKFSHAI 257

Query: 168 IKNMQG-KNIILVSSAYHLKRSQLYFQHFGINTKASC 203
           +    G  +  + +S+YH  R+ ++ +  GIN  ASC
Sbjct: 258 MDARGGAAHCTIATSSYHCLRAAMFARRLGIN--ASC 292


>gi|306823505|ref|ZP_07456880.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|304553212|gb|EFM41124.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
          Length = 348

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           +Q     TII SGG      ++ES    N LL  GV    I LE +S  T +N +FS ++
Sbjct: 200 EQGGRRATIITSGGQGHDEVISESRAMANYLLSQGVPESSILLEDKSSTTEENLKFSHAI 259

Query: 168 IKNMQG-KNIILVSSAYHLKRSQLYFQHFGINTKASC 203
           +    G  +  + +S+YH  R+ ++ +  GIN  ASC
Sbjct: 260 MDARGGAAHCTIATSSYHCLRAAMFARRLGIN--ASC 294


>gi|268608564|ref|ZP_06142291.1| hypothetical protein RflaF_03567 [Ruminococcus flavefaciens FD-1]
          Length = 254

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 98/220 (44%), Gaps = 22/220 (10%)

Query: 1   MLLSWIFLIVSYWH----LLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRP 56
           ML+S +  ++  +H     L  SI +      F++L S +  G I  +L   L  S  R 
Sbjct: 35  MLVSAVLTVIFVFHGRFTSLVSSIWEKPVGKVFIVLISLLMAGGI--VLASVLSVSMARE 92

Query: 57  LLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTI 116
           +  P   +D  ++VL   G  +    P++ +     +          YK    H   C +
Sbjct: 93  MNDPPQNEDTTLVVL---GCKVKDGRPSLMLSRRLNAA---------YKYMSGHETVCAV 140

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI-KNMQGKN 175
           + SGG      ++E+      L E G++   I +E +S  T +N +FS  +I +N   + 
Sbjct: 141 V-SGGQGSDEVMSEAECMKIYLTEKGIDPQRIFMEDKSTTTKENLEFSKKLIAENGLPQK 199

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIP 215
           + LV+  +H  R+++  +  GI++  + S Y + Y  I+P
Sbjct: 200 VTLVTDGFHQLRAEMLAEKTGISSPYNISGYTSWY--IVP 237


>gi|255036862|ref|YP_003087483.1| hypothetical protein Dfer_3103 [Dyadobacter fermentans DSM 18053]
 gi|254949618|gb|ACT94318.1| protein of unknown function DUF218 [Dyadobacter fermentans DSM
           18053]
          Length = 256

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (50%), Gaps = 4/118 (3%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
            R+ +T  LYK+ K   +  T   S  D       E+      L++ GV   DI  E ++
Sbjct: 104 DRVLQTFLLYKAGKIRKILITGA-SADDAMAGKRGETKTAAALLVQWGVPAGDIVFEEKA 162

Query: 155 LDTFQNAQFSSSMIKNM--QGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
            +T QNA  S+ +++ M   GK  IL++SA+H++RS   F+  GI TK   +D+   Y
Sbjct: 163 KNTRQNALNSAQILRKMFPSGK-YILITSAFHMRRSVGCFEKAGIKTKPFPADFYGGY 219


>gi|257869611|ref|ZP_05649264.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
 gi|257803775|gb|EEV32597.1| conserved hypothetical protein [Enterococcus gallinarum EG2]
          Length = 356

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 83/181 (45%), Gaps = 29/181 (16%)

Query: 60  PQWKKDGNIIVLLG----NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCT 115
           P++ +D   I++LG    NG  + P + A RI+ +   Y   F   R  K+  +  M   
Sbjct: 169 PRYDQD--FIIVLGAGLLNGEKVSPLL-AQRIDKAIAFYHLQF---RAKKTAPRFLM--- 219

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QG 173
              SGG      + E++      +  G+   +I +E  S  T++N +FS  ++ ++  +G
Sbjct: 220 ---SGGQGSDEKIPEAVAMKEYAVSQGIPESEILVEANSTTTYENMKFSKEIMDSLRPEG 276

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
            + I VS+ YH+ R+ +Y     ++ KA       A+Y         YL    L+EYI I
Sbjct: 277 YHAIFVSNNYHIFRAGMYADQ--VHVKADGIGSHTAFY---------YLPNAFLREYIAI 325

Query: 234 L 234
           L
Sbjct: 326 L 326


>gi|271500774|ref|YP_003333799.1| hypothetical protein Dd586_2243 [Dickeya dadantii Ech586]
 gi|270344329|gb|ACZ77094.1| protein of unknown function DUF218 [Dickeya dadantii Ech586]
          Length = 259

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 88/195 (45%), Gaps = 27/195 (13%)

Query: 60  PQWKKD---GNIIVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLYKSCKQHSM 112
           P W  D    N IV+LG G T  P  P     PS      S +R+ E +RL+++     +
Sbjct: 71  PTWTPDFPKVNYIVVLGGGYTFNPDWP-----PSANLINNSLARVTEGIRLWRANPGAKL 125

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNM 171
             T   + G+P       S     ++ ES GV   DI L  ++ DT + A  + ++I   
Sbjct: 126 IFTGAAAQGNP-----VTSASTAARVAESLGVPAQDILLVDKARDTEEEAAGTEALIGK- 179

Query: 172 QGKNIILVSSAYHLKRSQLYFQHFGIN------TKASCSDYLNAYYSIIPLSANFYLTEL 225
             +  +LV+SA HL R+  +FQ  G++       + + +  LN +  + P +     +E 
Sbjct: 180 --QPFLLVTSANHLPRAIRFFQARGLHPIPAPANQLAITSPLNPWERVFPSALYLSHSER 237

Query: 226 ALKEYIGILIAYYRG 240
           A  E +G++    +G
Sbjct: 238 AWYEGLGLIWQQMKG 252


>gi|171741210|ref|ZP_02917017.1| hypothetical protein BIFDEN_00283 [Bifidobacterium dentium ATCC
           27678]
 gi|171276824|gb|EDT44485.1| hypothetical protein BIFDEN_00283 [Bifidobacterium dentium ATCC
           27678]
          Length = 348

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           +Q     TII SGG      ++ES    N LL  GV    I LE +S  T +N +FS ++
Sbjct: 200 EQGGRRATIITSGGQGHDEVISESRAMANYLLSQGVPESSILLEDKSSTTEENLKFSHAI 259

Query: 168 IKNMQG-KNIILVSSAYHLKRSQLYFQHFGINTKASC 203
           +    G  +  + +S+YH  R+ ++ +  GIN  ASC
Sbjct: 260 MDARGGAAHCTIATSSYHCLRAAMFARRLGIN--ASC 294


>gi|194334537|ref|YP_002016397.1| hypothetical protein Paes_1732 [Prosthecochloris aestuarii DSM 271]
 gi|194312355|gb|ACF46750.1| protein of unknown function DUF218 [Prosthecochloris aestuarii DSM
           271]
          Length = 250

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 80/178 (44%), Gaps = 13/178 (7%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           + +V+LG G T+   +P +R      +  R    + +++  K   +  T       P   
Sbjct: 73  DAVVVLG-GVTV--QVPGVRYGEWGDAADRFEGGVEVFRGGKAPLLVLTGAKMPWAPDAR 129

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLK 186
              E  +   + L  GV  + +++  +  +T   A+    ++  +    +ILV+SA+H++
Sbjct: 130 --VEGELLRERALLLGVPEESVRVTGRVGNTADEAREVRKLLAGIARPRVILVTSAFHMR 187

Query: 187 RSQLYFQHFGINTKASCSDYLNAYY------SIIPLSANFYLTELALKEYIGILIAYY 238
           R+ + F+H G+       D+  ++Y        +P +     +ELA++E IG L  YY
Sbjct: 188 RAAMLFRHAGLRVDEFPVDFRTSFYDRLTVIDFLPCADGLENSELAIREMIGWL--YY 243


>gi|218667128|ref|YP_002426951.1| hypothetical protein AFE_2571 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|218519341|gb|ACK79927.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 266

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 102/240 (42%), Gaps = 22/240 (9%)

Query: 3   LSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQW 62
           L W+  IV + +L      ++  +     L+ F    I   +LL  L+  Y  PL  P  
Sbjct: 28  LGWLAEIVGWRYL-----GRVLMLLALGTLY-FFSTAIGARLLLLPLEDRYP-PLTKPLH 80

Query: 63  KKD-GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK-QHSMHCTIIISG 120
             D    I++LG G  +       +   S Q  +     +RL  + +        II SG
Sbjct: 81  GADTPQAIIVLGGGEVM-------QSPGSNQETANARTLVRLLAAAQLARQTGLPIIPSG 133

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           G P+    AE++     L +    +  I  ETQS +T  NA  S++++    G    LV+
Sbjct: 134 GAPRLGAPAEALTMEFILRQDLGVQSTIWPETQSYNTAANATDSAAILAEHHGHQAYLVT 193

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDY----LNAYY--SIIPLSANFYLTELALKEYIGIL 234
           SA H+ R+  +F+  G+      +DY    +N     S +P +    ++  A  EY+G+L
Sbjct: 194 SALHMPRAVAWFRRAGVKVVPVPTDYRLDRVNGLRLESWLPRAIYLEISSEASHEYLGLL 253


>gi|306841899|ref|ZP_07474579.1| Hypothetical protein BIBO2_1680 [Brucella sp. BO2]
 gi|306288029|gb|EFM59431.1| Hypothetical protein BIBO2_1680 [Brucella sp. BO2]
          Length = 205

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 71/155 (45%), Gaps = 11/155 (7%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKL 150
           +  RI ETMRL +          II+SGG+    +    E+      L + G   D    
Sbjct: 46  AADRIVETMRLARLYPD----AKIIVSGGEGTFFEKSAREAETTRALLSDLGFSGDRYIF 101

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E +S +T +NA FS ++     G+  +LV+SAYH+ R+   F+  G +  A   DY    
Sbjct: 102 EGKSRNTVENAIFSQALALPKPGETWLLVTSAYHMPRAVGCFRKAGFDVTAWPVDYKTRT 161

Query: 211 YSIIPL---SANFYLTE--LALKEYIGILIAYYRG 240
                L   S N  L+   +AL+E+ G+   ++ G
Sbjct: 162 RETFGLYLESPNDALSRFSMALREWTGLAAYWWTG 196


>gi|220935563|ref|YP_002514462.1| integral membrane protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996873|gb|ACL73475.1| integral membrane protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 250

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 95/210 (45%), Gaps = 26/210 (12%)

Query: 37  GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS- 95
           G G +   LL  L++ Y  P   P+     +I+VL   G       P + +     S++ 
Sbjct: 50  GSGPVAHALLGGLEYRYPAPENMPELD---HIVVLAAYGAHD----PRVSVINQVNSHAL 102

Query: 96  -RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
            R+ E   L    ++H      +  GG+  K       +  + L+  GV    I++E  S
Sbjct: 103 IRLVEASLL---AREHPEAILTVTGGGEVPK-------LMADVLIVLGVPESRIRVEALS 152

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY---- 210
            +TF++A    + +K+   +   LV+SA H+ R+ + F+  G+    + +DYL+      
Sbjct: 153 SNTFESALHLQAELKD---QRFALVTSAGHMSRAMMVFRGQGLEPIPAPTDYLSFADIWS 209

Query: 211 YSIIPLSANFYLTELALKEYIGILIAYYRG 240
             I+    N  L++LA+ EYI ++   +RG
Sbjct: 210 AQIMAKPGNLLLSDLAIHEYIALVWYRWRG 239


>gi|90579519|ref|ZP_01235328.1| hypothetical protein VAS14_01116 [Vibrio angustum S14]
 gi|90439093|gb|EAS64275.1| hypothetical protein VAS14_01116 [Vibrio angustum S14]
          Length = 275

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 109/239 (45%), Gaps = 23/239 (9%)

Query: 7   FLIVSYWHLLCQSIRKIFFMSCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQ 61
            LI+ +  LL     +   ++  ++ FSF+G     +  + T LL+ L+  Y   + S  
Sbjct: 18  LLIIGFIGLLVLWFTRNKKLASGIIAFSFLGIFAVSFQPVSTSLLRPLEQQYPAFVGS-- 75

Query: 62  WKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
             K  N +++LGN   I  T P I  E S  +  R+ E +R+ +      M  +    G 
Sbjct: 76  -SKPINFVMVLGNSHVIDKTFP-ITSELSRTALMRLVEGIRIARMYPGSKMILSGYGGGT 133

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
           D     ++ + +     L  GV + DI L   + DT++ A  ++S++ +   KN++LV+S
Sbjct: 134 D-----ISHARMMAKVALALGVSKSDILLLETAKDTWEEAHQAASVVGD---KNLVLVTS 185

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYLNA------YYSIIPLSANFYLTELALKEYIGIL 234
           A H+ R+   F   G+N   + +++L +      +    P S   Y TE    E +G L
Sbjct: 186 ASHMSRALYEFHQAGLNPIPAPTNFLASNKIKQPWIRYAPSSQFLYQTERYWHEKLGSL 244


>gi|307130843|ref|YP_003882859.1| membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Dickeya dadantii 3937]
 gi|306528372|gb|ADM98302.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Dickeya dadantii 3937]
          Length = 259

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 89/195 (45%), Gaps = 27/195 (13%)

Query: 60  PQWKKD---GNIIVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLYKSCKQHSM 112
           P W  D    N IV+LG G T  P  P     PS      + +R+ E +RL+++     +
Sbjct: 71  PAWTPDFPKVNYIVVLGGGYTFNPDWP-----PSANLINNNLARVTEGIRLWRANPGARL 125

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNM 171
             T   + G+P  +    +     ++ ES GV   DI L  Q+ DT + A  + +++   
Sbjct: 126 IFTGAAAQGNPVTNASTAA-----RVAESLGVPAQDILLVDQARDTEEEAAGTEALVGK- 179

Query: 172 QGKNIILVSSAYHLKRSQLYFQHFGIN------TKASCSDYLNAYYSIIPLSANFYLTEL 225
             +  +LV+SA HL R+  +FQ  G++       + + +  LN +  + P +     +E 
Sbjct: 180 --QPFLLVTSANHLPRAIRFFQARGLHPIPAPANQLAITSPLNPWERVFPSALYLSHSER 237

Query: 226 ALKEYIGILIAYYRG 240
           A  E +G++    +G
Sbjct: 238 AWYEGLGLIWQQMKG 252


>gi|198284290|ref|YP_002220611.1| hypothetical protein Lferr_2201 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|198248811|gb|ACH84404.1| protein of unknown function DUF218 [Acidithiobacillus ferrooxidans
           ATCC 53993]
          Length = 264

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 102/240 (42%), Gaps = 22/240 (9%)

Query: 3   LSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQW 62
           L W+  IV + +L      ++  +     L+ F    I   +LL  L+  Y  PL  P  
Sbjct: 26  LGWLAEIVGWRYL-----GRVLMLLALGTLY-FFSTAIGARLLLLPLEDRYP-PLTKPLH 78

Query: 63  KKD-GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK-QHSMHCTIIISG 120
             D    I++LG G  +       +   S Q  +     +RL  + +        II SG
Sbjct: 79  GADTPQAIIVLGGGEVM-------QSPGSNQETANARTLVRLLAAAQLARQTGLPIIPSG 131

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           G P+    AE++     L +    +  I  ETQS +T  NA  S++++    G    LV+
Sbjct: 132 GAPRLGAPAEALTMEFILRQDLGVQSTIWPETQSYNTAANATDSAAILAEHHGHQAYLVT 191

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDY----LNAYY--SIIPLSANFYLTELALKEYIGIL 234
           SA H+ R+  +F+  G+      +DY    +N     S +P +    ++  A  EY+G+L
Sbjct: 192 SALHMPRAVAWFRRAGVKVVPVPTDYRLDRVNGLRLESWLPRAIYLEISSEASHEYLGLL 251


>gi|228474816|ref|ZP_04059547.1| putative membrane protein [Staphylococcus hominis SK119]
 gi|228271479|gb|EEK12847.1| putative membrane protein [Staphylococcus hominis SK119]
          Length = 318

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 70/142 (49%), Gaps = 21/142 (14%)

Query: 64  KDGNIIVLLGNGT---TIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           K  ++I++LG G    T+ P +            SR+   + +YK     S +C I++SG
Sbjct: 145 KQYDMILILGAGIFNETVTPMLA-----------SRLDRALEIYK---VQSHNCNILVSG 190

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---II 177
           G      ++E++   N L++ GV    I +E+QS  T++N  +S S I N   +N   I+
Sbjct: 191 GQGPDEPISEALAMKNYLIKCGVSSSSILMESQSSSTYENFLYSKSFI-NTSFENVPSIL 249

Query: 178 LVSSAYHLKRSQLYFQHFGINT 199
            V+S +H+ R+  + Q   I  
Sbjct: 250 CVTSQFHILRALRFAQKLNIKV 271


>gi|168209634|ref|ZP_02635259.1| conserved hypothetical protein [Clostridium perfringens B str. ATCC
           3626]
 gi|170712243|gb|EDT24425.1| conserved hypothetical protein [Clostridium perfringens B str. ATCC
           3626]
          Length = 257

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 52/96 (54%), Gaps = 5/96 (5%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           ++   +  I++SGG      + E+      L+E+GV +D I LE ++  T++N  +S  +
Sbjct: 127 EKTGFNGEIVVSGGQGPGESITEAYAMEKYLVENGVPKDKIVLENKATSTYENLNYSKKI 186

Query: 168 IKNMQGK-----NIILVSSAYHLKRSQLYFQHFGIN 198
           I+N+  K     +I++V++ +H  RS L  +  G N
Sbjct: 187 IENLSRKPIKDLDILIVTTDFHAMRSNLLAKRNGYN 222


>gi|152989850|ref|YP_001355572.1| hypothetical protein NIS_0098 [Nitratiruptor sp. SB155-2]
 gi|151421711|dbj|BAF69215.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 233

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 51/91 (56%), Gaps = 7/91 (7%)

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL 207
           I+ E +SL+T+QNA F++   + +  K+I LV+SAYH+ R+   F+HFG +      DY 
Sbjct: 137 IRYEVKSLNTYQNAAFTA---QKLPQKSICLVTSAYHMPRAYKLFRHFGFSITPVSCDYQ 193

Query: 208 N----AYYSIIPLSANFYLTELALKEYIGIL 234
                  + + P       + +A+ EY+G+L
Sbjct: 194 TKDDIKVWDLFPSMEGLKKSYIAIHEYVGLL 224


>gi|70725701|ref|YP_252615.1| hypothetical protein SH0700 [Staphylococcus haemolyticus JCSC1435]
 gi|68446425|dbj|BAE04009.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 318

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 14/133 (10%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           K  ++I++LG G       P +          R+   + +Y+     +  C II+SGG  
Sbjct: 145 KQYDLIMVLGAGIFTEKVTPMLA--------ERLNRALSVYQ---HQTDKCKIIVSGGQG 193

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNIILVSS 181
               ++E++     L++ GV +  I +E+QS +TF+N  +S  +I N+     NI+ V+S
Sbjct: 194 PDEPISEALAMQRYLIQHGVPQSSIIMESQSTNTFENFYYSKKVIHNLYSNSPNILCVTS 253

Query: 182 AYHLKRSQLYFQH 194
            +H+ R  + F H
Sbjct: 254 QFHILRG-MKFAH 265


>gi|314935744|ref|ZP_07843096.1| putative membrane protein [Staphylococcus hominis subsp. hominis
           C80]
 gi|313656309|gb|EFS20049.1| putative membrane protein [Staphylococcus hominis subsp. hominis
           C80]
          Length = 318

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 70/140 (50%), Gaps = 21/140 (15%)

Query: 64  KDGNIIVLLGNGT---TIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           K  ++I++LG G    T+ P +            SR+   + +YK     S +C I++SG
Sbjct: 145 KQYDMILILGAGIFNETVTPMLA-----------SRLDRALEIYK---VQSHNCNILVSG 190

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---II 177
           G      ++E++   N L++ GV    I +E+QS  T++N  +S S I N   +N   I+
Sbjct: 191 GQGPDEPISEALAMKNYLIKCGVSSSSILMESQSSSTYENFLYSKSFI-NTSFENVPSIL 249

Query: 178 LVSSAYHLKRSQLYFQHFGI 197
            V+S +H+ R+  + Q   I
Sbjct: 250 CVTSQFHILRALRFAQKLNI 269


>gi|163840431|ref|YP_001624836.1| hypothetical protein RSal33209_1686 [Renibacterium salmoninarum
           ATCC 33209]
 gi|162953907|gb|ABY23422.1| hypothetical membrane protein [Renibacterium salmoninarum ATCC
           33209]
          Length = 282

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 83/175 (47%), Gaps = 21/175 (12%)

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           ++++  + +V+LG+        P +R        SR+ + + LY+     +    +I SG
Sbjct: 97  RYQRSPDAVVVLGSQIINGKAPPLLR--------SRLDKGLELYREISVGAAPL-LIPSG 147

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG-KNIILV 179
           G        E       L+++G    D+  E ++++T QN QFS+++ +  +   ++++V
Sbjct: 148 GQGVGESRPEGAAMAEYLVDAGAPPHDVVPELRAVNTAQNLQFSAAVAREYERLGSLVVV 207

Query: 180 SSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           ++ YH+ R+ L  +  GIN +   S            +A ++L    L+E++ IL
Sbjct: 208 TNNYHVLRAALLSRKLGINAEVVGSP-----------TAGYFLPSAFLREFVAIL 251


>gi|168822078|ref|ZP_02834078.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|197247984|ref|YP_002145908.1| hypothetical protein SeAg_B0996 [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197211687|gb|ACH49084.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|205341539|gb|EDZ28303.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320085232|emb|CBY95017.1| Uncharacterized protein ycbC [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 258

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 99/223 (44%), Gaps = 26/223 (11%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGAKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASC 203
            R DI    +  DT + A      I +      +LV+SA HL R+ ++FQH G+N   + 
Sbjct: 152 PRSDIITLDKPKDTEEEAVAVKQAIGDAP---FLLVTSASHLPRAMIFFQHAGLNPLPAP 208

Query: 204 SDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 209 ANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|86140156|ref|ZP_01058718.1| hypothetical protein MED193_11777 [Roseobacter sp. MED193]
 gi|85823093|gb|EAQ43306.1| hypothetical protein MED193_11777 [Roseobacter sp. MED193]
          Length = 164

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 64/137 (46%), Gaps = 12/137 (8%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           ++ V+LG         P  R  P+ +   R  +  +L++  +    H  +I  GG  Q H
Sbjct: 2   SVAVVLGAAV-----WPGGRPSPTLRR--RCLQAAKLFR--RGRVSH--VICCGGLGQ-H 49

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLK 186
             +E+ V      E+GV    I LE QS  T +N     +++  +   NI+LV+  YH  
Sbjct: 50  PPSEAEVMRQICREAGVPDSAILLEDQSRTTLENLANIRALLARLDQPNIVLVTDRYHKW 109

Query: 187 RSQLYFQHFGINTKASC 203
           R+ +  +HFG   +ASC
Sbjct: 110 RALMVARHFGFQAQASC 126


>gi|73661853|ref|YP_300634.1| hypothetical protein SSP0544 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|72494368|dbj|BAE17689.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 323

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 14/138 (10%)

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           K D ++I++LG G       P +         SR+   + LY        +   I+SGG 
Sbjct: 143 KPDFDVILVLGAGIFTENVTPMLA--------SRLDRALTLYV----QQPNAKFIVSGGQ 190

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG--KNIILVS 180
                ++E++     L+  GVE + I LE QS  T +N QFS S+I++       I+ V+
Sbjct: 191 GPDEPISEALAMKRYLIHHGVESNHIMLEDQSTSTSENIQFSKSLIESHFECVPKIVCVT 250

Query: 181 SAYHLKRSQLYFQHFGIN 198
           S +H+ R+  + Q F + 
Sbjct: 251 SQFHIMRALRFGQKFNLK 268


>gi|89092000|ref|ZP_01164955.1| hypothetical protein MED92_07531 [Oceanospirillum sp. MED92]
 gi|89083735|gb|EAR62952.1| hypothetical protein MED92_07531 [Oceanospirillum sp. MED92]
          Length = 272

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 99/222 (44%), Gaps = 13/222 (5%)

Query: 23  IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTI 82
           +F + C +LL   +    +    L+ L+  + +P LS   +    IIVL G        +
Sbjct: 39  VFLVWCSVLLTIVVSQYPVANHALEPLESYFSKPNLSSLEQPLAGIIVLGGGEDA---EL 95

Query: 83  PAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLE 140
             I     F S +   E + +  +    +    +I +GG     + G   + V  N L E
Sbjct: 96  SGIHGSNEFNSGA---ERLMVLPALMLRNPKLQVIYTGGSGSIFRPGYRGADVAQNWLSE 152

Query: 141 SGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---IILVSSAYHLKRSQLYFQHFGI 197
            G+    I +E  S +T+QNA ++  +I  +   +    +L++SA+H+ RS   F+  GI
Sbjct: 153 QGLAGRLI-IERDSRNTYQNALYTRELINELGADSQGSWLLITSAFHMPRSVGVFRKAGI 211

Query: 198 NTKASCSDYLNAYYSIIP-LSANFYLTELALKEYIGILIAYY 238
           +      DY  A     P L+ N     LA++E+IG+L  YY
Sbjct: 212 DVVPYPVDYRVAENRWRPSLNRNMADLNLAVREWIGLLAYYY 253


>gi|326390031|ref|ZP_08211593.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993896|gb|EGD52326.1| protein of unknown function DUF218 [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 192

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 83/179 (46%), Gaps = 26/179 (14%)

Query: 31  LLFSFIG------WGIIPTILLKHLQFS-YQRPLLSPQWKKDGNIIVLLGNGTTIIPTIP 83
           LL  FIG        ++ T+  + + F+ Y++P      KK   IIVL   G  +    P
Sbjct: 3   LLLRFIGILIVIFVTVVITLEYQIISFALYEKP------KKSDVIIVL---GCAVYGKTP 53

Query: 84  AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
           +    P F+   R+ E +RLYK          II+SGG      ++E+      LL++G+
Sbjct: 54  S----PFFKE--RLDEALRLYK----EGYGKYIIVSGGKGPGENISEAEAGKEYLLKNGI 103

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
               I  + +S  T++N  FS  ++     K  I++S+ +HLKR+ +  +   IN   S
Sbjct: 104 PEKIILTDDKSFSTYENLLFSKEIMDKNSLKTAIIISNKFHLKRASVIAKRIDINASFS 162


>gi|262404134|ref|ZP_06080689.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. RC586]
 gi|262349166|gb|EEY98304.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. RC586]
          Length = 283

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 91/189 (48%), Gaps = 21/189 (11%)

Query: 27  SCFMLLFS-----FIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            C ++LFS     FI +  I T LL  L+ +Y   L       +G +  +++LGNG  + 
Sbjct: 38  GCLVVLFSLTGIFFISFQPIATRLLMPLERTYTAFL-----PVEGTVDYVMVLGNGHVVD 92

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL 139
             IP    E S  +  R+ E +R+ +      M  +   +GG    H    + V     L
Sbjct: 93  DDIPPTS-ELSRAALMRLAEGIRINRMYPGSKMILSGY-AGGSEVSHARMMARVA----L 146

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
             GV + DI L   + DT++ A+ +++ +   Q K ++LV+SA H+KR+   F+  G+N 
Sbjct: 147 ALGVPKSDIILLETAKDTWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFEAAGLNP 203

Query: 200 KASCSDYLN 208
             + +++L 
Sbjct: 204 IPAPTNFLG 212


>gi|224825882|ref|ZP_03698986.1| protein of unknown function DUF218 [Lutiella nitroferrum 2002]
 gi|224602106|gb|EEG08285.1| protein of unknown function DUF218 [Lutiella nitroferrum 2002]
          Length = 267

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 89/196 (45%), Gaps = 18/196 (9%)

Query: 49  LQFSYQR-PLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSC 107
           L  S +R PL++    ++   IV+LG G    P     R EPS  +  R    +R     
Sbjct: 66  LNRSLERFPLVALSQVRETGAIVVLGGGKKPAPEY--GRNEPSADTLMR----LRYAAYL 119

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSS 166
            +HS    +++SGG P   G AE+ V    L+   GV+   +  E  S  TF NA+ S+ 
Sbjct: 120 ARHSGR-PVLVSGGAPLG-GEAEAPVMARTLVSDYGVQPRWV--EQGSDTTFDNARLSAQ 175

Query: 167 MIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL----NAYYSIIPLSANFYL 222
           ++K    ++I LVS  +HL R+   F+  G+    + +  +          +P       
Sbjct: 176 LLKADGVRSITLVSQGWHLARAVPLFEEQGLKVLPAPTGLVRYDGGGVMWYLPSGRAMQE 235

Query: 223 TELALKEYIGILIAYY 238
           T  AL+E++G L  YY
Sbjct: 236 THAALREWVGRL--YY 249


>gi|168181584|ref|ZP_02616248.1| conserved hypothetical protein [Clostridium botulinum Bf]
 gi|237796355|ref|YP_002863907.1| hypothetical protein CLJ_B3154 [Clostridium botulinum Ba4 str. 657]
 gi|182675224|gb|EDT87185.1| conserved hypothetical protein [Clostridium botulinum Bf]
 gi|229261607|gb|ACQ52640.1| conserved hypothetical protein [Clostridium botulinum Ba4 str. 657]
          Length = 197

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R+ E +RLY           II+SG       ++E+      L++ GV++  I LE +S 
Sbjct: 65  RLDEGLRLY----NEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGVDKKFIILEDKSR 120

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
           +T +N +FS   +++    + I+VS+ YHLKR++L  Q  GI  KAS S
Sbjct: 121 NTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQKEGI--KASYS 167


>gi|300021971|ref|YP_003754582.1| hypothetical protein Hden_0439 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523792|gb|ADJ22261.1| protein of unknown function DUF218 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 264

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 74/157 (47%), Gaps = 11/157 (7%)

Query: 92  QSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAE-SIVYNNKLLESGVERDDIKL 150
           +S  R+ E +R+ +   +      I+ +GG     G  E S      ++++G+  + + +
Sbjct: 105 ESAERLTEAIRIARQRPE----LKIVFTGGVGDLFGGFEASEAIRQYVVDAGIAPERVII 160

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E  S DT++NA  +   +        +LV+SAYH+ R+   F+  G+N      D+    
Sbjct: 161 ENGSRDTYENAVLTLQTLNPAPDDRWLLVTSAYHMPRAVGAFRQAGLNISPFPVDFRTRD 220

Query: 211 YSII---PLS--ANFYLTELALKEYIGILIAYYRGNR 242
              I   P+S  A     +LA++E+IG L+AY    R
Sbjct: 221 AGDILRFPISVAAGLQRADLAVREWIG-LVAYRIAGR 256


>gi|322832243|ref|YP_004212270.1| hypothetical protein Rahaq_1521 [Rahnella sp. Y9602]
 gi|321167444|gb|ADW73143.1| protein of unknown function DUF218 [Rahnella sp. Y9602]
          Length = 259

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 90/196 (45%), Gaps = 32/196 (16%)

Query: 55  RPLLS--PQWKKDGNI----IVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLY 104
           RP+ S  P ++  GN+    +V+LG G T  P        PS      S  R+ E +R+Y
Sbjct: 64  RPIESVYPTYQASGNVPVKYVVVLGGGYTYNPAW-----APSSNLINNSLPRVAEGIRIY 118

Query: 105 KSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQF 163
           ++     M    I +G     + ++ + V   K+ ES GV   DI L  +  DT Q A  
Sbjct: 119 RANPGSKM----IFTGARAMTNPMSSAAVAG-KVAESLGVPESDIILLDRPRDTHQEAL- 172

Query: 164 SSSMIKNMQGKN-IILVSSAYHLKRSQLYFQHFGINTKASCSDY------LNAYYSIIPL 216
               +K M G+   +LV+SA HL R+ ++F+  G+N   + ++       LN +   +P 
Sbjct: 173 ---QVKEMLGEQPFVLVTSANHLPRAIIFFRQLGLNPIPAPANQLAIDSPLNPWEKALPQ 229

Query: 217 SANFYLTELALKEYIG 232
           +     +E A  E +G
Sbjct: 230 ALFLSHSERAWYETLG 245


>gi|167724441|ref|ZP_02407677.1| hypothetical protein BpseD_35807 [Burkholderia pseudomallei DM98]
          Length = 111

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 7/89 (7%)

Query: 22  KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQ-RPLLSPQWKKDGNIIVLLGNGTTIIP 80
           +  F++     F+ IG G++P  LL+ LQ  Y  RP +  +W +  N IV+LG GT  I 
Sbjct: 26  RALFVATVAAFFA-IGCGLVPAWLLRALQAPYAARPAI--EWGER-NAIVMLGLGTEKIA 81

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQ 109
              A+  EP   SYSR+ E   LY+ C++
Sbjct: 82  ATGAV--EPGTFSYSRVVEAASLYRDCRR 108


>gi|148560243|ref|YP_001259097.1| hypothetical protein BOV_1136 [Brucella ovis ATCC 25840]
 gi|148371500|gb|ABQ61479.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 268

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 72/156 (46%), Gaps = 11/156 (7%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKL 150
           +  RI ETMRL +          I++SGG+    +    E+      LL+ G   +    
Sbjct: 109 AADRIVETMRLARLYPD----AKILVSGGEGTFFEKSAREAETTRALLLDLGFSGNRYIF 164

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
           E +  +T +NA FS ++ +   G+  +LV+SAYH+ R+   F+  G +  A   DY    
Sbjct: 165 EGKLRNTVENAIFSQALAQPKPGETWLLVTSAYHMPRAVGCFRKAGFDVTAWPVDYKTRT 224

Query: 211 YSIIPL---SANFYLTE--LALKEYIGILIAYYRGN 241
                L   S N  L+   +AL+E+ G+   ++ G 
Sbjct: 225 RETFGLYLESPNDALSRFSMALREWTGLAAYWWTGR 260


>gi|194443111|ref|YP_002040188.1| hypothetical protein SNSL254_A1023 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194401774|gb|ACF61996.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
          Length = 258

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 102/224 (45%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  +GW  +  + L+ +     RP+ +  P W+    +  IV+LG G T  P     + 
Sbjct: 41  VFISVGWLALLLLSLQPVSDHLLRPIENRYPTWQGPQKVEYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL+++    +    +I +GG  + + ++ +          GV
Sbjct: 96  APSSNLINNSLPRLAEGIRLWRA----NPGAKLIFTGGVAKTNTVSTAEAGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R DI     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQH G+N   +
Sbjct: 152 PRSDII----TLDKPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQHAGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++ A  E +G L  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRAGYETLGRLWQWLKG 251


>gi|255527086|ref|ZP_05393975.1| protein of unknown function DUF218 [Clostridium carboxidivorans P7]
 gi|296188150|ref|ZP_06856542.1| hypothetical protein CLCAR_3670 [Clostridium carboxidivorans P7]
 gi|255509238|gb|EET85589.1| protein of unknown function DUF218 [Clostridium carboxidivorans P7]
 gi|296047276|gb|EFG86718.1| hypothetical protein CLCAR_3670 [Clostridium carboxidivorans P7]
          Length = 197

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 58/134 (43%), Gaps = 11/134 (8%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R  E +RL+K          II+SGG  Q   ++E+      L+  GV+   I LE +S 
Sbjct: 60  RTDEGLRLFK----EGYGKYIIVSGGKGQGESISEAEAMKRYLVSKGVDSSKIILEDKSA 115

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASC-------SDYLN 208
            T  N   S S+++    K  I+VS+ YHLKR+ L     GI    S        +D   
Sbjct: 116 STMANLINSKSIMEKKNFKTAIIVSNKYHLKRASLMATQEGIKASYSGVFVKPYKTDEFV 175

Query: 209 AYYSIIPLSANFYL 222
            Y   +P    +Y 
Sbjct: 176 GYLREVPALMKYYF 189


>gi|118591094|ref|ZP_01548493.1| hypothetical protein SIAM614_15747 [Stappia aggregata IAM 12614]
 gi|118436170|gb|EAV42812.1| hypothetical protein SIAM614_15747 [Stappia aggregata IAM 12614]
          Length = 265

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 93/209 (44%), Gaps = 29/209 (13%)

Query: 38  WGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQ-SYSR 96
           W I+P      L+  +QRP     +  DG  I++LG     + T   +R + +   S  R
Sbjct: 61  WLIVP------LEDRFQRPATLENY--DG--IIILGGAVDTVVT--GVRGDTALTMSAER 108

Query: 97  IFETMRLYKSCKQ----HSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLET 152
           +  T RL K+       H+    +I+S    +  G A          + G+  + I LE 
Sbjct: 109 VTITARLAKALPAAKIIHTGGQGMIVSSQATEAEGAAR------LFRDFGIAPERIILED 162

Query: 153 QSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG-INTKASCSDYL---- 207
           QS +T+QNA ++  +++   G+  +LV+SAYH+ RS   F+  G     A   D+     
Sbjct: 163 QSQNTWQNAVYAKKIVQPQPGQRWLLVTSAYHMPRSMGVFEKAGWTGVTAYPVDFRTRGP 222

Query: 208 -NAYYSIIPLSANFYLTELALKEYIGILI 235
            ++       S      ++A +E++G+ +
Sbjct: 223 QDSMLGFDGASKGLRRFDIAFREWVGLAV 251


>gi|168205486|ref|ZP_02631491.1| conserved hypothetical protein [Clostridium perfringens E str.
           JGS1987]
 gi|170663020|gb|EDT15703.1| conserved hypothetical protein [Clostridium perfringens E str.
           JGS1987]
          Length = 257

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 52/94 (55%), Gaps = 5/94 (5%)

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
           ++   +  I++SGG      + E+      L+E+GV +D I LE ++  T++N  +S  +
Sbjct: 127 EKTGFNGEIVVSGGQGPGESITEAYAMEKYLVENGVPKDKIVLENKATSTYENLNYSKKI 186

Query: 168 IKNMQGK-----NIILVSSAYHLKRSQLYFQHFG 196
           I+++ GK     +I++V++ +H  RS L  +  G
Sbjct: 187 IESLSGKPIKDLDILVVTTDFHAMRSNLLAKRNG 220


>gi|311747747|ref|ZP_07721532.1| membrane protein [Algoriphagus sp. PR1]
 gi|126575735|gb|EAZ80045.1| membrane protein [Algoriphagus sp. PR1]
          Length = 256

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 68/122 (55%), Gaps = 19/122 (15%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGG------DPQKHGLAESIVYNNKLLESGVERDDI 148
            RI   ++LY+  K       I+I+GG      +PQ    +E+ +    L+ +GV  +D+
Sbjct: 102 DRITHALQLYRMGKIKK----ILITGGQGLNPVNPQ----SEAELLQRFLIMTGVPPEDV 153

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNI----ILVSSAYHLKRSQLYFQHFGINTKASCS 204
            +E ++ +T QNAQF+ + ++  +G NI    +L++SA+H+ RS+  F   G+ T+   +
Sbjct: 154 MIEDKAKNTAQNAQFTKTFLEE-KGINIDQEFLLITSAFHMYRSKGCFDKVGLKTETFPT 212

Query: 205 DY 206
           DY
Sbjct: 213 DY 214


>gi|332662639|ref|YP_004445427.1| hypothetical protein Halhy_0646 [Haliscomenobacter hydrossis DSM
           1100]
 gi|332331453|gb|AEE48554.1| protein of unknown function DUF218 [Haliscomenobacter hydrossis DSM
           1100]
          Length = 251

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 69/117 (58%), Gaps = 7/117 (5%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKL 150
           S +R+ +T+ LY+  K  +    I+++GG       G  E+ V  + + + G+ R  + +
Sbjct: 99  SVNRLTQTLELYQQGKIRN----ILLTGGSSNIITKGQLEAQVVVDFIEDMGIPRTAVIV 154

Query: 151 ETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
           E+Q+ +T++NA  S+ +I+    K + +L++SA H++R++  F+  G++ +  C+DY
Sbjct: 155 ESQARNTWENALNSTQIIQAKYPKASCVLITSATHMRRARACFRKAGLDIEYYCTDY 211


>gi|116249878|ref|YP_765716.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254526|emb|CAK05600.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 262

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 92/208 (44%), Gaps = 20/208 (9%)

Query: 44  ILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRL 103
           +L++ L+  + +P   P   +    +++LG G           IE +     R  E +RL
Sbjct: 59  LLMQGLEQRFAKPAADPDSLQ---CMIVLGGGFENEVNTARHGIEFN-GGADRFIEALRL 114

Query: 104 YKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES--GVERDDIKLETQSLDTFQNA 161
            +   Q      I++SGGD    G+ E     ++      GV RD +  E QS  TF+NA
Sbjct: 115 AQKFPQSR----ILVSGGDGSISGIYEGDAAASERFFPLFGVGRDRLIEERQSRTTFENA 170

Query: 162 QFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-------LNAYYSII 214
             +   + +    N +L++S +H+ RS   F+  GI+     +DY       L   ++  
Sbjct: 171 VNTKEFLASQGLSNCLLITSGFHMPRSVGIFRKLGIDIVPWPTDYRTDGQVRLGLDFTQP 230

Query: 215 PLSANFYLTELALKEYIGILIAYYRGNR 242
            L+A    T  A++E+ G L+ YY   R
Sbjct: 231 SLNAQNLAT--AIREWYG-LVGYYLAGR 255


>gi|258627463|ref|ZP_05722244.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258580269|gb|EEW05237.1| conserved hypothetical protein [Vibrio mimicus VM603]
          Length = 287

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 89/189 (47%), Gaps = 21/189 (11%)

Query: 27  SCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            C ++LFSF G     +  + T LL  L+ +Y   L       +G +  I++LGNG  + 
Sbjct: 47  GCLVVLFSFTGLFLVSFQPVATRLLMPLERTYTAFL-----PVEGTVDYIMVLGNGHVVD 101

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL 139
             IP    E S  +  R+ E +R+ +      M  +    G +      + + +     L
Sbjct: 102 DDIPPTS-ELSRAALMRLTEGIRISRMYPGSKMILSGYAGGSE-----FSHARMMARVAL 155

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
             GV + DI L   + DT++ A+ +++ +   Q K ++LV+SA H+KR+   F+  G+  
Sbjct: 156 ALGVPKSDIILLETAKDTWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFESAGLTP 212

Query: 200 KASCSDYLN 208
             + ++YL 
Sbjct: 213 IPAPTNYLG 221


>gi|150398639|ref|YP_001329106.1| hypothetical protein Smed_3453 [Sinorhizobium medicae WSM419]
 gi|150030154|gb|ABR62271.1| protein of unknown function DUF218 [Sinorhizobium medicae WSM419]
          Length = 262

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 98/218 (44%), Gaps = 23/218 (10%)

Query: 29  FMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGN-GTTIIPTIPAIRI 87
           F+ LF+  G     +  L+ L+  + RP  SP+  +   +IVL G     ++ +   I +
Sbjct: 49  FITLFTTAG-----SYFLQILEDRFPRP--SPEPAELACMIVLGGAFENVVMASRGGIEM 101

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES--GVER 145
               Q+  R  ET+RL    + H     I++SGGD    G+ E   + +       G+  
Sbjct: 102 N---QAAERFVETLRL---ARAHP-GARILVSGGDGSLSGIYEGDAHASAAFFGTFGIGP 154

Query: 146 DDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           + +  E +S  TF+NA+ +  +++        LV+SAYH+ RS   F+   I       D
Sbjct: 155 ERLIREGESRTTFENARNTRHLLRENGLDRCALVTSAYHMPRSVGLFRANDIEVTPWPVD 214

Query: 206 YLNAYYSIIPL-----SANFYLTELALKEYIGILIAYY 238
           Y  +    + +     S N  L   A KE+ G L+AYY
Sbjct: 215 YRTSGKVRLGVDFTQPSLNAQLATTAAKEWTG-LLAYY 251


>gi|77465405|ref|YP_354908.1| hypothetical protein RSP_3403 [Rhodobacter sphaeroides 2.4.1]
 gi|77389823|gb|ABA81007.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 280

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 66/128 (51%), Gaps = 6/128 (4%)

Query: 113 HCTIIISGGDPQKHG--LAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
              ++ +GG  +  G  + E+ +    L+ +GV+   + LE QS +T +NA+F+ +++ N
Sbjct: 136 EARVLFTGGSGRLFGAEIPEARIAREILVSAGVDPARLILEGQSRNTAENARFAKALVAN 195

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKAS-CSDYLNAYYSI---IPLSANFYLTELA 226
               + +LV+SA+H+ R+   F   G        +DY  A         L+ N  L  +A
Sbjct: 196 QGQGSWLLVTSAFHMPRAVETFCAAGWQDLVPWPTDYRTASLRDGIGWDLARNLDLLNVA 255

Query: 227 LKEYIGIL 234
           ++E+IGIL
Sbjct: 256 VREWIGIL 263


>gi|317506557|ref|ZP_07964352.1| DUF218 domain-containing protein [Segniliparus rugosus ATCC
           BAA-974]
 gi|316255154|gb|EFV14429.1| DUF218 domain-containing protein [Segniliparus rugosus ATCC
           BAA-974]
          Length = 330

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 67/125 (53%), Gaps = 12/125 (9%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           IV LG G     T+P + ++       R+ +T+ +     Q      I+++GG PQ +G+
Sbjct: 169 IVALGAGLHPDGTMPQVLVD-------RLRKTLEV----AQADPAAPIVVTGGKPQ-NGV 216

Query: 129 AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS 188
            E+    + L+  GV+   I  E  S  T QNA  S+ ++++++  ++++V+SA H++R+
Sbjct: 217 TEADAMADWLVGQGVDPGRIHKEDHSASTVQNALNSAEILRSLRPAHLVIVTSANHVRRA 276

Query: 189 QLYFQ 193
              F+
Sbjct: 277 SALFE 281


>gi|148270249|ref|YP_001244709.1| hypothetical protein Tpet_1119 [Thermotoga petrophila RKU-1]
 gi|281412552|ref|YP_003346631.1| protein of unknown function DUF218 [Thermotoga naphthophila RKU-10]
 gi|147735793|gb|ABQ47133.1| protein of unknown function DUF218 [Thermotoga petrophila RKU-1]
 gi|281373655|gb|ADA67217.1| protein of unknown function DUF218 [Thermotoga naphthophila RKU-10]
          Length = 237

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 95/197 (48%), Gaps = 25/197 (12%)

Query: 51  FSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQH 110
           +S ++ L  P    +  +IV+LG G   +          S  +  R+   +++Y+  K  
Sbjct: 56  WSLEKNLDVPATLPNDAVIVVLGGG---VERNTKAGDNLSDATLRRLLTGVQIYQKTK-- 110

Query: 111 SMHCTIIISGGDPQKHGL-AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK 169
                I+++GG     GL  E+++  + L+  GV  + I +E +S +T++NA F+   I 
Sbjct: 111 ---MPILVTGG--SLTGLRPEAMIMKDYLVSLGVPEEKITVEDRSRNTYENAFFTREKIG 165

Query: 170 NMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYY-------SIIPLSANFYL 222
           ++    IILV+ + H++R+   F+ F      S + Y   +Y         +P + +FYL
Sbjct: 166 DVP---IILVTDSIHMRRAVSTFKSF----FQSVTPYPAGFYFGDPEFVDFLPNATSFYL 218

Query: 223 TELALKEYIGILIAYYR 239
              A+ E+IG++   +R
Sbjct: 219 NSRAIYEWIGLVWYNFR 235


>gi|237798424|ref|ZP_04586885.1| hypothetical protein POR16_06246 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021276|gb|EGI01333.1| hypothetical protein POR16_06246 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 256

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 106/244 (43%), Gaps = 29/244 (11%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTIL-LKHLQFSYQRPLLSPQWK- 63
           + LI ++W    +  R     +CF++    +    +P ++     Q     PL   QW  
Sbjct: 19  LLLIAAWW---LRRSRPRLAAACFIVGLGGLWLMSLPVVVEFSARQLERTTPLPRQQWPI 75

Query: 64  --KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI---FETMRLYKSCKQHSMHCTIII 118
             +  + IV+LGNG          R  P++ + +      E +RL     + S    I+ 
Sbjct: 76  LAQQADAIVVLGNGRE--------RNSPTWGADTPTGLGLERLRLAARLAKES-GLPIMT 126

Query: 119 SGGDPQKHGLAESIVYNNKLLES-GVERDDIKL-ETQSLDTFQNAQFSSSMIKNMQGKNI 176
           +GG       +E+ +    L E  GV    ++  E QS  T++NA  ++ +++ +  + +
Sbjct: 127 AGGLHFDQPPSEASIMAQSLQEDFGV---TVRWQEGQSRTTWENATMAARVLQPLGIRRV 183

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYLN-----AYYSIIPLSANFYLTELALKEYI 231
           +LV+ A+H+ R++  F+  G    ++   +L       +   +P S  F  + + L E  
Sbjct: 184 VLVTQAWHMPRARWSFEQAGFTVVSAPVGFLGVDNARPFGGWLPESRVFTQSGVLLNEAA 243

Query: 232 GILI 235
           G+L+
Sbjct: 244 GLLV 247


>gi|144899829|emb|CAM76693.1| Protein of unknown function DUF218 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 261

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 91/216 (42%), Gaps = 24/216 (11%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSF 91
           + +F+ W     IL++ L+  +  P   PQ + DG I++    G  + P + A R +   
Sbjct: 50  IVAFVPW---QAILVQPLENRFPGPSSLPQ-RVDGVIVL----GGALDPVVSAARDQ--- 98

Query: 92  QSYSRIFETMRLYKSCKQHSMHCTIIISGGD-----PQKHGLAESIVYNNKLLESGVERD 146
            + +   E +       +H     ++ SGG      P K    E+ V    L E G   D
Sbjct: 99  VAANGAVERVNALIWLGRHYPKARLVFSGGSGSVTTPDKK---EAPVARRYLNELGFGTD 155

Query: 147 DIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
            I  E QS +T +NA ++  ++    G+  +LV+SA H+ RS   F        A   DY
Sbjct: 156 GIVFEDQSRNTRENAVYTKQLMAPKNGEVWLLVTSAMHMPRSMGAFAAVDWPVIAYPVDY 215

Query: 207 LNAYYS---IIPLSANFYLTELALKEYIGILIAYYR 239
           L           L + F      L E++G+L  YYR
Sbjct: 216 LTTGEGGGFAFDLGSAFSSIGNGLHEWLGLL--YYR 249


>gi|91228201|ref|ZP_01262183.1| hypothetical protein V12G01_20638 [Vibrio alginolyticus 12G01]
 gi|91188190|gb|EAS74491.1| hypothetical protein V12G01_20638 [Vibrio alginolyticus 12G01]
          Length = 261

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 105/222 (47%), Gaps = 35/222 (15%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           CF++LFSF+G     +  + T LL  L+  ++  L        G I  +++LGNG  I  
Sbjct: 39  CFVVLFSFVGIFLVAFQPVSTKLLMPLEREHKAFL-----PVSGTIDYVMVLGNGHVIDD 93

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISG--GDPQKHGLAESIVYNN 136
            IP     P+ Q  SR    MRL +  +   M+    +I+SG  G  +   ++ + +  N
Sbjct: 94  EIP-----PTSQ-LSRA-ALMRLTEGIRILRMYPGAKLILSGYAGGSE---ISHARMMAN 143

Query: 137 KLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG 196
             L  GV + DI L   + DT++ A+ +++ +   Q K I+LV+SA H+ R+   F   G
Sbjct: 144 VALALGVAKSDIILLEDAKDTWEEARQAAAFV---QQKEIVLVTSASHMSRALYEFNAAG 200

Query: 197 INTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIG 232
           I    + +++L        +    P +     TEL   EY+G
Sbjct: 201 IKPIPAPTNFLAIREISQPWDKYSPKARYLEQTELYWHEYLG 242


>gi|332561062|ref|ZP_08415380.1| hypothetical protein RSWS8N_18489 [Rhodobacter sphaeroides WS8N]
 gi|332274860|gb|EGJ20176.1| hypothetical protein RSWS8N_18489 [Rhodobacter sphaeroides WS8N]
          Length = 267

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 66/128 (51%), Gaps = 6/128 (4%)

Query: 113 HCTIIISGGDPQKHG--LAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
              ++ +GG  +  G  + E+ +    L+ +GV+   + LE QS +T +NA+F+ +++ N
Sbjct: 123 EARVLFTGGSGRLFGAEIPEARIAREILVSAGVDPARLILEGQSRNTAENARFAKALVAN 182

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASC-SDYLNAYYSI---IPLSANFYLTELA 226
               + +LV+SA+H+ R+   F   G        +DY  A         L+ N  L  +A
Sbjct: 183 QGQGSWLLVTSAFHMPRAVETFCAAGWQDLVPWPTDYRTASLRDGIGWDLARNLDLLNVA 242

Query: 227 LKEYIGIL 234
           ++E+IGIL
Sbjct: 243 VREWIGIL 250


>gi|253730030|ref|ZP_04864195.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253726243|gb|EES94972.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
          Length = 171

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 73/145 (50%), Gaps = 16/145 (11%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           +R+   + +Y+   Q +    II+SGG      ++E++     L+  GV++ DI +E+ S
Sbjct: 17  ARLDRALDIYQ---QQASATKIIVSGGQGPDEPISEALAMQRYLIAHGVDKTDILMESHS 73

Query: 155 LDTFQNAQFSSSMIKNM--QGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYS 212
           ++T+ N  +S  +I N+  +   I+ V+S +H+ R+    Q  G++     S        
Sbjct: 74  INTYTNFLYSKQIINNLYHEAVKIVCVTSQFHVLRALRLAQKLGLSIDGVGSH------- 126

Query: 213 IIPLSANFYLTELALKEYIGILIAY 237
                 +F+L  L +K+Y+G++  Y
Sbjct: 127 ---TPYHFFLHVL-IKDYLGVMYQY 147


>gi|254228980|ref|ZP_04922401.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262394709|ref|YP_003286563.1| membrane protein [Vibrio sp. Ex25]
 gi|151938448|gb|EDN57285.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262338303|gb|ACY52098.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. Ex25]
          Length = 261

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 105/222 (47%), Gaps = 35/222 (15%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           CF++LFSF+G     +  + T LL  L+  ++  L        G I  +++LGNG  I  
Sbjct: 39  CFVVLFSFVGIFLVAFQPVSTKLLMPLEREHKAFL-----PVSGTIDYVMVLGNGHVIDD 93

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISG--GDPQKHGLAESIVYNN 136
            IP     P+ Q  SR    MRL +  +   M+    +I+SG  G  +   ++ + +  N
Sbjct: 94  EIP-----PTSQ-LSRA-ALMRLTEGIRILRMYPGAKLILSGYAGGSE---ISHARMMAN 143

Query: 137 KLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG 196
             L  GV + DI L   + DT++ A+ +++ +   Q K I+LV+SA H+ R+   F   G
Sbjct: 144 VALALGVAKSDIILLEDAKDTWEEARQAAAFV---QQKEIVLVTSASHMSRALYEFNAAG 200

Query: 197 INTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIG 232
           I    + +++L        +    P +     TEL   EY+G
Sbjct: 201 IKPIPAPTNFLAISEISQPWDKYSPKARYLEQTELYWHEYLG 242


>gi|251789903|ref|YP_003004624.1| hypothetical protein Dd1591_2303 [Dickeya zeae Ech1591]
 gi|247538524|gb|ACT07145.1| protein of unknown function DUF218 [Dickeya zeae Ech1591]
          Length = 258

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 94/196 (47%), Gaps = 25/196 (12%)

Query: 56  PLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLYKSCKQHS 111
           P  +P++ K  N IV+LG G T  P  P     PS      S +R+ E +RL+++    +
Sbjct: 71  PTWTPEFPKV-NYIVVLGGGYTFNPDWP-----PSANLINNSLARVTEGIRLWRA----N 120

Query: 112 MHCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKN 170
               +I +G   + + +  S   + ++ ES GV   DI L  Q+ DT + A  + ++I  
Sbjct: 121 PGAKLIFTGAAARSNPVT-SASTSARVAESLGVPAQDILLVDQARDTEEEAAGTEALIGK 179

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGIN------TKASCSDYLNAYYSIIPLSANFYLTE 224
              +  +LV+SA HL R+  +FQ  G++       + + +  LN +  + P +     +E
Sbjct: 180 ---QPFLLVTSASHLPRAIRFFQARGLHPIPAPANQLAMTSPLNPWERVFPSALYLSHSE 236

Query: 225 LALKEYIGILIAYYRG 240
            A  E +G++    +G
Sbjct: 237 RAWYEGLGLIWQQMKG 252


>gi|292558336|gb|ADE31337.1| hypothetical protein SSGZ1_0880 [Streptococcus suis GZ1]
          Length = 336

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 90/200 (45%), Gaps = 22/200 (11%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG 75
           + QS+  I   S F ++F ++G+ +  TI++  L        L   +    + +V+LG G
Sbjct: 118 VVQSLSAI---SFFNMVFVYVGFFVSYTIIISMLYTMSSFVNLVNFFPGKLDYVVVLGAG 174

Query: 76  TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYN 135
                  P +         SRI + + +Y    Q      +I+SGG      +AE     
Sbjct: 175 LIGDKVTPLLA--------SRIEKGIAIY----QKQPGSKLIMSGGQGPDELIAEGQAMA 222

Query: 136 NKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS-----QL 190
           N  LE GV  +DI +E QS +T +N +FS +++K   G    LV++ YH+ R+     QL
Sbjct: 223 NYALEKGVPAEDILIENQSTNTEENLKFSYALMK--PGSRFALVTNYYHVFRALLLARQL 280

Query: 191 YFQHFGINTKASCSDYLNAY 210
             +  G   K      LNA+
Sbjct: 281 RIKCIGYGAKTKFYFSLNAF 300


>gi|170755560|ref|YP_001782537.1| hypothetical protein CLD_1642 [Clostridium botulinum B1 str. Okra]
 gi|169120772|gb|ACA44608.1| conserved hypothetical protein [Clostridium botulinum B1 str. Okra]
          Length = 197

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R+ E +RLY           II+SG       ++E+      L++ G+++  I LE +S 
Sbjct: 65  RLDEGLRLY----NEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSR 120

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
           +T +N +FS   +++    + I+VS+ YHLKRS+L  Q  GI  KAS S
Sbjct: 121 NTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRSELLCQKEGI--KASYS 167


>gi|188589627|ref|YP_001922120.1| integral membrane protein [Clostridium botulinum E3 str. Alaska
           E43]
 gi|188499908|gb|ACD53044.1| integral membrane protein [Clostridium botulinum E3 str. Alaska
           E43]
          Length = 348

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 80/175 (45%), Gaps = 21/175 (12%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           + I++LG+G      +   R+ P   S  RI + +  Y      +    II SGG     
Sbjct: 165 DFIIVLGSG------LIGERVPPLLAS--RIDKAIEFYNKQSTVTNPPKIIFSGGQGSDE 216

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNIILVSSAYH 184
            ++E++       + G+  +D  LE +S++T QN  FS  ++ N+       I V++ +H
Sbjct: 217 KISEALAMQRYATQKGIPIEDTILEDKSVNTLQNMIFSKKIMDNLIPNTHASIFVTNNFH 276

Query: 185 LKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           L R+ ++ +  G+ ++   S            +A ++L    ++EYI  ++ Y +
Sbjct: 277 LFRAGIFARKAGLKSQGIGSK-----------TAFYFLPNAMIREYIAFVVMYKK 320


>gi|188588528|ref|YP_001921214.1| GdmH [Clostridium botulinum E3 str. Alaska E43]
 gi|188498809|gb|ACD51945.1| conserved hypothetical protein [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 253

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 5/88 (5%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           II+SGG      ++E++     LLE G+  D I +E QS +TF+N ++S  +I+    KN
Sbjct: 133 IIVSGGKGNDERISEAMAMKKYLLEQGISEDKILMEDQSKNTFENFKYSKKLIEEQSNKN 192

Query: 176 II-----LVSSAYHLKRSQLYFQHFGIN 198
           I      +V++ +H  RS++  +  G N
Sbjct: 193 IDDLSVKIVTTDFHGFRSKMLAKRNGYN 220


>gi|269967671|ref|ZP_06181721.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269827758|gb|EEZ82042.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 261

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 105/222 (47%), Gaps = 35/222 (15%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           CF++LFSF+G     +  + T LL  L+  ++  L        G I  +++LGNG  I  
Sbjct: 39  CFVVLFSFVGIFLVAFQPVSTKLLMPLEREHKAFL-----PVSGTIDYVMVLGNGHVIDD 93

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISG--GDPQKHGLAESIVYNN 136
            IP     P+ Q  SR    MRL +  +   M+    +I+SG  G  +   ++ + +  N
Sbjct: 94  EIP-----PTSQ-LSRA-ALMRLTEGIRILRMYPGAKLILSGYAGGSE---ISHARMMAN 143

Query: 137 KLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG 196
             L  GV + DI L   + DT++ A+ +++ +   Q K I+LV+SA H+ R+   F   G
Sbjct: 144 VALALGVAKSDIILLEDAKDTWEEARQAAAFV---QQKEIVLVTSASHMSRALYEFNAAG 200

Query: 197 INTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIG 232
           I    + +++L        +    P +     TEL   EY+G
Sbjct: 201 IKPIPAPTNFLAISEISQPWDKYSPKARYLEQTELYWHEYLG 242


>gi|124007832|ref|ZP_01692534.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
 gi|123986778|gb|EAY26559.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
          Length = 256

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 114/247 (46%), Gaps = 23/247 (9%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKI--FFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLL 58
           M ++W+ L+ + W LL +  R+      +   LL+ F    I+   LL  L  +   PL 
Sbjct: 14  MPVTWLCLVFT-WALLTKKPRRRRQLLRTGVFLLWLFTNPFIVNQALL--LWEAPPTPLH 70

Query: 59  SPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
           S +   D  I++    G T     P  R+    +   RI + + LY+  K       I+I
Sbjct: 71  SIRQNYDVGIVL---TGVTNTDKKPHDRVYLD-KGGDRITQALMLYRVGKIKK----ILI 122

Query: 119 SGG--DP-QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI-KNMQGK 174
           SGG  DP Q+   AE+ +    LL++ V   DI +ET++ +T +NA  ++ ++ K    +
Sbjct: 123 SGGSFDPKQRLERAEAYLLKQVLLQAKVPSHDIIIETKARNTRENALNTAKILNKQFPRQ 182

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDY------LNAYYSIIPLSANFYLTELALK 228
           + +L++SA+H++R+   F+  GI       D+          +S+ P     Y   +   
Sbjct: 183 SYLLITSAFHIRRAVGCFRQAGIRVTPFSVDFYTIDKGFTFPFSLFPAEKALYKWYVLSH 242

Query: 229 EYIGILI 235
           E IG ++
Sbjct: 243 EVIGYIV 249


>gi|302333991|gb|ADL24184.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           JKD6159]
          Length = 171

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 72/145 (49%), Gaps = 16/145 (11%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           +R+   + +Y+   Q +    II+SGG      + E++     L+  GV++ DI +E+ S
Sbjct: 17  ARLDRALDIYQ---QQASATKIIVSGGQGPDEPIPEALAMQRYLIAHGVDKTDILMESHS 73

Query: 155 LDTFQNAQFSSSMIKNM--QGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYS 212
           ++T+ N  +S  +I N+  +   I+ V+S +H+ R+    Q  G++     S        
Sbjct: 74  INTYTNFLYSKQIINNLYHEAVKIVCVTSQFHVLRALRLAQKLGLSIDGVGSH------- 126

Query: 213 IIPLSANFYLTELALKEYIGILIAY 237
                 +F+L  L +K+Y+G++  Y
Sbjct: 127 ---TPYHFFLHVL-IKDYLGVMYQY 147


>gi|237711018|ref|ZP_04541499.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|265750614|ref|ZP_06086677.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|229454862|gb|EEO60583.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263237510|gb|EEZ22960.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 252

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 8/126 (6%)

Query: 86  RIEPSFQSYS-RIFETMRLYKSCKQHSM----HCTIIISGGDPQKHGLAESIVYNNKLLE 140
           R  P F   + R+ E +RLYK  +   +      +II S       G A  +     L +
Sbjct: 86  RSRPEFSEIADRLLEGIRLYKHGRIRKLVLASDGSIIESKDGKGLQGNAADM--KQYLAD 143

Query: 141 SGVERDDIKLETQSLDTFQNAQFSSSMIKN-MQGKNIILVSSAYHLKRSQLYFQHFGINT 199
            G+  +D+ LET++ +T++NA F+  +I N M+ ++ +L++SA H++RS   F   G+N 
Sbjct: 144 LGMPLEDVILETRANNTWENATFTLELIGNSMKTESTLLITSATHMRRSLWTFHAAGLNP 203

Query: 200 KASCSD 205
               +D
Sbjct: 204 DTYITD 209


>gi|259503279|ref|ZP_05746181.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|259168734|gb|EEW53229.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
          Length = 278

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 70/140 (50%), Gaps = 19/140 (13%)

Query: 102 RLYKSCK--QHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQ 159
           RL ++ +  Q     TI++SGG      + E+      LLE G+  + +  E+Q+ +T+Q
Sbjct: 130 RLTRAAQFWQRQPTVTIVVSGGRVHGDQVTEAAAMAAFLLECGLPPEKLLQESQARNTWQ 189

Query: 160 NAQFSSSMI-KNMQGKN---IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIP 215
           N  +S  +I ++  G     +++V+S++H+ R+ +Y            S  L   Y  +P
Sbjct: 190 NLAYSQRLITQHWSGTGQPRVVVVTSSFHVPRAWIY------------SRQLGQRYQFLP 237

Query: 216 LSANFYLTELAL-KEYIGIL 234
               ++   LAL ++Y+GIL
Sbjct: 238 APTPWHYLPLALVRDYLGIL 257


>gi|310826960|ref|YP_003959317.1| hypothetical protein ELI_1368 [Eubacterium limosum KIST612]
 gi|308738694|gb|ADO36354.1| hypothetical protein ELI_1368 [Eubacterium limosum KIST612]
          Length = 346

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 62/131 (47%), Gaps = 12/131 (9%)

Query: 105 KSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS 164
           K  +        ++SGG      ++E++V  + LL  G  + DI +E  S +T +N  FS
Sbjct: 196 KQMEMTGKKAKFVVSGGKGMDESVSEALVMKDYLLSKGYHKSDILVEEHSRNTRENMLFS 255

Query: 165 SSMIKNMQ-GKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLT 223
            ++I  ++     I V+S++H+ R+ LY +   ++     +            +A +Y  
Sbjct: 256 KAIIDRLKPNARGIFVTSSFHVLRASLYARDAELDFTGVPAK-----------TAFYYFP 304

Query: 224 ELALKEYIGIL 234
              L+E+IG+L
Sbjct: 305 NAFLREFIGVL 315


>gi|310829787|ref|YP_003962144.1| integral membrane protein [Eubacterium limosum KIST612]
 gi|308741521|gb|ADO39181.1| integral membrane protein [Eubacterium limosum KIST612]
          Length = 403

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 83/188 (44%), Gaps = 35/188 (18%)

Query: 55  RPLLSPQWKKDGNIIVL---LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHS 111
           RP+L   +     IIVL   L  G  + P +   RI+ + + Y R        ++ K+ S
Sbjct: 208 RPVLRQDY-----IIVLGSGLMGGNKVTPLLAG-RIDRALKVYRR--------QADKKKS 253

Query: 112 MHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK-- 169
               +I+SGG      +AE        LE G+  D I +E QS +T++N  FS  +I+  
Sbjct: 254 -PPMLIMSGGQGGDEQIAEGEAMKQYALEQGIPEDHILVEDQSKNTYENMLFSRQLIESR 312

Query: 170 --NMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYL-TELA 226
             +M+   I+  +S YH+ R+ +Y +  G+  +             I     FY      
Sbjct: 313 EADMKHLRILFSTSNYHVFRAGIYARKAGLKAQG------------IGAKTKFYFWYNAL 360

Query: 227 LKEYIGIL 234
           L+EY+ IL
Sbjct: 361 LREYVAIL 368


>gi|114048174|ref|YP_738724.1| hypothetical protein Shewmr7_2682 [Shewanella sp. MR-7]
 gi|113889616|gb|ABI43667.1| protein of unknown function DUF218 [Shewanella sp. MR-7]
          Length = 244

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 83/173 (47%), Gaps = 19/173 (10%)

Query: 68  IIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSM--HCTIIISG--GDP 123
           ++++LG+G   IP   A+      QS S +  T RL +  +Q  +   CT+++SG  G+ 
Sbjct: 78  VVMVLGSGHADIPGATAV------QSLSTVALT-RLTEGLRQLQLGQDCTLVVSGWEGEL 130

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
            +H  AE  V     +E GV+   I       DT + A +      N   + + LV+SA 
Sbjct: 131 TQHPHAE--VMAKAAIELGVDASRIVQLPLPRDTIEEAHYFKEHFGN---QAVRLVTSAS 185

Query: 184 HLKRSQLYFQHFGINTKASCSDY--LNAYYSIIPLSANFYLTELALKEYIGIL 234
           H+ RS   F   G+   A+ +D+   + +Y  +  + N   ++ A+ EYIG L
Sbjct: 186 HMPRSMAIFSGQGLAASAAPTDFRARDGFYWRL-TADNLLASQRAIHEYIGRL 237


>gi|323704444|ref|ZP_08116023.1| protein of unknown function DUF218 [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323536510|gb|EGB26282.1| protein of unknown function DUF218 [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 194

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 57/111 (51%), Gaps = 6/111 (5%)

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           P F+   R+ E +RLYK      +   II+SGG      ++E+      LL++G+  + I
Sbjct: 55  PFFKE--RLNEAIRLYK----KGLGKYIIVSGGKGPGEDVSEAEAGKEYLLKNGIPYNTI 108

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
             + +S  T QN + S  ++     K  I+VS+ +HLKR+ +  +  GIN 
Sbjct: 109 LKDDKSYSTLQNLENSKKIMDEKSLKTAIIVSNKFHLKRASIIAKEAGINA 159


>gi|47565636|ref|ZP_00236676.1| hypothetical protein cytosolic protein [Bacillus cereus G9241]
 gi|47557272|gb|EAL15600.1| hypothetical protein cytosolic protein [Bacillus cereus G9241]
          Length = 185

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 72  AKVIVSGGQGEDEDIPEAHSMRNYLMARGIDESRILIEDQSTNTYENVKFSMDL---YDV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGLKMEALAAE 160


>gi|152994702|ref|YP_001339537.1| hypothetical protein Mmwyl1_0668 [Marinomonas sp. MWYL1]
 gi|150835626|gb|ABR69602.1| protein of unknown function DUF218 [Marinomonas sp. MWYL1]
          Length = 255

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 95/204 (46%), Gaps = 14/204 (6%)

Query: 38  WGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI 97
           W  +   L+  ++  Y  P+   Q   D   +++LG+G   +   P + +     +  R+
Sbjct: 65  WNPVANSLIATVEHDY--PVFDVQQPVDA--VIVLGSGHKDLSNTPTV-MALGNSALFRL 119

Query: 98  FETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDT 157
            E +R+ K+    + +  + +SG   Q      + V     +E GV+ D IK    + DT
Sbjct: 120 EEGLRILKA----NPNAQLFVSGYSGQMTE-PHAEVMRRAAIELGVQPDRIKAFPLAKDT 174

Query: 158 FQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLS 217
            + A   +SM   ++GKN  LV+ A HLKR+ ++F+  GI    + + YL +  S   + 
Sbjct: 175 EEEA---NSMKPYLEGKNAALVTEASHLKRASIFFEQAGIKIIPAPAMYLGSEKSDWQID 231

Query: 218 AN-FYLTELALKEYIGILIAYYRG 240
           A   Y ++ A  E++G    + +G
Sbjct: 232 ATAAYKSQRAFYEWLGRTWQWIKG 255


>gi|332711315|ref|ZP_08431247.1| hypothetical protein LYNGBM3L_63860 [Lyngbya majuscula 3L]
 gi|332349864|gb|EGJ29472.1| hypothetical protein LYNGBM3L_63860 [Lyngbya majuscula 3L]
          Length = 281

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (49%), Gaps = 15/119 (12%)

Query: 137 KLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHF 195
           ++LE  GV R  I  E++SL+T QNA     ++       ++LV+SA H+ RS L F+  
Sbjct: 161 QILEDLGVPRAAIIQESRSLNTHQNAVNVRKILDQRDFPKVLLVTSAIHMPRSVLVFRRQ 220

Query: 196 GINTKASCSDYLNAYYSI--------------IPLSANFYLTELALKEYIGILIAYYRG 240
           GI+   + +D+L + + +              +P +        A+KEYIGI+    RG
Sbjct: 221 GIDVIPAPTDFLVSQHELDEPSSSSQAALLHSLPNAEQLSRITRAIKEYIGIVAYRIRG 279


>gi|332283765|ref|YP_004415676.1| membrane protein [Pusillimonas sp. T7-7]
 gi|330427718|gb|AEC19052.1| membrane protein [Pusillimonas sp. T7-7]
          Length = 254

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 78/161 (48%), Gaps = 15/161 (9%)

Query: 91  FQSYSRIFETMRLYKSCKQH-SMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIK 149
           F+ Y +     R+ K+   + +    +I+  G   +  ++E+ +  N L +  +    I 
Sbjct: 96  FEPYDKATAIARIDKAANLYKAQRAPLIVVSGAALEGNVSEAQIMANALKQHDIPESAII 155

Query: 150 LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA 209
           +E++S  T +NA +++  ++    +NI+LV+SA H+ R+   F+  GI   A+      A
Sbjct: 156 MESRSFTTHENAIYTAETLRQRHIQNILLVTSALHMPRAMAVFKKQGIAAIAAPL----A 211

Query: 210 YYSIIPLSANFY-----LTELA-----LKEYIGILIAYYRG 240
              ++P    F      +  LA     +KEY+G+L+ + RG
Sbjct: 212 PQIVVPDDPGFSFWQPDMRSLAASRSIVKEYVGLLVYWVRG 252


>gi|315604221|ref|ZP_07879287.1| conserved hypothetical protein [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315313927|gb|EFU61978.1| conserved hypothetical protein [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 330

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 66/143 (46%), Gaps = 17/143 (11%)

Query: 102 RLYKSCK---QHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTF 158
           R+ ++C+         T++ SGG  +   ++E+      L   GV    I LE +S  T+
Sbjct: 178 RVERACELWNAQGRRATLVPSGGQGEDEEISEAEAMARHLRALGVPASQIALEDRSTTTW 237

Query: 159 QNAQFSSSMIK---NMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIP 215
           +N  FS  +I    ++      LV+S YH+ R+ +Y +  G+N     +D L +      
Sbjct: 238 ENLSFSRDLIAERSSVPDPRSALVTSDYHVFRAAMYARAVGLN-----ADGLGSR----- 287

Query: 216 LSANFYLTELALKEYIGILIAYY 238
            +A +Y     ++E+I I   Y+
Sbjct: 288 -TARYYFPTAFIREFIAISRRYW 309


>gi|206581004|ref|YP_002239432.1| hypothetical protein KPK_3613 [Klebsiella pneumoniae 342]
 gi|288936282|ref|YP_003440341.1| hypothetical protein Kvar_3429 [Klebsiella variicola At-22]
 gi|290510662|ref|ZP_06550032.1| hypothetical protein HMPREF0485_02432 [Klebsiella sp. 1_1_55]
 gi|206570062|gb|ACI11838.1| conserved hypothetical protein [Klebsiella pneumoniae 342]
 gi|288890991|gb|ADC59309.1| protein of unknown function DUF218 [Klebsiella variicola At-22]
 gi|289777378|gb|EFD85376.1| hypothetical protein HMPREF0485_02432 [Klebsiella sp. 1_1_55]
          Length = 259

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 90/210 (42%), Gaps = 32/210 (15%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIF 98
           LLK ++ SY      P W+ +  +  +V+LG G T  P        PS      S  R+ 
Sbjct: 62  LLKPIEDSY------PTWRGEQPVSYVVVLGGGYTWNP-----EWAPSSNLINNSLPRLT 110

Query: 99  ETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDT 157
           E +RL+++     M  T     G   K     +     ++ ES GV R DI +  +  DT
Sbjct: 111 EGIRLWQANPGSKMIFT-----GAAAKTNPVSTAEAGARVAESLGVPRSDIIVLDRPKDT 165

Query: 158 FQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN------TKASCSDYLNAYY 211
            + AQ     I +      +LV+SA HL R+ ++F+H G++       + + +  LN + 
Sbjct: 166 EEEAQAVKRAIGDAP---FLLVTSASHLPRAMIFFRHAGLDPLPAPANQLAVTSPLNPWE 222

Query: 212 SIIPLSANFYLTELALKEYIGILIAYYRGN 241
             IP       ++    E +G +  + +G 
Sbjct: 223 RAIPSPVWLMHSDRVGYETLGRVWQWLKGG 252


>gi|262195869|ref|YP_003267078.1| hypothetical protein Hoch_2653 [Haliangium ochraceum DSM 14365]
 gi|262079216|gb|ACY15185.1| protein of unknown function DUF218 [Haliangium ochraceum DSM 14365]
          Length = 199

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           +  + IV+LG      P +   R+  S     R+   + LY    Q      + ++GG P
Sbjct: 35  EPADAIVVLG-----APVLAPGRL--SEVGRERVDAAVSLY----QRGAGPRLCVTGGGP 83

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
              G  E+          G+  + +++E Q+ +T +NA+F+++M++    +++ LVS  +
Sbjct: 84  A--GRVEADAMAAHARARGLPEEALRIERQARNTEENARFAAAMLRAEGCRSVWLVSQPF 141

Query: 184 HLKRSQLYFQHFGINTK 200
           HL R+ ++F+  G+  +
Sbjct: 142 HLARACVWFRRCGLEAR 158


>gi|27380091|ref|NP_771620.1| hypothetical protein bll4980 [Bradyrhizobium japonicum USDA 110]
 gi|27353245|dbj|BAC50245.1| bll4980 [Bradyrhizobium japonicum USDA 110]
          Length = 301

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 10/114 (8%)

Query: 129 AESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKR 187
           A+   Y+  +LES G+ ++ + +E  S +T++NA F+  ++    G+  +LV+SA+H+ R
Sbjct: 172 AKEADYSAPILESLGIPKERLIVERDSRNTWENAVFTKQLVSPKPGERWLLVTSAFHMPR 231

Query: 188 SQLYFQHFGINTKA-------SCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           +   F   G + +A          D L A+  I         T++A++E+IG+L
Sbjct: 232 AMGIFHKAGFDVEAYPVDWRMGGRDDLFAFTHIG--KEGLGRTDVAMREWIGLL 283


>gi|311697190|gb|ADQ00062.1| protein containing DUF218 [marine bacterium HP15]
          Length = 159

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 76/154 (49%), Gaps = 10/154 (6%)

Query: 89  PSFQS-YSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
           P+ +S   R++   RL+ + K       ++  G DP     +E++    + L   V    
Sbjct: 11  PNLESGADRVWHAARLFNASK---APLVLLTGGSDPSHSAASEAMRQFMRDLR--VPGQA 65

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY- 206
           + LE++S +T QNA++S+ ++       I+LV+ AYH+ R++  F+  G+      +D+ 
Sbjct: 66  LVLESRSRNTSQNAEYSAEILTEQGVNRILLVTFAYHMPRAKALFEAQGLEVILVATDHE 125

Query: 207 ---LNAYYSIIPLSANFYLTELALKEYIGILIAY 237
                 + S++P ++    +   +KE +G L+ +
Sbjct: 126 VLSRPLWRSLLPETSALDGSSRVIKEIVGRLVGH 159


>gi|237727319|ref|ZP_04557800.1| conserved hypothetical protein [Bacteroides sp. D4]
 gi|229434175|gb|EEO44252.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4]
          Length = 230

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 8/126 (6%)

Query: 86  RIEPSFQSYS-RIFETMRLYKSCKQHSM----HCTIIISGGDPQKHGLAESIVYNNKLLE 140
           R  P F   + R+ E +RLYK  +   +      +II S       G A  +     L +
Sbjct: 86  RSRPEFSEIADRLLEGIRLYKHGRIRKLVLASDGSIIESKDGKGLQGNAADM--KQYLAD 143

Query: 141 SGVERDDIKLETQSLDTFQNAQFSSSMIKN-MQGKNIILVSSAYHLKRSQLYFQHFGINT 199
            G+  +D+ LET++ +T++NA F+  +I N M+ ++ +L++SA H++RS   F   G+N 
Sbjct: 144 LGMPLEDVILETRANNTWENATFTLELIGNSMKTESTLLITSATHMRRSLWTFHAAGLNP 203

Query: 200 KASCSD 205
               +D
Sbjct: 204 DTYITD 209


>gi|325681016|ref|ZP_08160548.1| hypothetical protein CUS_5709 [Ruminococcus albus 8]
 gi|324107245|gb|EGC01529.1| hypothetical protein CUS_5709 [Ruminococcus albus 8]
          Length = 193

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 9/105 (8%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL---AESIVYNNKLLESGVERDDIKLET 152
           R+ E +RLYKS +   M    + SGG  QK  L   AE +      +  GV   DI LE 
Sbjct: 46  RVPEAVRLYKSGRAPMM----LFSGGKVQKTALGEMAEWLSMETAAISLGVSERDILLEK 101

Query: 153 QSLDTFQNAQFSSSMIKNM--QGKNIILVSSAYHLKRSQLYFQHF 195
            S++T +N   S ++++ +   G  IILV++AYH++R+ L  +  
Sbjct: 102 CSMNTAENFSCSENLLREVLPDGGRIILVTTAYHMRRALLTAEKI 146


>gi|296272332|ref|YP_003654963.1| hypothetical protein Arnit_0792 [Arcobacter nitrofigilis DSM 7299]
 gi|296096506|gb|ADG92456.1| protein of unknown function DUF218 [Arcobacter nitrofigilis DSM
           7299]
          Length = 235

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 73/145 (50%), Gaps = 18/145 (12%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SR +E ++L    K      T II+ G   K  +++++   N+L+  G+  + I ++ + 
Sbjct: 92  SRAYEVIKLSLKLKD-----TKIITSGYAGKKLISDALYAKNELISLGINENRIIMQDKP 146

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL------N 208
            DT + A     +I N   K  ILV+SAYH+ R+   F+  G+N  A  ++++      N
Sbjct: 147 KDTIEEAISIKKLINN---KPFILVTSAYHMPRAMKIFKMQGLNPIAMPTNFMAKKQKSN 203

Query: 209 AYYSIIPLSANFYLTELALKEYIGI 233
           +Y SI  L        +A+ EYIG+
Sbjct: 204 SYLSIKDLKK----VSIAIHEYIGL 224


>gi|291614927|ref|YP_003525084.1| hypothetical protein Slit_2472 [Sideroxydans lithotrophicus ES-1]
 gi|291585039|gb|ADE12697.1| protein of unknown function DUF218 [Sideroxydans lithotrophicus
           ES-1]
          Length = 251

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 86/196 (43%), Gaps = 15/196 (7%)

Query: 49  LQFSYQRPLLSPQWKKDGNIIVLLGNGTTI-IPTIPAIRIEPSFQSYSRIFETMRLYKSC 107
           LQ    +P ++   K   + IV+LG GT    P      +  S ++  R+    RLY+  
Sbjct: 63  LQGLEGQPFVNDTSKPQADAIVVLGGGTNFRAPEYGGDTV--SKETLERLRYAARLYRQT 120

Query: 108 KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSM 167
            +      I+++GG P  + L+E+     K LE          E  S +T +NA+ S  +
Sbjct: 121 GK-----PILVTGGTPLGNDLSEA-AQMKKTLEQEFNVPVRWAEGASNNTLENARLSREV 174

Query: 168 IKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY----YSIIPLSANFYLT 223
           +K      I LV+ A+H+ R+   FQ  G     + + Y   Y       IP ++    +
Sbjct: 175 LKKEGISRIYLVTHAWHMPRAVQVFQAAGFQVYPAPTAYTTRYQLDLLVFIPSASALRDS 234

Query: 224 ELALKEYIGILIAYYR 239
            + + E IG+L  +YR
Sbjct: 235 RIFMHEMIGLL--WYR 248


>gi|251779259|ref|ZP_04822179.1| conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
 gi|243083574|gb|EES49464.1| conserved hypothetical protein [Clostridium botulinum E1 str. 'BoNT
           E Beluga']
          Length = 253

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 49/88 (55%), Gaps = 5/88 (5%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           II+SGG      ++E++     LLE G+  D I +E QS +TF+N ++S  +I+    KN
Sbjct: 133 IIVSGGKGNDERISEAMAMKKYLLEQGISEDKILMEDQSKNTFENFKYSKKLIEEHSNKN 192

Query: 176 II-----LVSSAYHLKRSQLYFQHFGIN 198
           I      +V++ +H  RS++  +  G N
Sbjct: 193 IDDLSVKIVTTDFHGFRSKMLAKRNGYN 220


>gi|221369405|ref|YP_002520501.1| hypothetical protein RSKD131_3568 [Rhodobacter sphaeroides KD131]
 gi|221162457|gb|ACM03428.1| Hypothetical Protein RSKD131_3568 [Rhodobacter sphaeroides KD131]
          Length = 267

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 65/128 (50%), Gaps = 6/128 (4%)

Query: 113 HCTIIISGGDPQKHG--LAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
              ++ +GG  +  G  + E+ +    L+ +GV+   + LE QS +T +NA F+ +++ N
Sbjct: 123 EARVLFTGGSGRLFGAEIPEARIAREILVSAGVDPARLILEGQSRNTAENAHFAKALVAN 182

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKAS-CSDYLNAYYSI---IPLSANFYLTELA 226
               + +LV+SA+H+ R+   F   G        +DY  A         L+ N  L  +A
Sbjct: 183 QGQGSWLLVTSAFHMPRAVETFCAAGWQDLVPWPTDYRTASLRDGIGWDLARNLDLLNVA 242

Query: 227 LKEYIGIL 234
           ++E+IGIL
Sbjct: 243 VREWIGIL 250


>gi|310823295|ref|YP_003955653.1| hypothetical protein STAUR_6067 [Stigmatella aurantiaca DW4/3-1]
 gi|309396367|gb|ADO73826.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 256

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 81/181 (44%), Gaps = 13/181 (7%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQS-YSRIFETMRLYKSCKQHSMHCTIIISGG--DP 123
           + +++LG G  + P        P + +   RI     L +  +       +++SGG  D 
Sbjct: 78  DAVIVLGGG--LDPDATERSGRPEYNAAVERILRGYELLREGRARH----VLLSGGSLDT 131

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
           +   + E+ V   +LL  G+  + I +E  S +T +NA  S  +I+    K ++L++SA 
Sbjct: 132 RPEAVIEATVLQRQLLAWGIAPERIVVEGHSRNTRENALDSKKLIEERGWKTLLLITSAA 191

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYY----SIIPLSANFYLTELALKEYIGILIAYYR 239
           HL R+   F   G+      +D   +      S +P + +   +  AL+E  G ++   R
Sbjct: 192 HLPRAYGCFAAVGLRPDTLAADVRASDGKRPPSWLPRANHLSASTDALRELAGRVVYRLR 251

Query: 240 G 240
           G
Sbjct: 252 G 252


>gi|329935832|ref|ZP_08285635.1| hypothetical protein SGM_1127 [Streptomyces griseoaurantiacus M045]
 gi|329304675|gb|EGG48550.1| hypothetical protein SGM_1127 [Streptomyces griseoaurantiacus M045]
          Length = 336

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 86/183 (46%), Gaps = 25/183 (13%)

Query: 63  KKDGNIIVLLGNG---TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           ++  + +V+LG+G    T +P + A R++ + + ++R+           +      ++ S
Sbjct: 155 RRRADYVVVLGSGLIGGTTVPPLLAGRLDRARKEHARL----------SRKGRRPVMLTS 204

Query: 120 GGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIIL 178
           GG      + ES    + L+  G   D I+ E +S  T +N  FS ++++        ++
Sbjct: 205 GGQGPDEKVPESHAMADYLVAQGFPADLIEREDRSTTTDENLTFSKALMERANPDYRCVI 264

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYY 238
           V++ YH+ R+ +  +  G+      +          P +A F+ + + ++E++ +L+AY 
Sbjct: 265 VTNNYHVFRAAVTARRTGVRGHVIGA----------PTAAYFWPSAM-IREFVALLVAYR 313

Query: 239 RGN 241
           R N
Sbjct: 314 RTN 316


>gi|170726063|ref|YP_001760089.1| hypothetical protein Swoo_1709 [Shewanella woodyi ATCC 51908]
 gi|169811410|gb|ACA85994.1| protein of unknown function DUF218 [Shewanella woodyi ATCC 51908]
          Length = 264

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 85/170 (50%), Gaps = 9/170 (5%)

Query: 66  GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQK 125
           G ++++LG+G     +  A++ + S  + +R+ E +R Y         C +++SG    +
Sbjct: 80  GCLVMVLGSGHDESISGTAVQ-KLSSTALARLSEGIRQYNLGSD----CKLVVSGWSGGE 134

Query: 126 HGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHL 185
             L+ + V     +E G++ + I     + DT + A+F    I N   +   LV+SA H+
Sbjct: 135 GTLSHAEVMAEAAIELGIDNERIIRFPLARDTIEEAEFLKWEIGNYPFR---LVTSASHM 191

Query: 186 KRSQLYFQHFGINTKASCSDYLNAYYSIIPLSA-NFYLTELALKEYIGIL 234
            RS   FQ+ G+  +A+ +D++        L A N + ++ A+ EY+G L
Sbjct: 192 PRSMAIFQNIGLAPQAAPTDFMTRQGRWWRLDAENLWSSQRAIHEYLGRL 241


>gi|330445713|ref|ZP_08309365.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489904|dbj|GAA03862.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 275

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 94/187 (50%), Gaps = 17/187 (9%)

Query: 26  MSCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIP 80
           ++  ++ FSF+G     +  + T LL+ L+  ++  + S    K  + +++LGNG  I  
Sbjct: 37  LASGIIAFSFLGIFAVSFQPVSTSLLRPLEQEHRAFVGS---SKPIDFVMVLGNGHVIDK 93

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLE 140
           T P I  E S  +  R+ E +R+Y+      M  +   SGG    H    + V     L 
Sbjct: 94  TFP-ITSELSRTALMRLAEGIRIYRMYPGSKMILSGY-SGGTTMSHARMLAKVA----LA 147

Query: 141 SGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTK 200
            GV + DI L   + DT++ A  ++S++ +   KN++LV+SA H+ R+   F   G++  
Sbjct: 148 LGVSKSDILLLETAKDTWEEAHQAASVVGS---KNLVLVTSASHMSRALNEFHQAGLDPI 204

Query: 201 ASCSDYL 207
            + ++++
Sbjct: 205 PAPTNFM 211


>gi|170758739|ref|YP_001788223.1| hypothetical protein CLK_2294 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169405728|gb|ACA54139.1| conserved hypothetical protein [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 197

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R+ E +RLY           II+SG       ++E+      L++ G+++  I LE +S 
Sbjct: 65  RLDEGLRLY----NEGYGKYIIVSGAKGPGENISEAEAMEKYLVQKGLDKKFIILEDKSR 120

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
           +T +N +FS   +++    + I+VS+ YHLKR++L  Q  GI  KAS S
Sbjct: 121 NTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQKEGI--KASYS 167


>gi|218290184|ref|ZP_03494343.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239779|gb|EED06969.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 259

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 90/206 (43%), Gaps = 23/206 (11%)

Query: 44  ILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS----RIFE 99
           +LL  L+ +Y     +P  +  G+ IV+LG G +      A     +   Y     R+  
Sbjct: 58  LLLIPLERAY-----APPARPTGDAIVVLGAGFSAAAPDFADPAANTGTLYGDSGERVLA 112

Query: 100 TMRLYKSCKQHSMHCTIIISGGD---PQKHGLAESIVYNNKLLESGVERDDIKLETQSLD 156
              LY+      +H  I++SGG          A +++    L   GV   ++ ++  S  
Sbjct: 113 AAALYRR-----LHLPIVLSGGPLIRANGKSYAFALIAARDLAALGVPARELYVDATSRT 167

Query: 157 TFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA------Y 210
           T +NA+ +++++  +     ILV+SA  + R+ + F+  G+  +     Y+ +       
Sbjct: 168 TEENAEHTAAILHRLHRSRPILVASAAQMARAVIDFRRVGVKVEPYPVGYVASPVPTPLA 227

Query: 211 YSIIPLSANFYLTELALKEYIGILIA 236
           Y+ +P  A    T  AL E +GIL A
Sbjct: 228 YAWLPSEAGLDETCTALHEDLGILAA 253


>gi|209551623|ref|YP_002283540.1| hypothetical protein Rleg2_4052 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537379|gb|ACI57314.1| protein of unknown function DUF218 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 262

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 91/207 (43%), Gaps = 18/207 (8%)

Query: 44  ILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS-RIFETMR 102
           ++++ L+  + +P   P   +    +++LG G      +   R    F + + R  E +R
Sbjct: 59  LMMQGLEQRFAKPAADPDSLQ---CMIVLGGG--FENEVNTARHGIEFNAAADRFVEALR 113

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES--GVERDDIKLETQSLDTFQN 160
           L +   Q      I++SGGD    G+ E     ++      GV +D +  E QS  TF+N
Sbjct: 114 LAQKFPQSR----ILVSGGDGSLSGIYEGDAAASERFFPLFGVGKDRLIEERQSRTTFEN 169

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-----LNAYYSIIP 215
           A  +   + +    N +L++S +H+ RS   F+  GI+     +DY     + A      
Sbjct: 170 AVNTKEFLASQGLANCLLITSGFHMPRSVGIFRKLGIDIVPWPTDYRTDGRVKAGLDFTQ 229

Query: 216 LSANFYLTELALKEYIGILIAYYRGNR 242
            + N      A++E+ G L+ YY   R
Sbjct: 230 PNLNAQNMATAIREWYG-LVGYYLAGR 255


>gi|312870586|ref|ZP_07730701.1| conserved hypothetical protein [Lactobacillus oris PB013-T2-3]
 gi|311093901|gb|EFQ52230.1| conserved hypothetical protein [Lactobacillus oris PB013-T2-3]
          Length = 280

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 71/141 (50%), Gaps = 20/141 (14%)

Query: 64  KDGNIIVLLGNGTTI--IPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
           +  + +V+LG G T   +P + A R++ +++ +    ET+              +I+SGG
Sbjct: 105 RATDYLVVLGAGLTKGQVPPVLAARLDSAYRFWKVHPETV--------------VIVSGG 150

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK---NMQGK-NII 177
           D     + ++    + L   GV    I LE+Q+ +T+QN   S  +I    + +GK  + 
Sbjct: 151 DVHGDQVTQARAMADYLQRLGVVATKILLESQARNTWQNLVNSRKLIAQHWHREGKPRVT 210

Query: 178 LVSSAYHLKRSQLYFQHFGIN 198
           +V+S++H+ R+ LY    G+N
Sbjct: 211 VVTSSFHVPRAMLYTHRLGLN 231


>gi|317968461|ref|ZP_07969851.1| hypothetical protein SCB02_02886 [Synechococcus sp. CB0205]
          Length = 266

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 83/199 (41%), Gaps = 24/199 (12%)

Query: 58  LSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSM---HC 114
           L+P+   + + +V+LG G  + P +P  R     +   R+   +RL    K  ++     
Sbjct: 70  LTPKTIPNADAVVVLGGG--LKPALPPRRGVEVSEGGDRLLTGVRLMSQKKAGTLVTSGA 127

Query: 115 TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK 174
            I  +  DP     AE+        E GV    I     S  T + A+    + K     
Sbjct: 128 QISFTAADPAP---AEAFSAKALAEELGVPSQRIVPNPLSKTTAEEARDIGQLAKQRGWS 184

Query: 175 NIILVSSAYHLKRSQLYFQ-HFGINTKASCSDYL-------------NAYYSIIPLSANF 220
            ++LV+SA+H+ RS   FQ   G+       D+L             +    ++P +   
Sbjct: 185 QVLLVTSAFHMPRSLATFQRRSGLQVIPVACDFLLPERQRLGSPTPGSLVQDLLPSAEAL 244

Query: 221 YLTELALKEYIGILIAYYR 239
           YL+ +ALKE++G  +A YR
Sbjct: 245 YLSSVALKEHLG--LALYR 261


>gi|302524814|ref|ZP_07277156.1| predicted protein [Streptomyces sp. AA4]
 gi|302433709|gb|EFL05525.1| predicted protein [Streptomyces sp. AA4]
          Length = 329

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 85/177 (48%), Gaps = 30/177 (16%)

Query: 69  IVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           +V+LG+G     +P + A R++ + Q               +Q S    +++SGG     
Sbjct: 161 VVVLGSGLQGDRVPPLLASRLDRAVQ--------------VQQRSPGAVLVVSGGQGADE 206

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI--KNMQGKNIILVSSAYH 184
             +E+      L+E+GV  + + LE ++  T +N +FS +++  +   G  I+ V++ YH
Sbjct: 207 LTSEAAAMARYLVEAGVPEEQLVLEDRATTTSENLRFSVALLAERGFSGP-ILAVTNNYH 265

Query: 185 LKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
           + R+ +  +  G+         LN    I   +A++++    L+E++ +L+ Y + N
Sbjct: 266 VFRTAVLARQLGLR--------LNV---IGARTASYFVPSAFLREFVALLVEYRKTN 311


>gi|168179334|ref|ZP_02613998.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
 gi|226950331|ref|YP_002805422.1| hypothetical protein CLM_3296 [Clostridium botulinum A2 str. Kyoto]
 gi|182669557|gb|EDT81533.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
 gi|226841604|gb|ACO84270.1| conserved hypothetical protein [Clostridium botulinum A2 str.
           Kyoto]
          Length = 198

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R+ E +RLY           II+SG       ++E+      L++ G+++  I LE +S 
Sbjct: 65  RLDEGLRLY----NEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSR 120

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
           +T +N +FS   +++    + I+VS+ YHLKR++L  Q  GI  KAS S
Sbjct: 121 NTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQKEGI--KASYS 167


>gi|157369964|ref|YP_001477953.1| hypothetical protein Spro_1721 [Serratia proteamaculans 568]
 gi|157321728|gb|ABV40825.1| protein of unknown function DUF218 [Serratia proteamaculans 568]
          Length = 257

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 84/183 (45%), Gaps = 19/183 (10%)

Query: 67  NIIVLLGNGTTIIPT-IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQK 125
           N IV+LG G T  P   P+  +     S  R+ E +RLY +   H     +    G P+ 
Sbjct: 80  NYIVVLGGGYTFNPDWAPSSNL--IGNSLPRVTEGVRLYLA---HPGAKMVFTGAGSPKT 134

Query: 126 HGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYH 184
              A +     ++ ES GV R DI L  + LDT Q A   S ++     +  ILV+SA H
Sbjct: 135 LSNAATAA---QVAESLGVPRSDIVLLDRPLDTEQEALQVSKLVGQ---QPFILVTSANH 188

Query: 185 LKRSQLYFQHFGIN------TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYY 238
           L R+  +F+  G++       + + S  LN +  ++P +     +E A  E +G L    
Sbjct: 189 LPRAMRFFEAKGLHPIPAPANQLAISSQLNIWDRVVPSAMFLGHSERAWYETLGSLWQRL 248

Query: 239 RGN 241
           +G+
Sbjct: 249 KGS 251


>gi|77745325|gb|ABB02563.1| unknown [Lactobacillus reuteri]
          Length = 271

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 102 RLYKS--CKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQ 159
           RL K+  C +      II SGG  QK   +E+ V    L+  G+    I  E + L+T+Q
Sbjct: 128 RLDKAINCWKTHQSAKIIGSGGIVQKAKESEAEVMAGYLIAHGIPARKIIRENKGLNTWQ 187

Query: 160 NAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           N  F+S +IK  +   +++V+S +H+ R++ Y +  G+N
Sbjct: 188 NLAFASQLIKPQE--TVVVVTSDFHVLRARAYARKMGLN 224


>gi|312144373|ref|YP_003995819.1| protein of unknown function DUF218 [Halanaerobium sp.
           'sapolanicus']
 gi|311905024|gb|ADQ15465.1| protein of unknown function DUF218 [Halanaerobium sp.
           'sapolanicus']
          Length = 252

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 85/182 (46%), Gaps = 13/182 (7%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           ++ + IV+LG G        A   EPS  S  R+ +   L+++     ++  II SGG  
Sbjct: 77  EEDHPIVVLGGGNYYKTDGSA---EPSVHSKQRLAKAYELHRT-----LNTKIIYSGGVG 128

Query: 124 QKH-GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA 182
             H   +E+      L   G+E +  + E Q+  T++NA +    +   + + I LV+SA
Sbjct: 129 LGHDNFSEADAAKEFLSGLGLESEKYESEDQARSTYENALYIKKWLNENEIERIYLVTSA 188

Query: 183 YHLKRSQLYFQHFGINTKASCS----DYLNAYYSIIPLSANFYLTELALKEYIGILIAYY 238
           YH+ RS   F+   I+  A  S    D+  ++ + +P      +   AL E++GI+  Y 
Sbjct: 189 YHMYRSARAFRAQEIDFLAHHSGFIYDHKFSWLNYLPNRGALQVNLSALHEWVGIVWYYL 248

Query: 239 RG 240
           R 
Sbjct: 249 RA 250


>gi|284039129|ref|YP_003389059.1| hypothetical protein Slin_4276 [Spirosoma linguale DSM 74]
 gi|283818422|gb|ADB40260.1| protein of unknown function DUF218 [Spirosoma linguale DSM 74]
          Length = 272

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 100/216 (46%), Gaps = 31/216 (14%)

Query: 43  TILLKHLQFSYQRPLLSPQWKKDGN-----IIVLLG---NGTTIIPTIPAIRIEPS---- 90
           + L+  L   ++ P+  P     G+      IVL G   NG    P  P  R   +    
Sbjct: 52  SFLVNELALWWEYPI-KPDMHAPGDSVKRVAIVLTGGMINGEREAPGKPLNRTHLARFLL 110

Query: 91  FQSYSRIFETMRLYKSCKQHSMHCTIIISGG----DPQKHGL-AESIVYNNKLLESGVER 145
            +   RI + + LYK+         ++ISGG      Q   L  E  +    L+ +GV  
Sbjct: 111 GREADRIGQALYLYKTGAVQK----VLISGGLGSWPFQPISLNDEGHLAGELLIIAGVRP 166

Query: 146 DDIKLETQSLDTFQNAQFSSSMIKNMQGK---NIILVSSAYHLKRSQLYFQHFGINTKAS 202
           +DI LE +S +T +NA+FS+ +++    K     +L++SA+H+KR+   FQ  G+ T   
Sbjct: 167 EDIMLEGKSRNTHENARFSAPILRKHFDKAHYEYVLITSAWHMKRAIACFQKEGVQTIPF 226

Query: 203 CSDYL-NAYYS-----IIPLSANFYLTELALKEYIG 232
            S++L N   S     ++P    F+ +   ++E++G
Sbjct: 227 PSNFLGNRRLSGPAEWLLPDEEAFFESYYLIREFVG 262


>gi|320527634|ref|ZP_08028808.1| hypothetical protein HMPREF9430_00919 [Solobacterium moorei F0204]
 gi|320131955|gb|EFW24511.1| hypothetical protein HMPREF9430_00919 [Solobacterium moorei F0204]
          Length = 268

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 79/162 (48%), Gaps = 26/162 (16%)

Query: 30  MLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEP 89
           ++  +F+ + +   +L +H+ F Y               +V+LG G      I  +R  P
Sbjct: 73  LVFVAFMFYSMFIQLLPRHVDFDY---------------VVVLGAGL-----IDGLR--P 110

Query: 90  SFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIK 149
           +    +R+ + +R++         C I++SGG      ++E+      L++ G++   I 
Sbjct: 111 TKLLANRLDKAIRVFNKSVSS---CYIVVSGGQGSDEKVSEAEAMRTYLIDKGIKNHQII 167

Query: 150 LETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQL 190
           +E +S++TFQN + S  +IK   G+  I +V+S +H+ R+ L
Sbjct: 168 MEDKSVNTFQNMRNSYEIIKRRGGRMRIAVVTSNFHVYRALL 209


>gi|317496202|ref|ZP_07954562.1| hypothetical protein HMPREF0432_01166 [Gemella moribillum M424]
 gi|316913777|gb|EFV35263.1| hypothetical protein HMPREF0432_01166 [Gemella moribillum M424]
          Length = 355

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 64/130 (49%), Gaps = 17/130 (13%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISGGDPQKH 126
           +V+LG G      +   R+ P   S        R+    K +S H    +I+SGG     
Sbjct: 173 VVVLGAG------LIGERVTPLLAS--------RIRTGIKIYSKHPGSKLIMSGGQGADE 218

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLK 186
            ++E+    N  LE GV  +DI +E +S +T +N +FS  ++K++  +   LV++ YH+ 
Sbjct: 219 VVSEAFAMKNYALEQGVSEEDIIMEDKSTNTEENIKFSKRLMKDVNSR-FALVTNYYHVY 277

Query: 187 RSQLYFQHFG 196
           R+ +  +  G
Sbjct: 278 RALVLAKTLG 287


>gi|330505003|ref|YP_004381872.1| hypothetical protein MDS_4089 [Pseudomonas mendocina NK-01]
 gi|328919289|gb|AEB60120.1| hypothetical protein MDS_4089 [Pseudomonas mendocina NK-01]
          Length = 256

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 95/221 (42%), Gaps = 23/221 (10%)

Query: 27  SCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLS-PQWK---KDGNIIVLLGNGTTIIPTI 82
           +CF+  F  +    +P ++        + P L   +W    +  + IV+LG G       
Sbjct: 37  TCFVTGFGGLWLMSLPAVMQWSAGLLEREPALEEARWATLAQRADAIVILGAGREQNDPG 96

Query: 83  PAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESG 142
                +P   +  R+    RL ++     M  T  +  G P              L+   
Sbjct: 97  WGGADQPGLMALERLRYAARLARASG-LPMAATGGLHYGQPPSEA---------ALMADA 146

Query: 143 VERD---DIK-LETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           ++RD   +I+ LE QS  T++NA  S+ +++    + ++LV+ A+H+ R++  F+  G  
Sbjct: 147 MKRDYGLEIRWLEEQSRTTWENAVLSADLLQPQGVRRVVLVTQAWHMPRARWSFEQAGFE 206

Query: 199 TKASCSDYLNAYYS-----IIPLSANFYLTELALKEYIGIL 234
             ++   YL+A Y+      +P S   + +   L E IG+L
Sbjct: 207 VISAPMGYLSAGYARPLGGWLPESRVIWQSSQLLNEAIGLL 247


>gi|303240608|ref|ZP_07327123.1| protein of unknown function DUF218 [Acetivibrio cellulolyticus CD2]
 gi|302591845|gb|EFL61578.1| protein of unknown function DUF218 [Acetivibrio cellulolyticus CD2]
          Length = 259

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 62/111 (55%), Gaps = 12/111 (10%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM---Q 172
           II+SGG      ++E+      L+ +GV + +I +E QS +T +N + + ++I+N+   +
Sbjct: 142 IIVSGGQGFDEEVSEAFAMKEYLVSNGVNQKNIIMEEQSTNTLENIKNTKALIENLPDEK 201

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKA-SC--------SDYLNAYYSII 214
             N+++V++ +HL R+++  + FG       C        ++YL  ++++I
Sbjct: 202 SNNVLIVTNRFHLFRAKMLAERFGFKAYGMPCITPLYTIPNNYLREFFAVI 252


>gi|298370494|ref|ZP_06981810.1| periplasmic protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281954|gb|EFI23443.1| periplasmic protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 220

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
           +PS     RI   + LY+S +       I+ +GG P+K  + E+ V     L+ G+   +
Sbjct: 66  QPSPVFLERINHAIALYQSHRV----GKIVFTGGTPKKGYMTEAEVGRRYALKQGIPAKN 121

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
           I  E  S +T++N +    +++     +II+VS  YHL R+Q   +   +N + S +
Sbjct: 122 ILFENTSRNTYENLRNIKPILRANSVDSIIIVSDPYHLARAQAIARDLDLNAEVSAT 178


>gi|212694703|ref|ZP_03302831.1| hypothetical protein BACDOR_04235 [Bacteroides dorei DSM 17855]
 gi|212662682|gb|EEB23256.1| hypothetical protein BACDOR_04235 [Bacteroides dorei DSM 17855]
          Length = 252

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 8/126 (6%)

Query: 86  RIEPSFQSYS-RIFETMRLYK-SCKQH---SMHCTIIISGGDPQKHGLAESIVYNNKLLE 140
           R  P F   + R+ E +RLYK  C +    +   +II S       G A  +     L +
Sbjct: 86  RSRPEFSEIADRLLEGIRLYKHGCIRKLVLASDGSIIESKDGKGLQGNAADM--KQYLAD 143

Query: 141 SGVERDDIKLETQSLDTFQNAQFSSSMIKN-MQGKNIILVSSAYHLKRSQLYFQHFGINT 199
            G+  +D+ LET++ +T++NA F+  +I N M+ ++ +L++SA H++RS   F   G+N 
Sbjct: 144 LGMPLEDVILETRANNTWENATFTLELIGNSMKTESTLLITSATHMRRSLWTFHAAGLNP 203

Query: 200 KASCSD 205
               +D
Sbjct: 204 DTYITD 209


>gi|299534801|ref|ZP_07048130.1| hypothetical protein BFZC1_02177 [Lysinibacillus fusiformis ZC1]
 gi|298729646|gb|EFI70192.1| hypothetical protein BFZC1_02177 [Lysinibacillus fusiformis ZC1]
          Length = 344

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 81/181 (44%), Gaps = 28/181 (15%)

Query: 60  PQWKKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTII 117
           P+  +D   I++LG+G     +P + A          SRI + +  Y      +   TII
Sbjct: 159 PRLNQD--FIIVLGSGLINDKVPPLLA----------SRIQKAIDFYHKQAAVTTPPTII 206

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI---KNMQGK 174
            SGG      L E+       +E G+  +    E +S++T+QN  FS  ++   K  +  
Sbjct: 207 FSGGQGPDENLPEAEAMQRYAIEKGIPIEQTLQENRSVNTYQNMLFSKQLMDARKQGEAY 266

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           N I  ++ +HL R+ +Y +  G++++   S            +A +Y     ++EY+ I+
Sbjct: 267 NSIFTTNNFHLFRAGIYARLAGLDSQGIGSK-----------TAFYYWPNAMIREYVAIV 315

Query: 235 I 235
           +
Sbjct: 316 V 316


>gi|223986622|ref|ZP_03636616.1| hypothetical protein HOLDEFILI_03938 [Holdemania filiformis DSM
           12042]
 gi|223961417|gb|EEF65935.1| hypothetical protein HOLDEFILI_03938 [Holdemania filiformis DSM
           12042]
          Length = 363

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK- 174
           +I SGG       AE+ V  + LLE GV    I++E QS++T++N  FS  ++ +M+   
Sbjct: 220 LIPSGGQGPDEPRAEAEVMKDYLLEQGVPEVRIRVENQSVNTYENMVFSKKIMDSMKKNY 279

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYS 212
             +  +S YH+ R+ L  +  GI   +       AY+S
Sbjct: 280 KCLFCTSDYHVFRAGLLSRKAGIRRCSGIGSRTVAYFS 317


>gi|256003507|ref|ZP_05428497.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|255992531|gb|EEU02623.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           2360]
 gi|316941425|gb|ADU75459.1| protein of unknown function DUF218 [Clostridium thermocellum DSM
           1313]
          Length = 262

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 78/160 (48%), Gaps = 28/160 (17%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK--QHSMHCTIIISGGDPQKH 126
           +V+LG G      +   RI P+FQ         RL K  +  + +    ++++GG     
Sbjct: 107 LVILGAG------LKGDRITPTFQ--------YRLDKGVEYLRANPELKVVVTGGQGPGE 152

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---IILVSSAY 183
            L E+      L+  G++ D I +E ++  T +N ++++ ++K + G++   I++V++ +
Sbjct: 153 DLTEAEAMKRYLVSHGIDEDRIIMEDRATSTNENMKYTAEVLKQLTGRSDYRIMIVTNDF 212

Query: 184 HLKRSQLYFQHFGI---------NTKASCSDYLNAYYSII 214
           H+ R+++  +H G          N     + Y+  Y++++
Sbjct: 213 HMFRAKILARHNGFTPYGITVPTNPVVLVNSYIREYFAVV 252


>gi|307717857|ref|YP_003873389.1| transmembrane protein [Spirochaeta thermophila DSM 6192]
 gi|306531582|gb|ADN01116.1| probable transmembrane protein [Spirochaeta thermophila DSM 6192]
          Length = 249

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 79/160 (49%), Gaps = 25/160 (15%)

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           P   + +R++  +R  +      +   ++++GG     G +E  +  + + E G E  ++
Sbjct: 98  PGVVTLARLWGGLRYARM-----LGVPLVLAGGSVWDEGKSEGEMMADLVRELGWE--EV 150

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
            +E +S  T++NA+ ++ M+       ++LV+SAYH++R+   F+  G+    +  D+ +
Sbjct: 151 VVEGESRTTWENARNTARMVGR---GPVLLVTSAYHMQRAVWCFRAQGVEVIPAPVDFRD 207

Query: 209 AYYSIIPLSANFYL---------TELALKEYIGILIAYYR 239
                 P    FYL          + AL+EY+G++  +YR
Sbjct: 208 ER----PAHWIFYLGISAEAARDVQAALREYVGMV--WYR 241


>gi|218682013|ref|ZP_03529614.1| hypothetical protein RetlC8_24195 [Rhizobium etli CIAT 894]
          Length = 262

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 93/209 (44%), Gaps = 22/209 (10%)

Query: 44  ILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS-RIFETMR 102
           +L++ L+  + +P   P+     N+  ++  G      +   R    F + + R  E +R
Sbjct: 59  LLMQGLEQRFTKPAADPE-----NLQCMIVLGGAFENEVNTARHGIEFNAAADRFVEALR 113

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES--GVERDDIKLETQSLDTFQN 160
           L +   Q      I++SGGD    G+ E     ++      G+ +D +  ETQS  TF+N
Sbjct: 114 LAQKFPQSR----ILVSGGDGSLSGVYEGDAAASERFFPLFGIGKDRLIEETQSRTTFEN 169

Query: 161 AQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY-------YSI 213
           A  +   + +    + +L++S +H+ RS   F+  G   +A  +DY           Y+ 
Sbjct: 170 AVNTKEFLASQGLSHCLLITSGFHMPRSVGIFRKLGTRYRALPTDYRTDGAVRPGLDYTQ 229

Query: 214 IPLSANFYLTELALKEYIGILIAYYRGNR 242
             L+A    T  A++E+ G L+ YY   R
Sbjct: 230 PNLNAQNMAT--AIREWYG-LVGYYLAGR 255


>gi|330953011|gb|EGH53271.1| hypothetical protein PSYCIT7_16874 [Pseudomonas syringae Cit 7]
          Length = 256

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 85/196 (43%), Gaps = 31/196 (15%)

Query: 56  PLLSPQWK---KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI---FETMRLYKSCKQ 109
           PL   QW    +  + IV+LGNG          R  P++ + +      E +RL     +
Sbjct: 67  PLPQQQWATLAQQADAIVVLGNGRE--------RNSPTWGADTPTGLGLERLRLAARLAK 118

Query: 110 HSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL-----ETQSLDTFQNAQFS 164
            S    I+ SGG       +E+ +    L      +DD  +     E  S  T++NA  S
Sbjct: 119 ES-GLPILTSGGLHFDQPPSEAAIMAQSL------QDDFAVTVRWQEGLSRTTWENATMS 171

Query: 165 SSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN-----AYYSIIPLSAN 219
           +++++    K ++LV+ A+H+ R++  F+  G    ++   YL       +   +P S  
Sbjct: 172 AAVLQPQGIKRVVLVTQAWHMPRARWSFEQAGFTVVSAPVGYLGVDNARPFGGWLPESRV 231

Query: 220 FYLTELALKEYIGILI 235
           F  + + L E  G+L+
Sbjct: 232 FTQSGMLLNEAAGLLV 247


>gi|296393440|ref|YP_003658324.1| hypothetical protein Srot_1020 [Segniliparus rotundus DSM 44985]
 gi|296180587|gb|ADG97493.1| protein of unknown function DUF218 [Segniliparus rotundus DSM
           44985]
          Length = 344

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 68/125 (54%), Gaps = 12/125 (9%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           IV LG G     ++P + +E       R+ +T+ L  +  + S    II++GG PQ +GL
Sbjct: 180 IVTLGAGLRPDGSMPQVLLE-------RLKKTLDLALADPEAS----IIVTGGKPQ-NGL 227

Query: 129 AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS 188
            E+    + L+  GV+   +  E +S  T QNA  S+S++++++   +++V+SA H +R+
Sbjct: 228 TEADAMADWLVGQGVDPARVHKEDRSASTVQNALNSASILRSLKPSQLVVVTSANHARRA 287

Query: 189 QLYFQ 193
               +
Sbjct: 288 SALLE 292


>gi|251779225|ref|ZP_04822145.1| integral membrane protein [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243083540|gb|EES49430.1| integral membrane protein [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 348

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 79/175 (45%), Gaps = 21/175 (12%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           + I++LG+G      +   R+ P   S  RI + +  Y      +    II SGG     
Sbjct: 165 DFIIVLGSG------LIGERVPPLLAS--RIDKAIEFYNKQGTVTNPPKIIFSGGQGSDE 216

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI--ILVSSAYH 184
            ++E++       + G+  +D  LE +S++T QN  FS  ++ N        I V++ +H
Sbjct: 217 KISEALAMQRYATQKGIPIEDTILEDKSVNTLQNMIFSKKIMDNSTPNTYASIFVTNNFH 276

Query: 185 LKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           L R+ ++ +  G+ ++   S            +A ++L    ++EYI  ++ Y +
Sbjct: 277 LFRAGIFARKAGLKSQGIGSR-----------TAFYFLPNAMIREYIAFVVMYKK 320


>gi|303253664|ref|ZP_07339802.1| hypothetical protein APP2_0852 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248075|ref|ZP_07530104.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|302647584|gb|EFL77802.1| hypothetical protein APP2_0852 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306855473|gb|EFM87647.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 246

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 104/235 (44%), Gaps = 22/235 (9%)

Query: 5   WIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKK 64
           W+F ++ YW     +++KI +   F+ + S   +   P +  K          L+ +  K
Sbjct: 22  WLFSLICYWL----NLKKISYSLAFLGIGSLYLFST-PYVATKLTDSLVTEDNLALEDYK 76

Query: 65  DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
               IV+LG G        +  I       ++  E MR Y +  Q      ++I+G  P 
Sbjct: 77  KAQAIVVLGGGVR-----DSKEIYNPIAVGNQALERMR-YAAYLQKETQLPLLITGSSP- 129

Query: 125 KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYH 184
            +G +E+    N+  +         LE ++  T +NAQFS  ++       IILV++ +H
Sbjct: 130 -NGTSEAKTMANEF-QYFFSVSTQWLEEKAKTTKENAQFSRELLAKEGINKIILVTNQWH 187

Query: 185 LKRSQLYFQHFG-------INTKASCSDYLNAYYSIIPLSANFYLTELALKEYIG 232
           +KR+++ F+  G       I    + ++Y+N  Y  IP S       L+LKE++G
Sbjct: 188 MKRAKMLFEKQGFEVLPASIGHGVTPTEYINFAY-FIPQSGAMDSIMLSLKEWLG 241


>gi|125974276|ref|YP_001038186.1| hypothetical protein Cthe_1772 [Clostridium thermocellum ATCC
           27405]
 gi|281418329|ref|ZP_06249349.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
 gi|125714501|gb|ABN52993.1| protein of unknown function DUF218 [Clostridium thermocellum ATCC
           27405]
 gi|281409731|gb|EFB39989.1| protein of unknown function DUF218 [Clostridium thermocellum JW20]
          Length = 262

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 78/160 (48%), Gaps = 28/160 (17%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCK--QHSMHCTIIISGGDPQKH 126
           +V+LG G      +   RI P+FQ         RL K  +  + +    ++++GG     
Sbjct: 107 LVILGAG------LKGDRITPTFQ--------YRLDKGVEYLRANPELKVVVTGGQGPGE 152

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---IILVSSAY 183
            L E+      L+  G++ D I +E ++  T +N ++++ ++K + G++   I++V++ +
Sbjct: 153 DLTEAEAMKRYLVSHGIDEDRIIMEDRATSTNENMKYTAEVLKQLTGRSDYRIMIVTNDF 212

Query: 184 HLKRSQLYFQHFGI---------NTKASCSDYLNAYYSII 214
           H+ R+++  +H G          N     + Y+  Y++++
Sbjct: 213 HMFRAKILARHNGFTPYGITAPTNPVVLVNSYIREYFAVV 252


>gi|300312530|ref|YP_003776622.1| transmembrane protein [Herbaspirillum seropedicae SmR1]
 gi|300075315|gb|ADJ64714.1| transmembrane protein [Herbaspirillum seropedicae SmR1]
          Length = 269

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 67/132 (50%), Gaps = 15/132 (11%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERD---DIK-LETQSLDTFQNAQFSSSMIKNM 171
           I+++GG+P     +E+ V    L     ERD    ++  E +S  T+ NA  S++M+K  
Sbjct: 142 ILVTGGNPDGSPESEAAVMARTL-----ERDFAVPVRWQEGRSNTTYDNATLSAAMLKEA 196

Query: 172 QGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSII----PLSANFYLTELAL 227
               I+LV+ + H+ R+   F   G+  +A+ + +     + +    P +A+  L   AL
Sbjct: 197 GISRILLVTDSLHMPRAMQVFATTGLQVQAAPTVFAGQARTRVTDYLPNAASLQLASYAL 256

Query: 228 KEYIGILIAYYR 239
           +E+IG L  +YR
Sbjct: 257 REWIGQL--WYR 266


>gi|304316432|ref|YP_003851577.1| hypothetical protein Tthe_0963 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777934|gb|ADL68493.1| protein of unknown function DUF218 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 191

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 57/111 (51%), Gaps = 6/111 (5%)

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           P F+   R+ E ++LYK      +   II+SGG      ++E+      LL++G+  + +
Sbjct: 51  PFFKE--RLSEAIKLYK----EGLGKYIIVSGGKGPGEDISEAEAGKEYLLKNGITDNVV 104

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
            ++  S  T QN + S  ++     K  I+VS+ +HLKR+ +  +  GIN 
Sbjct: 105 LMDDGSYSTLQNLENSKKIMDEKSLKTAIIVSNKFHLKRASIIAKEAGINA 155


>gi|332968000|gb|EGK07087.1| protein of hypothetical function DUF218 [Desmospora sp. 8437]
          Length = 190

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 5/115 (4%)

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
           +PS     R+   + LY     H      II  G     G++E+      L+E GV   D
Sbjct: 54  QPSPALRERLQMALSLY-----HKGQVQWIICSGGVGDDGISEAEGMKRYLMEQGVPPKD 108

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
           + LE +S +T +N Q+S  ++K    +NI LV+  YH+ RS    +  GI  + +
Sbjct: 109 LLLEEESTNTKENLQYSKKLLKPNDIQNIYLVTHDYHMYRSLALARQAGIRAEPA 163


>gi|187934001|ref|YP_001887179.1| integral membrane protein [Clostridium botulinum B str. Eklund 17B]
 gi|187722154|gb|ACD23375.1| integral membrane protein [Clostridium botulinum B str. Eklund 17B]
          Length = 348

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 80/175 (45%), Gaps = 21/175 (12%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           + I++LG+G      +   R+ P   S  RI + +  Y      +    II SGG     
Sbjct: 165 DFIIVLGSG------LIGERVPPLLAS--RIDKAIEFYNKQGAVTNPPKIIFSGGQGSDE 216

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM--QGKNIILVSSAYH 184
            ++E++      ++ G+  ++  LE +S++T QN  FS  ++ N        I V++ +H
Sbjct: 217 KISEALAMQRYAVQKGIPIENTILEDKSVNTLQNMMFSKKIMDNSTPNTHTSIFVTNNFH 276

Query: 185 LKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           L R+ ++ +  G+ ++   S            +A ++L    ++EYI  ++ Y +
Sbjct: 277 LFRAGIFARKAGLKSQGIGSK-----------TAFYFLPNAMIREYIAFVVMYKK 320


>gi|153938260|ref|YP_001392181.1| hypothetical protein CLI_2956 [Clostridium botulinum F str.
           Langeland]
 gi|152934156|gb|ABS39654.1| conserved hypothetical protein [Clostridium botulinum F str.
           Langeland]
          Length = 197

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 56/107 (52%), Gaps = 4/107 (3%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R+ E +RLY           II+SG       ++E+      L++ G+++  I LE +S 
Sbjct: 65  RLDEGLRLY----NEGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSR 120

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
           +T +N +FS   +++    + I+VS+ YHLKR++L  Q  GI    S
Sbjct: 121 NTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQKEGIRASYS 167


>gi|115380347|ref|ZP_01467350.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115362646|gb|EAU61878.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
          Length = 233

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 81/181 (44%), Gaps = 13/181 (7%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQS-YSRIFETMRLYKSCKQHSMHCTIIISGG--DP 123
           + +++LG G  + P        P + +   RI     L +  +       +++SGG  D 
Sbjct: 55  DAVIVLGGG--LDPDATERSGRPEYNAAVERILRGYELLREGRARH----VLLSGGSLDT 108

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
           +   + E+ V   +LL  G+  + I +E  S +T +NA  S  +I+    K ++L++SA 
Sbjct: 109 RPEAVIEATVLQRQLLAWGIAPERIVVEGHSRNTRENALDSKKLIEERGWKTLLLITSAA 168

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYY----SIIPLSANFYLTELALKEYIGILIAYYR 239
           HL R+   F   G+      +D   +      S +P + +   +  AL+E  G ++   R
Sbjct: 169 HLPRAYGCFAAVGLRPDTLAADVRASDGKRPPSWLPRANHLSASTDALRELAGRVVYRLR 228

Query: 240 G 240
           G
Sbjct: 229 G 229


>gi|15599180|ref|NP_252674.1| hypothetical protein PA3985 [Pseudomonas aeruginosa PAO1]
 gi|107103503|ref|ZP_01367421.1| hypothetical protein PaerPA_01004573 [Pseudomonas aeruginosa PACS2]
 gi|9950176|gb|AAG07372.1|AE004816_8 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
          Length = 253

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 83/186 (44%), Gaps = 24/186 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIE-PSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
           P   +  + IV+LG G       PA   + PS  +  R+    RL K+         ++I
Sbjct: 74  PGLAQRADAIVILGAGRQT--NDPAWGDDAPSLLAAERLRYAARLAKTSA-----LPVLI 126

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQ-----SLDTFQNAQFSSSMIKNMQG 173
           SGG       +E+ +  N LL+      D  + T+     S  T++NA  S+  ++    
Sbjct: 127 SGGLHYGRPPSEAALMANALLQ------DFGVPTRWQEGLSRTTWENATLSAPQLREAGV 180

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA-----YYSIIPLSANFYLTELALK 228
           + ++LV+ A+H++R++  F+  G     +   +L       +   +P +  F+ + + L 
Sbjct: 181 RRVVLVTQAWHMQRARWSFERQGFEVIPAPVGFLGGANLRPFGGWLPEAQAFWQSGMLLN 240

Query: 229 EYIGIL 234
           E IG++
Sbjct: 241 EAIGLV 246


>gi|218889732|ref|YP_002438596.1| hypothetical protein PLES_09901 [Pseudomonas aeruginosa LESB58]
 gi|254236878|ref|ZP_04930201.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254242671|ref|ZP_04935993.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|313109425|ref|ZP_07795385.1| hypothetical protein PA39016_001790025 [Pseudomonas aeruginosa
           39016]
 gi|126168809|gb|EAZ54320.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126196049|gb|EAZ60112.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218769955|emb|CAW25717.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
 gi|310881887|gb|EFQ40481.1| hypothetical protein PA39016_001790025 [Pseudomonas aeruginosa
           39016]
          Length = 253

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 83/186 (44%), Gaps = 24/186 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIE-PSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
           P   +  + IV+LG G       PA   + PS  +  R+    RL K+         ++I
Sbjct: 74  PGLAQRADAIVILGAGRQT--NDPAWGDDAPSLLAAERLRYAARLAKTSA-----LPVLI 126

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQ-----SLDTFQNAQFSSSMIKNMQG 173
           SGG       +E+ +  N LL+      D  + T+     S  T++NA  S+  ++    
Sbjct: 127 SGGLHYGRPPSEAALMANALLQ------DFGVPTRWQEGLSRTTWENATLSAPQLREAGV 180

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA-----YYSIIPLSANFYLTELALK 228
           + ++LV+ A+H++R++  F+  G     +   +L       +   +P +  F+ + + L 
Sbjct: 181 RRVVLVTQAWHMQRARWSFERQGFEVIPAPVGFLGGANLRPFGGWLPEAQAFWQSGMLLN 240

Query: 229 EYIGIL 234
           E IG++
Sbjct: 241 EAIGLV 246


>gi|218509953|ref|ZP_03507831.1| hypothetical protein RetlB5_22095 [Rhizobium etli Brasil 5]
          Length = 262

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 104/265 (39%), Gaps = 38/265 (14%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTI--------------------L 45
           +FLI     + CQ +   F +  F L+   + W  +  +                    L
Sbjct: 1   MFLISKLVWIFCQPLSLAFLLVFFALVAGLLRWRALSIVAATASALILFVTLYTTAGNLL 60

Query: 46  LKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS-RIFETMRLY 104
           ++ L+  + +P   P+     N+  ++  G      +   R    F   + R  E +RL 
Sbjct: 61  MQGLEQRFAKPAADPE-----NLQCMIVLGGAFENEVNTARHGIEFNGGADRFVEALRL- 114

Query: 105 KSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES--GVERDDIKLETQSLDTFQNAQ 162
               Q      I++SGGD    G+ E     ++      G+ R+ +  ETQS  TF+NA 
Sbjct: 115 ---AQKFPDSRILVSGGDGSMSGIYEGDAAASERFFPLFGIGRERLIEETQSRTTFENAV 171

Query: 163 FSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-----LNAYYSIIPLS 217
            +   + +    + +L++S +H+ RS   F+  GI+     +DY     +         +
Sbjct: 172 NTREFLASQGLSHCLLITSGFHMPRSVGIFRKLGIDIVPWPTDYRTDGQVRPGLDFTQPN 231

Query: 218 ANFYLTELALKEYIGILIAYYRGNR 242
            N      A++E+ G L+ YY   R
Sbjct: 232 LNAQNMATAIREWYG-LVGYYLAGR 255


>gi|81429248|ref|YP_396249.1| hypothetical protein LSA1636 [Lactobacillus sakei subsp. sakei 23K]
 gi|78610891|emb|CAI55943.1| Hypothetical protein LCA_1636 [Lactobacillus sakei subsp. sakei
           23K]
          Length = 277

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 79/181 (43%), Gaps = 28/181 (15%)

Query: 60  PQWKKDGNIIVLLGNG---TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTI 116
           P++ +D   I++LG+G      +P + A RIE +   Y R           K+      +
Sbjct: 91  PRYNQD--YIIVLGSGLIDGQYVPPLLASRIERAMTFYHR---------QVKKGRPAPKL 139

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN- 175
           + SGG      L ES+      ++ G+  +    E +S++T QN QFS  +I+    K+ 
Sbjct: 140 VFSGGQGGDEKLPESVAMQRYAIDHGIPVEQTLTEEKSVNTLQNMQFSKQIIEADTDKDK 199

Query: 176 --IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
             II  ++ YH  R+ L+ +   +      +            ++ ++L    ++E+I I
Sbjct: 200 PRIIFSTNNYHTFRAGLFAKQAHLKADGIGAK-----------TSKYFLPNATIREFIAI 248

Query: 234 L 234
           L
Sbjct: 249 L 249


>gi|289522163|ref|ZP_06439017.1| conserved hypothetical protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503999|gb|EFD25163.1| conserved hypothetical protein [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 254

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 92/190 (48%), Gaps = 21/190 (11%)

Query: 57  LLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTI 116
           +++P    D   IV+LG G     T    + E S  +  R+F  + L         +  I
Sbjct: 69  MVAPSLPADKAAIVVLGGGQRR--TSDPDKAEVSPHTLMRLFGGIEL-----ALKFNWPI 121

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI 176
           ++ GG      + E++    K+ E   +   I  E+QS  T++N + +SS++++++ K+ 
Sbjct: 122 LLCGGS-YSQEVPEAMTMAKKVKELFPDLP-IYEESQSRTTWENIKNASSILRSLELKHA 179

Query: 177 ILVSSAYHLKRSQLYFQHFGINTK------ASCSDYLNAYYSII---PLSANFYLTELAL 227
           +LV+  YH+ R+ L  Q                +D  NA  SII   P +++ ++  LAL
Sbjct: 180 VLVTHGYHMPRAHLIAQGLAPEINWHPFPVGKMAD--NAPLSIIDFLPGASSLHINSLAL 237

Query: 228 KEYIGILIAY 237
           KE++GI IAY
Sbjct: 238 KEHVGI-IAY 246


>gi|152985105|ref|YP_001346509.1| hypothetical protein PSPA7_1123 [Pseudomonas aeruginosa PA7]
 gi|150960263|gb|ABR82288.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 253

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 16/182 (8%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIE-PSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
           P   +  + IV+LG G     + PA   + PS  +  R+    RL ++         ++ 
Sbjct: 74  PGLAQRADAIVILGAGRQT--SDPAWGDDAPSLLAAERLRYAARLARASS-----LPVLT 126

Query: 119 SGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           SGG       +E+ +  N LLE  GV       E  S  T++NA  S+  ++    + ++
Sbjct: 127 SGGLHYGRPPSEAALMANALLEDFGVPAR--WQEGLSRTTWENATLSAPQLREAGVRRVV 184

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNA-----YYSIIPLSANFYLTELALKEYIG 232
           LV+ A+H++R++  F+  G     +   +L       +   +P +  F+ + + L E +G
Sbjct: 185 LVTQAWHMQRARWSFERQGFEVIPAPVGFLGGANLRPFGGWLPEAQAFWQSGMLLNEAVG 244

Query: 233 IL 234
           +L
Sbjct: 245 LL 246


>gi|113970950|ref|YP_734743.1| hypothetical protein Shewmr4_2615 [Shewanella sp. MR-4]
 gi|113885634|gb|ABI39686.1| protein of unknown function DUF218 [Shewanella sp. MR-4]
          Length = 244

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 82/171 (47%), Gaps = 15/171 (8%)

Query: 68  IIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG--GDPQK 125
           ++++LG+  + IP   A++   S  + +R+ E +R      Q    CT+++SG  G+  +
Sbjct: 78  VVMVLGSAHSDIPGATAVQ-SLSAVALARLTEGLRQL----QLGQDCTLVVSGWEGELTQ 132

Query: 126 HGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHL 185
           H  AE  V     +E GV+   I       DT + A +      N   + + LV+SA H+
Sbjct: 133 HPHAE--VMAKAAVELGVDASRIVQLPLPRDTIEEAHYFKEHFGN---QAVRLVTSASHM 187

Query: 186 KRSQLYFQHFGINTKASCSDY--LNAYYSIIPLSANFYLTELALKEYIGIL 234
            RS   F   G+   A+ +D+   + +Y  +  + N   ++ A+ EYIG L
Sbjct: 188 PRSMAIFSGQGLTASAAPTDFRARDGFYWRL-TADNLLASQRAIHEYIGRL 237


>gi|52143179|ref|YP_083650.1| hypothetical protein BCZK2058 [Bacillus cereus E33L]
 gi|51976648|gb|AAU18198.1| conserved hypothetical protein [Bacillus cereus E33L]
          Length = 185

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 72  AKVIVSGGQGEDEDIPEAHSMRNYLMARGIDESRILIEDQSTNTYENVKFSMDLY---DV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 160


>gi|46143765|ref|ZP_00134210.2| COG1434: Uncharacterized conserved protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208505|ref|YP_001053730.1| hypothetical protein APL_1031 [Actinobacillus pleuropneumoniae L20]
 gi|303251036|ref|ZP_07337222.1| hypothetical protein APP6_0335 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307245941|ref|ZP_07528024.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307250279|ref|ZP_07532233.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307252669|ref|ZP_07534561.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|126097297|gb|ABN74125.1| hypothetical protein APL_1031 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|302650046|gb|EFL80216.1| hypothetical protein APP6_0335 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306853160|gb|EFM85382.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306857720|gb|EFM89822.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306859845|gb|EFM91866.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 246

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 102/236 (43%), Gaps = 24/236 (10%)

Query: 5   WIFLIVSYWHLLCQSIRKIFFMSCFML-LFSFIGWGIIPTILLKHLQFSYQRPLLSPQWK 63
           W+F ++ YW  L +    + F+    L LFS       P +  K          L+ +  
Sbjct: 22  WLFSLICYWLNLKKISYSLAFLGIGSLYLFS------TPYVATKLTDSLVTEDNLTLEDY 75

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           K    IV+LG G        +  I       ++  E MR Y +  Q      ++I+G  P
Sbjct: 76  KKAQAIVVLGGGVR-----DSKEIYNPIAVGNQALERMR-YAAYLQKETQLPLLITGSSP 129

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
             +G +E+    N+  +         LE ++  T +NAQFS  ++       IILV++ +
Sbjct: 130 --NGTSEAKTMANEF-QYFFSVPTQWLEEKAKTTKENAQFSRELLAKEGINKIILVTNQW 186

Query: 184 HLKRSQLYFQHFG-------INTKASCSDYLNAYYSIIPLSANFYLTELALKEYIG 232
           H+KR+++ F+  G       I    + ++Y+N  Y  IP S       L+LKE++G
Sbjct: 187 HMKRAKMLFEKQGFEVLPASIGHGVTPAEYINFAY-FIPQSGAMDSIMLSLKEWLG 241


>gi|307261514|ref|ZP_07543183.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306868797|gb|EFN00605.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 246

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 104/235 (44%), Gaps = 22/235 (9%)

Query: 5   WIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKK 64
           W+F ++ YW     +++KI +   F+ + S   +   P +  K          L+ +  K
Sbjct: 22  WLFSLICYWL----NLKKISYSLAFLGIGSLYLFST-PYVATKLTDSLVTEDNLTLEDYK 76

Query: 65  DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
               IV+LG G        +  I       ++  E MR Y +  Q      ++I+G  P 
Sbjct: 77  KAQAIVVLGGGVR-----DSKEIYNPIAVGNQALERMR-YAAYLQKETQLPLLITGSSP- 129

Query: 125 KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYH 184
            +G +E+    N+  +         LE ++  T +NAQFS  ++       IILV++ +H
Sbjct: 130 -NGTSEAKTMANEF-QYFFSVPTQWLEEKAKTTKENAQFSRELLAKEGINKIILVTNQWH 187

Query: 185 LKRSQLYFQHFG-------INTKASCSDYLNAYYSIIPLSANFYLTELALKEYIG 232
           +KR+++ F+  G       I    + ++Y+N  Y  IP S       L+LKE++G
Sbjct: 188 MKRAKMLFEKQGFEVLPASIGHGVTPTEYINFAY-FIPQSGAMDSIMLSLKEWLG 241


>gi|54309547|ref|YP_130567.1| hypothetical protein PBPRA2380 [Photobacterium profundum SS9]
 gi|46913983|emb|CAG20765.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 284

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 100/207 (48%), Gaps = 14/207 (6%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           ++L +I L++  W    + +   F    F+ +F  + +  I T LL+ L+   Q P +  
Sbjct: 19  LILGFIGLLI-LWFTRRKGLASGFIAFAFLGIF-MVSFQPIATSLLRPLETENQ-PFVPS 75

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
               D   I++LG+G  I   +P I  E S  +  R+ E MR+Y+      +  +    G
Sbjct: 76  STPVD--YIMVLGSGHVIDKAMP-ITSELSRAALMRLSEGMRIYRLFPGSKLILSGYGGG 132

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
            D     ++++ +     L  GV + DI L   + DT++ A  ++S++ +   KN++LV+
Sbjct: 133 SD-----ISQARMMAKVALALGVNKSDILLLETARDTWEEAFQAASVVGD---KNMVLVT 184

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYL 207
           SA H+ R+   F   G+    + +++L
Sbjct: 185 SASHMTRALYEFNQAGLTPTPAPTNFL 211


>gi|313609567|gb|EFR85104.1| integral membrane protein [Listeria monocytogenes FSL F2-208]
          Length = 157

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 65/136 (47%), Gaps = 12/136 (8%)

Query: 105 KSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFS 164
           K   +     T I+SGG      ++E+    + L+  G++   I +E QS++T QN QFS
Sbjct: 9   KQYSKTGKRATFIVSGGQGANETVSEAQAMRDYLISKGIDETFIIMEDQSVNTLQNMQFS 68

Query: 165 -SSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLT 223
            + M   M   N +  ++ +HL R+ LY +  G+ ++            I   +A +Y+ 
Sbjct: 69  KAKMDAIMPVYNSLFSTNNFHLFRAGLYARKAGLKSQG-----------IGAKTALYYMP 117

Query: 224 ELALKEYIGILIAYYR 239
              ++E+I I + Y +
Sbjct: 118 NALIREFIAITVMYKK 133


>gi|190150356|ref|YP_001968881.1| hypothetical protein APP7_1087 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307254915|ref|ZP_07536737.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259356|ref|ZP_07541083.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307263699|ref|ZP_07545307.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189915487|gb|ACE61739.1| hypothetical protein APP7_1087 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306862156|gb|EFM94128.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866592|gb|EFM98453.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306870953|gb|EFN02689.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 246

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 102/236 (43%), Gaps = 24/236 (10%)

Query: 5   WIFLIVSYWHLLCQSIRKIFFMSCFML-LFSFIGWGIIPTILLKHLQFSYQRPLLSPQWK 63
           W+F ++ YW  L +    + F+    L LFS       P +  K          L+ +  
Sbjct: 22  WLFSLICYWLNLKKISYSLAFLGIGSLYLFS------TPYVATKLTDSLVTEDNLALEDY 75

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           K    IV+LG G        +  I       ++  E MR Y +  Q      ++I+G  P
Sbjct: 76  KKAQAIVVLGGGVR-----DSKEIYNPIAVGNQALERMR-YAAYLQKETQLPLLITGSSP 129

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
             +G +E+    N+  +         LE ++  T +NAQFS  ++       IILV++ +
Sbjct: 130 --NGTSEAKTMANEF-QYFFSVPTQWLEEKAKTTKENAQFSRELLAKEGINKIILVTNQW 186

Query: 184 HLKRSQLYFQHFG-------INTKASCSDYLNAYYSIIPLSANFYLTELALKEYIG 232
           H+KR+++ F+  G       I    + ++Y+N  Y  IP S       L+LKE++G
Sbjct: 187 HMKRAKMLFEKQGFEVLPASIGHGVTPAEYINFAY-FIPQSGAMDSIMLSLKEWLG 241


>gi|332307549|ref|YP_004435400.1| hypothetical protein Glaag_3198 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332174878|gb|AEE24132.1| protein of unknown function DUF218 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 251

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 98/220 (44%), Gaps = 15/220 (6%)

Query: 25  FMSCFMLLFSFIGWGIIPTILL-KHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIP 83
           ++SC  +L+ F    + P++LL K L+  Y    +S +  ++ + IV+L         +P
Sbjct: 39  WLSCLPILWVFFCSLVYPSVLLIKPLEDQYPTVKVSSKLWQNADAIVVLACNHFDDEGLP 98

Query: 84  AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES-G 142
            +   P   +  R      +YK       H  I ++ G   +   A    YN   L + G
Sbjct: 99  FVSRWPQC-TMQRNLHAALMYKE-----KHLPIHLAAGILNELDSASQAHYNKTFLMTLG 152

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
           V  +DI    Q  DT       +  +KN   K + LV+SA HL R+  YF+   I     
Sbjct: 153 VSPNDIYTHPQGHDTESEVDALAPHLKN---KYVALVTSASHLPRAVQYFELHDIKVLPI 209

Query: 203 CSDYL---NAYYSI-IPLSANFYLTELALKEYIGILIAYY 238
             ++L   N  ++I +P + + Y +E A+ EY+G++   Y
Sbjct: 210 PVEHLSRKNVSFTIGLPNAFSLYRSERAIHEYLGLIYQRY 249


>gi|146318649|ref|YP_001198361.1| hypothetical protein SSU05_0995 [Streptococcus suis 05ZYH33]
 gi|146320855|ref|YP_001200566.1| hypothetical protein SSU98_1008 [Streptococcus suis 98HAH33]
 gi|253751768|ref|YP_003024909.1| hypothetical protein SSUSC84_0901 [Streptococcus suis SC84]
 gi|253753592|ref|YP_003026733.1| membrane protein [Streptococcus suis P1/7]
 gi|253755527|ref|YP_003028667.1| membrane protein [Streptococcus suis BM407]
 gi|145689455|gb|ABP89961.1| Uncharacterized conserved protein [Streptococcus suis 05ZYH33]
 gi|145691661|gb|ABP92166.1| Uncharacterized conserved protein [Streptococcus suis 98HAH33]
 gi|251816057|emb|CAZ51677.1| putative membrane protein [Streptococcus suis SC84]
 gi|251817991|emb|CAZ55773.1| putative membrane protein [Streptococcus suis BM407]
 gi|251819838|emb|CAR45817.1| putative membrane protein [Streptococcus suis P1/7]
 gi|319758117|gb|ADV70059.1| hypothetical protein SSUJS14_0982 [Streptococcus suis JS14]
          Length = 336

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 89/200 (44%), Gaps = 22/200 (11%)

Query: 16  LCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNG 75
           + QS+  I   S F ++F ++G+ +   I++  L        L   +    + +V+LG G
Sbjct: 118 VVQSLSAI---SFFNMVFVYVGFFVSYAIIISMLYTMSSFVNLVNFFPGKLDYVVVLGAG 174

Query: 76  TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYN 135
                  P +         SRI + + +Y    Q      +I+SGG      +AE     
Sbjct: 175 LIGDKVTPLLA--------SRIEKGIAIY----QKQPGSKLIMSGGQGPDELIAEGQAMA 222

Query: 136 NKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS-----QL 190
           N  LE GV  +DI +E QS +T +N +FS +++K   G    LV++ YH+ R+     QL
Sbjct: 223 NYALEKGVPAEDILIENQSTNTEENLKFSYALMK--PGSRFALVTNYYHVFRALLLARQL 280

Query: 191 YFQHFGINTKASCSDYLNAY 210
             +  G   K      LNA+
Sbjct: 281 RIKCIGYGAKTKFYFSLNAF 300


>gi|323342995|ref|ZP_08083226.1| hypothetical protein HMPREF0357_11407 [Erysipelothrix rhusiopathiae
           ATCC 19414]
 gi|322463059|gb|EFY08254.1| hypothetical protein HMPREF0357_11407 [Erysipelothrix rhusiopathiae
           ATCC 19414]
          Length = 346

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/219 (20%), Positives = 91/219 (41%), Gaps = 42/219 (19%)

Query: 27  SCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGT---TIIPTIP 83
           SCF  +F FI +          L  S+      P   KD + I++LG+G    T +P + 
Sbjct: 145 SCFYFIFVFINF----------LSSSFLYQFFKPH--KDRDFIIVLGSGLRNGTEVPPLL 192

Query: 84  AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
           A RI+ + + Y                ++   +I SGG  +   + E     +  L  G+
Sbjct: 193 AARIDVALEYY-------------HHQTVPPRLIFSGGQGEDECVPEGQAMRDYALNRGI 239

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---IILVSSAYHLKRSQLYFQHFGINTK 200
                 +ET+S  T++N  FS  ++   +  +    +  S+ +H+ R+  Y +  G++  
Sbjct: 240 PESHALMETRSTTTYENMLFSKEIMDTYEFDHPYTCLFSSNTFHIFRASQYARRVGLDAH 299

Query: 201 ASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
              +            +A +++    ++E+I +++ + R
Sbjct: 300 GIGAK-----------TAGYFVPNALIREFIALMVMHRR 327


>gi|307150072|ref|YP_003885456.1| hypothetical protein Cyan7822_0130 [Cyanothece sp. PCC 7822]
 gi|306980300|gb|ADN12181.1| protein of unknown function DUF218 [Cyanothece sp. PCC 7822]
          Length = 278

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 14/113 (12%)

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           GV    I  ++ SL+T++N      ++     K ++LV+SA H+ RS L F+  GI+   
Sbjct: 164 GVPPSAILQDSTSLNTYENVVNVKKILNEKGIKRVLLVTSALHMPRSLLIFKKQGIDVIP 223

Query: 202 SCSDYL--------------NAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           + +D+L                  ++IP +     T  ALKEYIG++I   +G
Sbjct: 224 APTDFLVSQPELEQSDLSVETIMLNLIPDAGRLEGTTKALKEYIGMVIYRLKG 276


>gi|262171274|ref|ZP_06038952.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio mimicus MB-451]
 gi|261892350|gb|EEY38336.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio mimicus MB-451]
          Length = 277

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 88/189 (46%), Gaps = 21/189 (11%)

Query: 27  SCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            C ++LFS  G     +  + T LL  L+ +Y   L       +G I  +++LGNG  + 
Sbjct: 38  GCLVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFL-----PVEGTIDYVMVLGNGHVVD 92

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL 139
             IP    E S  +  R+ E +R+ +      M  +    G +      + + +     L
Sbjct: 93  DDIPPTS-ELSRAALMRLTEGIRISRMYPGSKMILSGYAGGSE-----FSHARMMARVAL 146

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
             GV + DI L   + DT++ A+ +++ +   Q K ++LV+SA H+KR+   F+  G+  
Sbjct: 147 ALGVPKSDIILLETAKDTWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFESAGLTP 203

Query: 200 KASCSDYLN 208
             + ++YL 
Sbjct: 204 IPAPTNYLG 212


>gi|255068087|ref|ZP_05319942.1| putative periplasmic protein [Neisseria sicca ATCC 29256]
 gi|255047685|gb|EET43149.1| putative periplasmic protein [Neisseria sicca ATCC 29256]
          Length = 195

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 87/183 (47%), Gaps = 25/183 (13%)

Query: 39  GIIPTILLKH-----LQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQS 93
           G+IP +L+       L +   +   + Q  K  +I V+LGN           R +P+   
Sbjct: 8   GLIPLLLIWETSVAWLHYQAVQAEKASQNIKPADIAVILGNSVNR-------RGKPNPCL 60

Query: 94  YSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQ 153
            SR+   + LY+  K   +    ++SGG     G  E+    +  ++ G+  + I++E +
Sbjct: 61  RSRVEAGVALYRQNKVSGL----LMSGGT-DGDGSNEAAAMQSMAIDMGIPPEHIRIENK 115

Query: 154 SLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQ-LYFQHF-GINTK----ASCSDYL 207
           S  TF+N   S+ +++++   N+I+VS A+HL R++ L  +H  G N +     SC D  
Sbjct: 116 SESTFENIALSAPLLQDVS--NVIIVSDAFHLARAEWLVNRHLKGKNVQFYASGSCGDST 173

Query: 208 NAY 210
             Y
Sbjct: 174 PNY 176


>gi|227515109|ref|ZP_03945158.1| membrane protein [Lactobacillus fermentum ATCC 14931]
 gi|227086441|gb|EEI21753.1| membrane protein [Lactobacillus fermentum ATCC 14931]
          Length = 308

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 6/106 (5%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R+   + LY+   +  +    I+SGG        E++  +    + GV +  I+LET S 
Sbjct: 166 RLLGGLALYQRFPKAEL----IMSGGQGDDEPEPEAVAMHRFARQKGVPKSAIRLETNST 221

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           +T  N   +   I +  G  ++LV+S YHL RS LY +  G+N + 
Sbjct: 222 NTATNLSEAKRFINS--GDRVVLVTSDYHLLRSLLYARRQGVNCQG 265


>gi|324998768|ref|ZP_08119880.1| hypothetical protein PseP1_08384 [Pseudonocardia sp. P1]
          Length = 346

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 76/177 (42%), Gaps = 31/177 (17%)

Query: 63  KKDGNIIVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
            +  + +V+LG+G   + +P + A RI        R    M              +++SG
Sbjct: 168 DRPADWVVVLGSGLHGSAVPPLLADRIRAGMTELDRRGARM--------------LVLSG 213

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK---NMQGKNII 177
           G      LAE        ++ G +   ++ ET S  T QN + S  +++   +  G  +I
Sbjct: 214 GKGDDERLAEGEAMRRWAVDHGADPALLRAETASRTTEQNLRLSDELVRGDPDPAGPGLI 273

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
            V+S YH+ R+ +  +  G++ +A+ +            +A +Y     L+E++ IL
Sbjct: 274 -VTSDYHVFRAAVLARRLGVDAQAAGAP-----------TAGYYWPSAVLREFVAIL 318


>gi|298527828|ref|ZP_07015232.1| protein of unknown function DUF218 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298511480|gb|EFI35382.1| protein of unknown function DUF218 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 256

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 86/177 (48%), Gaps = 14/177 (7%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           IV+LG+G  +   +P   +  S  S SR+ E +R+    K      T++ +GG   ++ +
Sbjct: 85  IVVLGSGHFLQEGLPPNALL-SQSSLSRVVEGIRI----KNMYPDSTLVFTGGR-FRYPV 138

Query: 129 AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS 188
           A S +     +E G++ +DI +  ++ DT   A  +  ++ +   ++ +LV+SA H+ RS
Sbjct: 139 ASSELAALASVELGIDENDILVVAEAKDTEDEASLARDIVGD---ESFVLVTSASHMHRS 195

Query: 189 QLYFQHFGINTKASCSDY-----LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            + F+  G++   S +D+     L   +   P +     TE    E +G+  A  RG
Sbjct: 196 MIIFKSEGMDPIPSPTDFRAPDKLYNLWDYFPSAGALAKTERVFYERLGLAWAMIRG 252


>gi|296387487|ref|ZP_06876962.1| hypothetical protein PaerPAb_05012 [Pseudomonas aeruginosa PAb1]
          Length = 222

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 83/186 (44%), Gaps = 24/186 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIE-PSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
           P   +  + IV+LG G       PA   + PS  +  R+    RL K+         ++I
Sbjct: 43  PGLAQRADAIVILGAGRQT--NDPAWGDDAPSLLAAERLRYAARLAKTSA-----LPVLI 95

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQ-----SLDTFQNAQFSSSMIKNMQG 173
           SGG       +E+ +  N LL+      D  + T+     S  T++NA  S+  ++    
Sbjct: 96  SGGLHYGRPPSEAALMANALLQ------DFGVPTRWQEGLSRTTWENATLSAPQLREAGV 149

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA-----YYSIIPLSANFYLTELALK 228
           + ++LV+ A+H++R++  F+  G     +   +L       +   +P +  F+ + + L 
Sbjct: 150 RRVVLVTQAWHMQRARWSFERQGFEVIPAPVGFLGGANLRPFGGWLPEAQAFWQSGMLLN 209

Query: 229 EYIGIL 234
           E IG++
Sbjct: 210 EAIGLV 215


>gi|325000419|ref|ZP_08121531.1| hypothetical protein PseP1_16707 [Pseudonocardia sp. P1]
          Length = 334

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 73/172 (42%), Gaps = 20/172 (11%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           + +V+LG G       P +R        SR+   + L +          ++ SGG     
Sbjct: 160 DFVVVLGAGLIRGKVTPLLR--------SRLDRAIALRRREMGMGNDPVLVTSGGRGPDE 211

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHL 185
            LAE+      LLE GV  D +  E +S  T +N  FS  ++     +   ++V++ +H+
Sbjct: 212 PLAEAEAMAGYLLEQGVPEDAVLREDRSRTTLENLTFSDRLMAGRVPRYRCVVVTNNFHV 271

Query: 186 KRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            R+ L  +  G++ +   S            +A +Y     ++E++ IL A+
Sbjct: 272 FRTALLARQAGVDAQVLGSP-----------TARYYWPSATIREFVAILAAH 312


>gi|258621490|ref|ZP_05716524.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258586878|gb|EEW11593.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 287

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 88/189 (46%), Gaps = 21/189 (11%)

Query: 27  SCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            C ++LFS  G     +  + T LL  L+ +Y   L       +G I  +++LGNG  + 
Sbjct: 47  GCLVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFL-----PVEGTIDYVMVLGNGHVVD 101

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL 139
             IP    E S  +  R+ E +R+ +      M  +    G +      + + +     L
Sbjct: 102 DDIPPTS-ELSRAALMRLTEGIRISRMYPGSKMILSGYAGGSE-----FSHARMMARVAL 155

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
             GV + DI L   + DT++ A+ +++ +   Q K ++LV+SA H+KR+   F+  G+  
Sbjct: 156 ALGVPKSDIILLETAKDTWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFESAGLTP 212

Query: 200 KASCSDYLN 208
             + ++YL 
Sbjct: 213 IPAPTNYLG 221


>gi|229824214|ref|ZP_04450283.1| hypothetical protein GCWU000282_01518 [Catonella morbi ATCC 51271]
 gi|229786568|gb|EEP22682.1| hypothetical protein GCWU000282_01518 [Catonella morbi ATCC 51271]
          Length = 341

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 81/174 (46%), Gaps = 29/174 (16%)

Query: 69  IVLLG---NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQK 125
           IV+LG   NGT + P +            SRI + ++L++   Q     T+I+SGG    
Sbjct: 170 IVVLGAGLNGTEVTPLLA-----------SRIDKAIKLWRRRPQD---VTLIMSGGQGPD 215

Query: 126 HGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHL 185
             ++E        L  GV +  I ++ QS +T +N  FS  +++  + ++ ++V++ YHL
Sbjct: 216 EVISEGEAMKAYALRQGVPQSAILVDNQSRNTHENLLFSYKLMEKGR-EDFVIVTNYYHL 274

Query: 186 KRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
            RS +  +  G+  +   +     Y+SI             L+E+IG L   +R
Sbjct: 275 LRSLILARRLGLKCQGYGAK-TKLYFSI----------NAFLREFIGYLTLAWR 317


>gi|254506071|ref|ZP_05118215.1| integral membrane protein [Vibrio parahaemolyticus 16]
 gi|219550889|gb|EED27870.1| integral membrane protein [Vibrio parahaemolyticus 16]
          Length = 268

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 101/223 (45%), Gaps = 33/223 (14%)

Query: 28  CFMLLFSFIGWGIIP-----TILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           CF++LFSFIG  +I      + LL  L+  Y     S  +  D +I  +++LG+G  +  
Sbjct: 39  CFIVLFSFIGMFLIAFQPVSSRLLMPLERQY-----SAFFPVDESIDYVMVLGSGHVVDD 93

Query: 81  TIPAIRIEPSFQSYSRIFE---TMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNK 137
            IP    E S     R+ E    MR+Y   K        +I  G      ++ + +    
Sbjct: 94  KIPPTS-ELSRTGLMRLAEGIRVMRIYPGSK--------LILSGYSGGSDISNARMMAKV 144

Query: 138 LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
            L  GV + DI L   + DT++ A+ +++ +K+   K +++V+SA H+KR+   F   G+
Sbjct: 145 ALALGVSKSDIILLETAKDTWEEARQAAAFVKH---KKMVVVTSASHMKRALNEFHSAGL 201

Query: 198 NTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIGIL 234
               + ++YL        +    P +     TE    E +GIL
Sbjct: 202 KPYPAPTNYLAHDNVTEPWSKYTPKAVYLEQTERYWHETLGIL 244


>gi|308179164|ref|YP_003918570.1| hypothetical protein AARI_34120 [Arthrobacter arilaitensis Re117]
 gi|307746627|emb|CBT77599.1| conserved hypothetical membrane protein [Arthrobacter arilaitensis
           Re117]
          Length = 342

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 65/140 (46%), Gaps = 11/140 (7%)

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           K D   +V+LG  T      P +R         R+ + + L +   QHS    ++ +GG 
Sbjct: 161 KADSAAVVVLGARTIKGKVTPLLR--------GRLDKGIELQQ--LQHSPRPFMVPTGGQ 210

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN-IILVSS 181
                  E +     L E G++   I +E ++ DT +N +FS+++I+  +    + LV+S
Sbjct: 211 GHDEVEPEGVSMAKYLQEQGIDEAQILIEDRAKDTMENLRFSNALIREQRPDGQLWLVTS 270

Query: 182 AYHLKRSQLYFQHFGINTKA 201
            YH  R  +  +  G++ +A
Sbjct: 271 DYHALRVAMASRQLGLDARA 290


>gi|119775365|ref|YP_928105.1| hypothetical protein Sama_2230 [Shewanella amazonensis SB2B]
 gi|119767865|gb|ABM00436.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 245

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 66/136 (48%), Gaps = 6/136 (4%)

Query: 102 RLYKSCKQHSM--HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQ 159
           RL +  KQ S+   CT+I+SG     +  A + V     +E GV    I     + DT +
Sbjct: 105 RLTEGLKQMSLGQDCTLIVSGYRSDYNRFAHADVMKQAAMELGVPEAQIIALPLARDTLE 164

Query: 160 NAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSAN 219
            A+   ++   +QG  + LV+SA H+ R+   F H GI   A+ +D+     +   L+A+
Sbjct: 165 EARQIKAL--GLQGA-LRLVTSAAHMPRAMAMFAHEGITADAAPTDFTARQSTWWRLNAD 221

Query: 220 -FYLTELALKEYIGIL 234
                + A+ EY+G L
Sbjct: 222 ALNSAQKAIHEYVGTL 237


>gi|30262287|ref|NP_844664.1| hypothetical protein BA_2278 [Bacillus anthracis str. Ames]
 gi|47527579|ref|YP_018928.1| hypothetical protein GBAA_2278 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49185134|ref|YP_028386.1| hypothetical protein BAS2124 [Bacillus anthracis str. Sterne]
 gi|49479213|ref|YP_036390.1| hypothetical protein BT9727_2062 [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|65319584|ref|ZP_00392543.1| COG1434: Uncharacterized conserved protein [Bacillus anthracis str.
           A2012]
 gi|118477705|ref|YP_894856.1| hypothetical protein BALH_2039 [Bacillus thuringiensis str. Al
           Hakam]
 gi|167632793|ref|ZP_02391119.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|177649292|ref|ZP_02932294.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|196039956|ref|ZP_03107259.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|196046918|ref|ZP_03114139.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|218903420|ref|YP_002451254.1| hypothetical protein BCAH820_2304 [Bacillus cereus AH820]
 gi|225864256|ref|YP_002749634.1| hypothetical protein BCA_2360 [Bacillus cereus 03BB102]
 gi|229600915|ref|YP_002866624.1| hypothetical protein BAA_2343 [Bacillus anthracis str. A0248]
 gi|254684861|ref|ZP_05148721.1| hypothetical protein BantC_13530 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254722269|ref|ZP_05184057.1| hypothetical protein BantA1_07359 [Bacillus anthracis str. A1055]
 gi|254737308|ref|ZP_05195012.1| hypothetical protein BantWNA_19319 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254743507|ref|ZP_05201192.1| hypothetical protein BantKB_21307 [Bacillus anthracis str. Kruger
           B]
 gi|254751624|ref|ZP_05203661.1| hypothetical protein BantV_04116 [Bacillus anthracis str. Vollum]
 gi|254760143|ref|ZP_05212167.1| hypothetical protein BantA9_17676 [Bacillus anthracis str.
           Australia 94]
 gi|30256918|gb|AAP26150.1| conserved hypothetical protein [Bacillus anthracis str. Ames]
 gi|47502727|gb|AAT31403.1| conserved hypothetical protein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49179061|gb|AAT54437.1| conserved hypothetical protein [Bacillus anthracis str. Sterne]
 gi|49330769|gb|AAT61415.1| conserved hypothetical protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|118416930|gb|ABK85349.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|167531605|gb|EDR94270.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|172084366|gb|EDT69424.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|196022293|gb|EDX60979.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|196029215|gb|EDX67819.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|218536887|gb|ACK89285.1| conserved hypothetical protein [Bacillus cereus AH820]
 gi|225786065|gb|ACO26282.1| conserved hypothetical protein [Bacillus cereus 03BB102]
 gi|229265323|gb|ACQ46960.1| conserved hypothetical protein [Bacillus anthracis str. A0248]
          Length = 185

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 72  VKVIVSGGQGEDEDIPEAHSMRNYLMARGIDESRILIEDQSTNTYENVKFSMDLY---DV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 160


>gi|326939983|gb|AEA15879.1| putative cytoplasmic protein [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 185

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 72  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY---NV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 160


>gi|307721211|ref|YP_003892351.1| hypothetical protein Saut_1291 [Sulfurimonas autotrophica DSM
           16294]
 gi|306979304|gb|ADN09339.1| protein of unknown function DUF218 [Sulfurimonas autotrophica DSM
           16294]
          Length = 248

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 61/108 (56%), Gaps = 7/108 (6%)

Query: 133 VYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
           V N KL  + G++ +D+ +  +  DT + A F+ +++ N   ++ ILV+SA H+ R+ + 
Sbjct: 140 VMNAKLANALGIKYEDMIINGKPTDTKEEALFTKTLVGN---ESFILVTSATHMPRAMML 196

Query: 192 FQHFGINTKASCSDYLNAY---YSIIPLSANFYLTELALKEYIGILIA 236
           F   G++   + ++Y  +    Y   P    F+++ +A+ EY+GIL A
Sbjct: 197 FTSLGMHPIPAPTNYYKSEFRGYLRAPDPGCFFISSIAIHEYLGILWA 244


>gi|167464933|ref|ZP_02330022.1| hypothetical Membrane Spanning Protein [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382670|ref|ZP_08056534.1| hypothetical protein PL1_1385 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153368|gb|EFX45791.1| hypothetical protein PL1_1385 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 365

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 104/237 (43%), Gaps = 30/237 (12%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +L+ WI  +++   L+    + +F     +LL+ F+    I   L   + + + +P    
Sbjct: 125 LLVYWIISLMNPTELISDDWKILFTGVSAILLYMFMD---IANFLTASILYQFNKP---- 177

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
             K + + +++ G+G       P +         SRI + +  Y    + +    +I SG
Sbjct: 178 --KYNQDFVIVHGSGLIHDKVPPLLA--------SRIDKAIEFYWMQSKVASPPKLIFSG 227

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK--NIIL 178
           G      ++E+       +E G+  +D   E QS  T++N  +S  +++++ G+  N I 
Sbjct: 228 GKGSDENVSEAEAMQIYAIEKGIPIEDTIQENQSRSTYENLLYSKRIMESINGEKYNSIF 287

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           VS+ +H+ R+ +Y +  G+++    S            +  +Y     ++EYI I +
Sbjct: 288 VSNNFHIFRAGMYARQLGLDSHCIGSK-----------TVFYYWLNAMIREYIAIFV 333


>gi|302185148|ref|ZP_07261821.1| hypothetical protein Psyrps6_02354 [Pseudomonas syringae pv.
           syringae 642]
          Length = 256

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 84/196 (42%), Gaps = 31/196 (15%)

Query: 56  PLLSPQWK---KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI---FETMRLYKSCKQ 109
           PL   QW    +  + IV+LGNG          R  P++ + +      E +RL     +
Sbjct: 67  PLPQQQWATLAQQADAIVVLGNGRE--------RNSPTWGTDTPTGLGLERLRLAARLAK 118

Query: 110 HSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL-----ETQSLDTFQNAQFS 164
            S    I+ SGG       +E+ +    L      +DD  +     E  S  T++NA  S
Sbjct: 119 ES-GLPILTSGGLHFDQPPSEAAIMAQSL------QDDFAVTVRWQEGLSRTTWENATMS 171

Query: 165 SSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN-----AYYSIIPLSAN 219
           +++++    K ++LV+ A+H+ R++  F+  G     +   +L       +   +P S  
Sbjct: 172 AAILQPQGIKRVVLVTQAWHMPRARWSFEQAGFTVVGAPVGFLGVDNARPFAGWLPESRV 231

Query: 220 FYLTELALKEYIGILI 235
           F  + + L E  G+L+
Sbjct: 232 FTQSGMLLNEAAGLLV 247


>gi|165976456|ref|YP_001652049.1| hypothetical protein APJL_1049 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|307257077|ref|ZP_07538852.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|165876557|gb|ABY69605.1| hypothetical protein APJL_1049 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|306864448|gb|EFM96356.1| Molybdate ABC transporter permease protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 246

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 36/242 (14%)

Query: 5   WIFLIVSYWHLLCQSIRKIFFMSCFML-LFSFIGWGIIPTILLKHLQFSYQRPLLSPQWK 63
           W+F ++ YW  L +    + F+    L LFS       P +  K          L+ +  
Sbjct: 22  WLFSLICYWLNLKKISYSLAFLGIGSLYLFS------TPYVATKLTDSLVTEDNLALEDY 75

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI------FETMRLYKSCKQHSMHCTII 117
           K    IV+LG G           +  S + Y+ I       E MR Y +  Q      ++
Sbjct: 76  KKAQAIVVLGGG-----------VRDSKEIYNPIVVGNQALERMR-YAAYLQKETQLPLL 123

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           I+G  P  +G +E+    N+  +         LE ++  T +NAQFS  ++       II
Sbjct: 124 ITGSSP--NGTSEAKTMANEF-QYFFSVPTQWLEEKAKTTKENAQFSRELLAKEGINKII 180

Query: 178 LVSSAYHLKRSQLYFQHFG-------INTKASCSDYLNAYYSIIPLSANFYLTELALKEY 230
           LV++ +H+KR+++ F+  G       I    + ++Y+N  Y  IP S       L+LKE+
Sbjct: 181 LVTNQWHMKRAKMLFEKQGFEVLPASIGHGVTPAEYINFAY-FIPQSGAMDSIMLSLKEW 239

Query: 231 IG 232
           +G
Sbjct: 240 LG 241


>gi|324998494|ref|ZP_08119606.1| hypothetical protein PseP1_06982 [Pseudonocardia sp. P1]
          Length = 334

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 75/172 (43%), Gaps = 20/172 (11%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           + +V+LG G       P +R        SR+   + L +          ++ SGG     
Sbjct: 160 DFVVVLGAGLIRGKVTPLLR--------SRLDRAIALRERETGTGNDPVLVTSGGRGPDE 211

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN-MQGKNIILVSSAYHL 185
            +AE+      LLE GV  D +  E +S  T +N  F+  ++ + + G   ++V++ +H+
Sbjct: 212 PVAEAEAMAGYLLEQGVPEDAVLREDRSRTTLENLTFTDRLMADRVPGYRCVVVTNNFHV 271

Query: 186 KRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            R+ L  +  G++     S            +A +YL    ++E++ IL ++
Sbjct: 272 FRTALLARQSGVDGHVLGSP-----------TARYYLPSATIREFVAILASH 312


>gi|170744388|ref|YP_001773043.1| hypothetical protein M446_6345 [Methylobacterium sp. 4-46]
 gi|168198662|gb|ACA20609.1| protein of unknown function DUF218 [Methylobacterium sp. 4-46]
          Length = 273

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 71/163 (43%), Gaps = 6/163 (3%)

Query: 85  IRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP--QKHGLAESIVYNNKLLESG 142
           IR E      +R  + +  + +  +      ++ +GG    ++ GL E+      L E G
Sbjct: 95  IRAERGAPGLNREADRLVAFAALARRYPAAKLVFAGGPASGRREGLTEAQASRALLEEIG 154

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG----IN 198
           +    + ++ +S  T++NA  + ++ +   G+  +LV+SA H+ R+   F+  G    + 
Sbjct: 155 LPPGRLLVDDRSRSTWENAVEARALARPGPGETWLLVTSASHMPRAMGAFRRAGWPPLLA 214

Query: 199 TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
              +         ++ PL A     +LA  E+ G+L    RG 
Sbjct: 215 WPVAYRTTRRGAAALRPLGAKLAAIDLAAHEWAGLLAYRLRGR 257


>gi|329118151|ref|ZP_08246863.1| protein of hypothetical function DUF218 [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327465811|gb|EGF12084.1| protein of hypothetical function DUF218 [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 222

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 84/193 (43%), Gaps = 26/193 (13%)

Query: 14  HLLCQSIRKIFFMSCFMLLFSFI--GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVL 71
           H+L  S+ + F +S  ++L  F+   W +  T           R  L PQ    G+  V+
Sbjct: 12  HILWGSLWRGFAISVALVLLFFVWCAWSVYRT----------GRDGL-PQ-GYTGDAAVV 59

Query: 72  LGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES 131
           LG         P  R         RI   + LY+S +   +    + +GG  +K  ++E 
Sbjct: 60  LGAAAWDARPSPVFR--------ERINHAVGLYRSGRVRKL----VFTGGAVKKGYMSEG 107

Query: 132 IVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLY 191
            V     L+ GV  +DI LE +S  T++N  +  + ++    + I++VS   HL R+   
Sbjct: 108 EVGRRYALKQGVPAEDILLENKSRTTYENLAYLRAPLREAGLRKIVIVSDPPHLARAAAV 167

Query: 192 FQHFGINTKASCS 204
            +  G++ + S +
Sbjct: 168 ARDLGLDAQVSPT 180


>gi|54025401|ref|YP_119643.1| hypothetical protein nfa34310 [Nocardia farcinica IFM 10152]
 gi|54016909|dbj|BAD58279.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 315

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           ++++GG+PQ +G+ E+    N L+  G+    I +E ++  T QNA FS+ +++++   +
Sbjct: 194 VVVTGGNPQ-NGITEAEAMRNWLVGRGLPAARIHVENRAGSTVQNALFSTRLLRDIGASS 252

Query: 176 IILVSSAYHLKRSQLYFQHFGI 197
            ++V+S  H++R+   F   GI
Sbjct: 253 AVVVTSPNHIRRAVADFIVAGI 274


>gi|206971658|ref|ZP_03232608.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|206733643|gb|EDZ50815.1| conserved hypothetical protein [Bacillus cereus AH1134]
          Length = 185

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 51/93 (54%), Gaps = 3/93 (3%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
              +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +     
Sbjct: 71  EAKVIVSGGQGEDEDIPEAHSMRNYLMARGIDESRILIEDQSTNTYENLKFSMDLY---N 127

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
            K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 128 VKHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 160


>gi|33593317|ref|NP_880961.1| hypothetical protein BP2323 [Bordetella pertussis Tohama I]
 gi|33572673|emb|CAE42596.1| conserved hypothetical membrane protein [Bordetella pertussis
           Tohama I]
 gi|332382726|gb|AEE67573.1| hypothetical protein BPTD_2282 [Bordetella pertussis CS]
          Length = 254

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 88/213 (41%), Gaps = 16/213 (7%)

Query: 36  IGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS 95
           + W +  T L        + P L P      + IV+LG  T       A      F  Y 
Sbjct: 48  LAWSLPATSLWLGGALESRYPHLPPDQSPTADAIVVLGGNT-------ANGRANWFLPYD 100

Query: 96  RIFETMRLYKSCK--QHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQ 153
           +    +R+  + +  Q      +++SGG  +   ++E+     ++ + GV    + LE  
Sbjct: 101 KETAVVRVDTATELFQAGRASKVVLSGGALEGD-ISEARGMAYRMRQHGVPESALILENA 159

Query: 154 SLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS------CSDYL 207
           S  T++NA  +   ++    + ++LV+SA H+ R+   F   G+   A+       +   
Sbjct: 160 SRTTYENAALTEDTLRQHGIQKVLLVTSALHMPRAMAAFSKQGVQAIAAPAPPQIVAPAD 219

Query: 208 NAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            +    +P   +F  +   +KEY G+ + + RG
Sbjct: 220 GSLSPWLPDQRSFDASRSIIKEYAGLFVYWLRG 252


>gi|302536555|ref|ZP_07288897.1| conserved hypothetical protein [Streptomyces sp. C]
 gi|302445450|gb|EFL17266.1| conserved hypothetical protein [Streptomyces sp. C]
          Length = 337

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 81/173 (46%), Gaps = 20/173 (11%)

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKS-CKQHSMHCTIIISGG 121
           + D + +V+LG+G      I   R+ P   S  R+ +  ++Y++   + S    ++ SGG
Sbjct: 155 RGDVDHVVMLGSGL-----IGGDRVPPLLAS--RLRKGQQIYEAQLARGSRPPVLLTSGG 207

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGKNIILVS 180
                 ++E+    + L+  GV  + +KLE  S  T +N  FS   M+ +  G   ++V+
Sbjct: 208 KGSDERVSEARAMADWLIAEGVPAEHVKLEENSATTEENMLFSKGIMLADKPGYRCVVVT 267

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           + +H  R+ +  +  G+N +   S            +A ++L    L+E++ +
Sbjct: 268 NNFHAFRAAMLARKTGVNGQVLGSP-----------TARYFLPSALLREFVAV 309


>gi|165870553|ref|ZP_02215207.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167639676|ref|ZP_02397946.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170686976|ref|ZP_02878195.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|170706657|ref|ZP_02897116.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|190565393|ref|ZP_03018313.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|196033843|ref|ZP_03101254.1| conserved hypothetical protein [Bacillus cereus W]
 gi|227814904|ref|YP_002814913.1| hypothetical protein BAMEG_2315 [Bacillus anthracis str. CDC 684]
 gi|228927349|ref|ZP_04090406.1| hypothetical protein bthur0010_20610 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228933586|ref|ZP_04096436.1| hypothetical protein bthur0009_20510 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228945900|ref|ZP_04108243.1| hypothetical protein bthur0007_20530 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229091270|ref|ZP_04222488.1| hypothetical protein bcere0021_20850 [Bacillus cereus Rock3-42]
 gi|229121834|ref|ZP_04251054.1| hypothetical protein bcere0016_21340 [Bacillus cereus 95/8201]
 gi|164713708|gb|EDR19231.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167512385|gb|EDR87761.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170128388|gb|EDS97256.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|170669027|gb|EDT19771.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|190563420|gb|EDV17385.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|195993523|gb|EDX57480.1| conserved hypothetical protein [Bacillus cereus W]
 gi|227005837|gb|ACP15580.1| conserved hypothetical protein [Bacillus anthracis str. CDC 684]
 gi|228661623|gb|EEL17243.1| hypothetical protein bcere0016_21340 [Bacillus cereus 95/8201]
 gi|228692036|gb|EEL45777.1| hypothetical protein bcere0021_20850 [Bacillus cereus Rock3-42]
 gi|228813774|gb|EEM60052.1| hypothetical protein bthur0007_20530 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228826046|gb|EEM71829.1| hypothetical protein bthur0009_20510 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228832245|gb|EEM77825.1| hypothetical protein bthur0010_20610 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 166

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 53  VKVIVSGGQGEDEDIPEAHSMRNYLMARGIDESRILIEDQSTNTYENVKFSMDLY---DV 109

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 110 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 141


>gi|149191740|ref|ZP_01869980.1| hypothetical protein VSAK1_04082 [Vibrio shilonii AK1]
 gi|148834429|gb|EDL51426.1| hypothetical protein VSAK1_04082 [Vibrio shilonii AK1]
          Length = 297

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 83/175 (47%), Gaps = 21/175 (12%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET---MRLYKSCKQHSMHCTIIISGGDPQK 125
           +++LG G  +   IP    E S  S  R+ E    +R+Y   K       +I+SG D   
Sbjct: 82  VMVLGGGHVVDDQIPPTS-ELSRASLMRLSEGIRILRMYPGAK-------LILSGYD-GG 132

Query: 126 HGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHL 185
            G++ +       L  G+ + DI L   + DT++ A+ ++  ++N   K ++LV+SA H+
Sbjct: 133 TGVSHARTMAKVALALGIAKPDIILLETAKDTWEEARQAAGFVQN---KKLVLVTSASHM 189

Query: 186 KRSQLYFQHFGINTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIGIL 234
           KR+   F+  G+N   + +++L       A+    P S     TE    E +G++
Sbjct: 190 KRAMHEFEAAGLNPLPAPTNFLAQKDIEQAWQKYTPSSRYLEQTERYWHETMGLI 244


>gi|116052024|ref|YP_789133.1| hypothetical protein PA14_12270 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115587245|gb|ABJ13260.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 253

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 83/186 (44%), Gaps = 24/186 (12%)

Query: 60  PQWKKDGNIIVLLGNGTTIIPTIPAIRIE-PSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
           P   +  + IV+LG G       PA   + PS  +  R+    RL K+         ++I
Sbjct: 74  PGLAQRADAIVILGVGRQT--NDPAWGDDAPSLLAAERLRYAARLAKTSA-----LPVLI 126

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQ-----SLDTFQNAQFSSSMIKNMQG 173
           SGG       +E+ +  N LL+      D  + T+     S  T++NA  S+  ++    
Sbjct: 127 SGGLHYGRPPSEAALMANALLQ------DFGVPTRWQEGLSRTTWENATLSAPQLREAGV 180

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA-----YYSIIPLSANFYLTELALK 228
           + ++LV+ A+H++R++  F+  G     +   +L       +   +P +  F+ + + L 
Sbjct: 181 RRVVLVTQAWHMQRARWSFERQGFEVIPAPVGFLGGANLRPFGGWLPEAQAFWQSGMLLN 240

Query: 229 EYIGIL 234
           E IG++
Sbjct: 241 EAIGLV 246


>gi|167947128|ref|ZP_02534202.1| probable transmembrane protein [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 250

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 72/152 (47%), Gaps = 10/152 (6%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL-ESGVERDDIKLETQ 153
           +R  E +R Y +         +I SGG P   G  E+ +    L  E GV    I  E  
Sbjct: 102 ARELERLR-YAAKLARQTGLPVIPSGGAPIYFGEPEAKIAARILQDEFGVSVSQI--EAA 158

Query: 154 SLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL------ 207
           S  T+ NA+ S+ ++K +  K ++LV++A H++R+   F+  G+   A+ + ++      
Sbjct: 159 SNTTWDNARLSAQLLKKLGIKQVLLVTNALHMRRAIYAFERNGVEVIAAPTSFIHKTNTR 218

Query: 208 NAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
           + +   +P          A+ EY+G+L  Y++
Sbjct: 219 HVWLEGLPNGLAVKNVAYAMHEYVGLLWYYFK 250


>gi|28211594|ref|NP_782538.1| membrane associated protein [Clostridium tetani E88]
 gi|28204035|gb|AAO36475.1| membrane associated protein [Clostridium tetani E88]
          Length = 192

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 79/162 (48%), Gaps = 16/162 (9%)

Query: 38  WGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI 97
           +GII T++L    + + R   + + +K   II+L   G ++    P+    P  Q   RI
Sbjct: 14  FGIILTLILGMNIYLFGR---NSKAEKSDCIIIL---GCSVYGETPS----PFLQW--RI 61

Query: 98  FETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDT 157
            E  RLYK          I+ SGG      ++E+      L+  G++ + I  E +S  T
Sbjct: 62  EEGYRLYK----EGYGRYILASGGKGPGESISEAEAMKRYLISKGIKEEYIIKEDKSTST 117

Query: 158 FQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
            +N +  + +++    KN ++VS+ YHLKR+ L  +  GI++
Sbjct: 118 MENLKNCNKIMEKKGLKNAVIVSNKYHLKRASLMTKKVGIDS 159


>gi|323524387|ref|YP_004226540.1| hypothetical protein BC1001_0013 [Burkholderia sp. CCGE1001]
 gi|323381389|gb|ADX53480.1| protein of unknown function DUF218 [Burkholderia sp. CCGE1001]
          Length = 186

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 56/108 (51%), Gaps = 1/108 (0%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SR+   +   + C  + +   I +SGG   K G  E+    + L++ G+ ++ I ++   
Sbjct: 50  SRLSARLDRARQCYDNGLCHQIFVSGG-IDKQGTDEARAMEDYLVKRGIPKERIVMDNMG 108

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
           LDT+   + +S+ ++    K+ ++V+  +H+ R+ L  + FGIN  A 
Sbjct: 109 LDTWDTVRNASAYMQTHHLKSALVVTQYFHVPRAALALRRFGINHVAG 156


>gi|228914883|ref|ZP_04078488.1| hypothetical protein bthur0012_21100 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228844679|gb|EEM89725.1| hypothetical protein bthur0012_21100 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 166

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 51/90 (56%), Gaps = 3/90 (3%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      K+
Sbjct: 55  VIVSGGQGEDEDIPEAHSMRNYLMARGIDESRILIEDQSTNTYENVKFSMDLY---DVKH 111

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSD 205
            ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 112 AVVVSNTYHLYRTKIIAKRLGMKMEALAAE 141


>gi|326776386|ref|ZP_08235651.1| protein of unknown function DUF218 [Streptomyces cf. griseus
           XylebKG-1]
 gi|326656719|gb|EGE41565.1| protein of unknown function DUF218 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 336

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 77/180 (42%), Gaps = 19/180 (10%)

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           ++  + +V+LG+G     T+P +         SR+     ++    +      +I SGG 
Sbjct: 155 RRKADFVVVLGSGLVGGSTVPPL-------LASRLKRGQAVHARLSRRGGSPVLITSGGQ 207

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSS 181
                L ES    + L+  G     I+ E +S +T +N +FS ++++  +     ++V++
Sbjct: 208 GPDEDLPESHAMADHLVAEGFPEHLIEREDRSTNTEENLRFSKAIMEKAKPDYRCVVVTN 267

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
            YH  R+ L  +   I  +   S            +A ++     L+E+  IL+ Y R N
Sbjct: 268 NYHAFRAALTARRVRIRGQVVGSP-----------TAAYFWPNATLREFTAILVDYRRSN 316


>gi|218897246|ref|YP_002445657.1| hypothetical protein BCG9842_B3064 [Bacillus cereus G9842]
 gi|228939435|ref|ZP_04102023.1| hypothetical protein bthur0008_20940 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228965253|ref|ZP_04126347.1| hypothetical protein bthur0004_20910 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228972289|ref|ZP_04132901.1| hypothetical protein bthur0003_20630 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228978903|ref|ZP_04139269.1| hypothetical protein bthur0002_21040 [Bacillus thuringiensis Bt407]
 gi|218541132|gb|ACK93526.1| conserved hypothetical protein [Bacillus cereus G9842]
 gi|228780777|gb|EEM28989.1| hypothetical protein bthur0002_21040 [Bacillus thuringiensis Bt407]
 gi|228787434|gb|EEM35401.1| hypothetical protein bthur0003_20630 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228794487|gb|EEM41999.1| hypothetical protein bthur0004_20910 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228820135|gb|EEM66172.1| hypothetical protein bthur0008_20940 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 178

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 65  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY---NV 121

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 122 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 153


>gi|292487838|ref|YP_003530713.1| hypothetical protein EAMY_1355 [Erwinia amylovora CFBP1430]
 gi|292899065|ref|YP_003538434.1| membrane protein [Erwinia amylovora ATCC 49946]
 gi|291198913|emb|CBJ46023.1| putative membrane protein [Erwinia amylovora ATCC 49946]
 gi|291553260|emb|CBA20305.1| Uncharacterized protein ycbC [Erwinia amylovora CFBP1430]
          Length = 262

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 86/183 (46%), Gaps = 26/183 (14%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
           IV+LG G T       ++  PS      S  R+ E +R++++  Q      +I +GG  Q
Sbjct: 82  IVVLGGGYTW-----NLQWAPSSNMLNNSLPRLAEGIRIWRANPQ----AKLIFTGGKAQ 132

Query: 125 KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYH 184
            + ++ + V  +     GV    I +  +  DT Q A   + ++ N   +   LV+SA H
Sbjct: 133 HNPMSSAAVTASVAQSLGVPAAAIIILDKPRDTEQEAHEVAKIVHN---QPFALVTSANH 189

Query: 185 LKRSQLYFQHFGIN------TKASCSDYLNAYYSIIPLSANFYL--TELALKEYIGILIA 236
           L R+  +FQ+ G+        + + +  LN +  ++P S  F+L  +E AL E IG L  
Sbjct: 190 LPRAIRFFQYQGLQPWPAPANQLAVASPLNVWERVLPSS--FWLGHSERALYENIGRLWQ 247

Query: 237 YYR 239
           + +
Sbjct: 248 WLK 250


>gi|325276217|ref|ZP_08142016.1| hypothetical protein G1E_22290 [Pseudomonas sp. TJI-51]
 gi|324098646|gb|EGB96693.1| hypothetical protein G1E_22290 [Pseudomonas sp. TJI-51]
          Length = 253

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 87/196 (44%), Gaps = 32/196 (16%)

Query: 56  PLLSPQWKK---DGNIIVLLGNGTTIIPTIPAIRIEPSF----QSYSRIFETMRLYKSCK 108
           PL    W +     + IV+LG G          R +P++    Q  +   E MR      
Sbjct: 67  PLAVSDWARLASRADAIVVLGAGRE--------RGDPAWGGGDQPTATALERMRFAARLA 118

Query: 109 QHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQ-----SLDTFQNAQF 163
           + S    ++ SGG       +E+ +  ++L      R+D  +E +     S  T++NAQ 
Sbjct: 119 KAS-GLPVLTSGGLHYGTPPSEAQLMADRL------REDFAVEVRWREEASRTTWENAQL 171

Query: 164 SSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN-----AYYSIIPLSA 218
           S+ +++ +  + +++V+ A+H++RS+  F+  G     +   +L       +  ++P S 
Sbjct: 172 SAKVLQPLGIRRVVVVTQAWHMQRSRWSFEQAGFEVVPAPVGFLGREHARPFGGLLPESR 231

Query: 219 NFYLTELALKEYIGIL 234
             + +   L E +G++
Sbjct: 232 AMWQSGQLLNEVVGLV 247


>gi|311899501|dbj|BAJ31909.1| hypothetical protein KSE_61430 [Kitasatospora setae KM-6054]
          Length = 330

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 97/225 (43%), Gaps = 36/225 (16%)

Query: 16  LCQSIRKIFFMSCFM--LLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG 73
           L    R +F ++C++  L   F+G+            + Y R  L P  ++D + +V+LG
Sbjct: 121 LVTVARTVFAVACYLSFLFACFVGY-----------AYLYGR--LIP--REDVDYVVVLG 165

Query: 74  NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIV 133
            G      +   R+ P   S  R+    RLY+          +++SGG      L E+  
Sbjct: 166 AGL-----LDGSRVPPLLAS--RLDRGRRLYERQVDRGRSPLLLVSGGKGGDEQLPEADA 218

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYF 192
               L+E G   D I  E +S  T +N +FS +++         ++V++ +H  R+ ++ 
Sbjct: 219 MAGYLVERGFPADRIVREDRSATTEENLRFSHAIMAAADPDYRCVVVTNNFHAFRAAVFA 278

Query: 193 QHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
           +  G+      S          P +A F+ +   ++E++ +++ Y
Sbjct: 279 RREGVRGHVVGS----------PTAAYFWPSA-TIREFVALIVVY 312


>gi|323493229|ref|ZP_08098358.1| hypothetical protein VIBR0546_19494 [Vibrio brasiliensis LMG 20546]
 gi|323312495|gb|EGA65630.1| hypothetical protein VIBR0546_19494 [Vibrio brasiliensis LMG 20546]
          Length = 267

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 93/195 (47%), Gaps = 37/195 (18%)

Query: 28  CFMLLFSFIGWGIIP-----TILLKHLQFSYQR--PLLSPQWKKDGNIIVLLGNGTTIIP 80
           CF++LFSFIG  +I      + LL  L+  Y    P+  P      + +++LG+G  +  
Sbjct: 39  CFVVLFSFIGIFLIAFQPVSSRLLMPLERQYSAFFPVDEPI-----DYVMVLGSGHVVDD 93

Query: 81  TIPAIRIEPSFQSYSRIFE---TMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNK 137
            IP    E S     R+ E    +R+Y   K       +I+SG        A S V N +
Sbjct: 94  KIPPTS-ELSRTGLMRLSEGIRILRIYPGAK-------LILSGYA------AGSEVSNAR 139

Query: 138 LLES-----GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYF 192
           ++       GV + DI L   + DT++ A+ +++ +     K +++V+SA H+KR+   F
Sbjct: 140 MMAKVALALGVAKSDIILLETAKDTWEEARQAAAFVST---KKLVVVTSASHMKRALNEF 196

Query: 193 QHFGINTKASCSDYL 207
              G+   A+ ++YL
Sbjct: 197 HSAGLKPYAAPTNYL 211


>gi|312171960|emb|CBX80217.1| Uncharacterized protein ycbC [Erwinia amylovora ATCC BAA-2158]
          Length = 262

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 86/183 (46%), Gaps = 26/183 (14%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
           IV+LG G T       ++  PS      S  R+ E +R++++  Q      +I +GG  Q
Sbjct: 82  IVVLGGGYTW-----NLQWAPSSNMLNNSLPRLAEGIRIWRANPQ----AKLIFTGGKAQ 132

Query: 125 KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYH 184
            + ++ + V  +     GV    I +  +  DT Q A   + ++ N   +   LV+SA H
Sbjct: 133 HNPMSSAAVTASVAQSLGVPAAAIIILDKPRDTEQEAHEVAKIVHN---QPFALVTSANH 189

Query: 185 LKRSQLYFQHFGIN------TKASCSDYLNAYYSIIPLSANFYL--TELALKEYIGILIA 236
           L R+  +FQ+ G+        + + +  LN +  ++P S  F+L  +E AL E IG L  
Sbjct: 190 LPRAIRFFQYQGLQPWPAPANQLAVASPLNVWERVLPSS--FWLGHSERALYENIGRLWQ 247

Query: 237 YYR 239
           + +
Sbjct: 248 WLK 250


>gi|144900194|emb|CAM77058.1| Protein of unknown function DUF218 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 167

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 54/104 (51%), Gaps = 2/104 (1%)

Query: 110 HSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK 169
           HS     ++  G    H   E++V  +  + +G++ D I +E QS +T  NA++ + +I 
Sbjct: 41  HSGRVAHLLMSGGAVNHPTPEALVMRDLAMAAGIDADRIVVEDQSRNTIGNARYCAPIIV 100

Query: 170 NMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS--DYLNAYY 211
                 ++LV+ ++HL R++L F   G+    S +  + +NA +
Sbjct: 101 AQGWTRLLLVTDSFHLPRARLIFARHGLKVALSGARPESVNAEW 144


>gi|182435761|ref|YP_001823480.1| hypothetical protein SGR_1968 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178464277|dbj|BAG18797.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 336

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 77/180 (42%), Gaps = 19/180 (10%)

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           ++  + +V+LG+G     T+P +         SR+     ++    +      +I SGG 
Sbjct: 155 RRKADFVVVLGSGLVGGSTVPPL-------LASRLKRGQAVHARLSRRGGSPVLITSGGQ 207

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSS 181
                L ES    + L+  G     I+ E +S +T +N +FS ++++  +     ++V++
Sbjct: 208 GPDEDLPESHAMADHLVAEGFPEHLIEREDRSTNTEENLRFSKAIMEKAKPDYRCVVVTN 267

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
            YH  R+ L  +   I  +   S            +A ++     L+E+  IL+ Y R N
Sbjct: 268 NYHAFRAALTARRVRIRGQVVGSP-----------TAAYFWPNATLREFTAILVDYRRSN 316


>gi|222095875|ref|YP_002529932.1| cytoplasmic protein [Bacillus cereus Q1]
 gi|221239933|gb|ACM12643.1| hypothetical Cytosolic Protein [Bacillus cereus Q1]
          Length = 185

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 63/121 (52%), Gaps = 14/121 (11%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS   I     
Sbjct: 72  VKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENVKFS---IDLYDV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           K+ ++VS+ YHL R+++  +  G+  +A  ++         P+ +     ++ ++EY+ I
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE--------TPIRSK---RKMYVREYVAI 177

Query: 234 L 234
           +
Sbjct: 178 M 178


>gi|239944530|ref|ZP_04696467.1| hypothetical protein SrosN15_26272 [Streptomyces roseosporus NRRL
           15998]
 gi|239990990|ref|ZP_04711654.1| hypothetical protein SrosN1_27034 [Streptomyces roseosporus NRRL
           11379]
 gi|291447993|ref|ZP_06587383.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
 gi|291350940|gb|EFE77844.1| conserved hypothetical protein [Streptomyces roseosporus NRRL
           15998]
          Length = 336

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 77/180 (42%), Gaps = 19/180 (10%)

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           ++  + +V+LG+G     T+P +         SR+     ++    +      +I SGG 
Sbjct: 155 RRKADFVVVLGSGLVGGSTVPPL-------LASRLKRGQAVHARLARRGGSPVLITSGGQ 207

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSS 181
                L ES    + L+  G     I+ E +S +T +N +FS ++++  +     ++V++
Sbjct: 208 GPDEDLPESHAMADHLVAQGFPAHLIEREDRSTNTEENLRFSKAIMEKAKPDYRCVVVTN 267

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
            YH  R+ L  +   I  +   S            +A ++     L+E+  IL+ Y R N
Sbjct: 268 NYHAFRAALTARRVRIRGQVVGSP-----------TAAYFWPNATLREFAAILVDYRRSN 316


>gi|220935848|ref|YP_002514747.1| hypothetical protein Tgr7_2685 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997158|gb|ACL73760.1| conserved protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 251

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 87/212 (41%), Gaps = 25/212 (11%)

Query: 35  FIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSY 94
           F GW      LL  L+  Y  P+  P  +  G I+VL G      P      + P   S 
Sbjct: 49  FAGW------LLAGLERGY--PVAPPLPEAAGAIVVLAGGRHPDAPEYGGETVSP--HSL 98

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
            R+    RL++          +++SGG  +    A        +LE  +       ET+S
Sbjct: 99  ERLRYGARLHRDTG-----LPLLVSGGRVRGDEPAAEADLLADVLEGELGVAVRWRETES 153

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQH-------FGINTKASCSDYL 207
            +T +NA FS+ ++     ++ +LVS A H+ R+   FQ        F        S + 
Sbjct: 154 RNTCENALFSAHLLAEAGIEHALLVSHALHMPRAVWCFQRTELAVTPFPTLPMGDLSRH- 212

Query: 208 NAYYSIIPLSANFYLTELALKEYIGILIAYYR 239
                ++P     +LT  AL EY+G++  +YR
Sbjct: 213 RGITVVLPQPRALWLTGQALHEYLGLV--WYR 242


>gi|33596348|ref|NP_883991.1| hypothetical protein BPP1716 [Bordetella parapertussis 12822]
 gi|33602366|ref|NP_889926.1| hypothetical protein BB3392 [Bordetella bronchiseptica RB50]
 gi|33566117|emb|CAE37017.1| conserved hypothetical membrane protein [Bordetella parapertussis]
 gi|33576805|emb|CAE33884.1| conserved hypothetical membrane protein [Bordetella bronchiseptica
           RB50]
          Length = 254

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 88/213 (41%), Gaps = 16/213 (7%)

Query: 36  IGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS 95
           + W +  T L        + P L P      + IV+LG  T       A      F  Y 
Sbjct: 48  LAWSLPATSLWLGGALESRYPHLPPDQSPTADAIVVLGGNT-------ANGRANWFLPYD 100

Query: 96  RIFETMRLYKSCK--QHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQ 153
           +    +R+  + +  Q      +++SGG  +   ++E+     ++ + GV    + LE  
Sbjct: 101 KETAVVRVDTATELFQAGRAPKVVLSGGALEGD-ISEARGMAYRMRQHGVPESALILENA 159

Query: 154 SLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS------CSDYL 207
           S  T++NA  +   ++    + ++LV+SA H+ R+   F   G+   A+       +   
Sbjct: 160 SRTTYENAALTEDTLRQHGIQKVLLVTSALHMPRAMAAFSKQGVQAIAAPAPPQIVAPAD 219

Query: 208 NAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            +    +P   +F  +   +KEY G+ + + RG
Sbjct: 220 GSLSPWLPDQRSFDASRSIIKEYAGLFVYWLRG 252


>gi|228985374|ref|ZP_04145533.1| hypothetical protein bthur0001_20700 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228774327|gb|EEM22734.1| hypothetical protein bthur0001_20700 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 201

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 63/121 (52%), Gaps = 14/121 (11%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS   I     
Sbjct: 88  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENVKFS---IDLYDV 144

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           K+ ++VS+ YHL R+++  +  G+  +A  ++         P+ +     ++ ++EY+ I
Sbjct: 145 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE--------TPIRSK---RKMYVREYVAI 193

Query: 234 L 234
           +
Sbjct: 194 M 194


>gi|184155411|ref|YP_001843751.1| hypothetical protein LAF_0935 [Lactobacillus fermentum IFO 3956]
 gi|183226755|dbj|BAG27271.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|299783224|gb|ADJ41222.1| Putative uncharacterized protein [Lactobacillus fermentum CECT
           5716]
          Length = 308

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 6/106 (5%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R+   + LY+   +  +    I+SGG        E++  +    + GV    I+LET S 
Sbjct: 166 RLLGGLALYQRFPKAEL----IMSGGQGDDEPEPEAVAMHRFARQKGVPESAIRLETNST 221

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           +T  N   +   I +  G  ++LV+S YHL RS LY +  G+N + 
Sbjct: 222 NTATNLSEAKRFINS--GDRVVLVTSDYHLLRSLLYARRQGVNCQG 265


>gi|315444167|ref|YP_004077046.1| hypothetical protein Mspyr1_25770 [Mycobacterium sp. Spyr1]
 gi|315262470|gb|ADT99211.1| uncharacterized conserved protein [Mycobacterium sp. Spyr1]
          Length = 185

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
              II++GG+P ++G  E+      L   G  R+ I LE ++  T QNA FS  + +   
Sbjct: 70  QAPIIVTGGNP-RNGNTEAEQMGKMLRLYGTPRERIILEERANSTVQNAAFSVPLAEQAG 128

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
              IILV+S+ H  R+   F   G N  A+ S
Sbjct: 129 ASGIILVTSSSHQDRADGIFADAGGNVLATVS 160


>gi|114319324|ref|YP_741007.1| hypothetical protein Mlg_0162 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225718|gb|ABI55517.1| protein of unknown function DUF218 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 247

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 87/198 (43%), Gaps = 27/198 (13%)

Query: 56  PLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCT 115
           P + P   +D   IV+LG G        +   E S ++ + +      Y +         
Sbjct: 64  PPVQPAQLRDAQAIVVLGAGYR------SGADEFSGETVNDLALVRLRYAAYLHRETGLP 117

Query: 116 IIISGG-----DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
           +I SGG     +P+   +AE       L E GV  D I  E+++ DT+ NAQ ++ ++  
Sbjct: 118 VIASGGAATDREPEARWMAEV------LAEFGV--DPILTESEARDTWGNAQHTAELLAR 169

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS------DYLNAYYSIIPLSANFYLTE 224
                + LVS A+H+ R+   F+  G+    + +      D   ++  + P +    ++ 
Sbjct: 170 QGLSRVALVSHAHHMPRAVWAFEQAGVTVLPAPTGAFVPHDRGWSWGMLRPQANALRMSW 229

Query: 225 LALKEYIGILIAYYRGNR 242
           LA+ EY+G+   +YR  R
Sbjct: 230 LAMHEYLGLF--WYRWMR 245


>gi|323137866|ref|ZP_08072941.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
 gi|322396869|gb|EFX99395.1| protein of unknown function DUF218 [Methylocystis sp. ATCC 49242]
          Length = 263

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 67/138 (48%), Gaps = 7/138 (5%)

Query: 106 SCKQHSMHCTIIISGGDPQKHG--LAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQF 163
           + K+   +  I+ +GG     G    E+        + G++  DI  E +S +TF+NA F
Sbjct: 114 ALKRRYPNARIVFTGGTAALRGSPFTEAEGVKRFWRDVGLDAGDILYEDRSRNTFENAIF 173

Query: 164 SSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-LNAYYS-IIPLSA--N 219
           +  +++   G+  +LV+SA H+ RS   F+       A   DY  N  +S I+P  A   
Sbjct: 174 TRELVQPKPGERWLLVTSAMHMPRSIGIFRKANFPVIAYPVDYRTNGKFSFILPRFAVKA 233

Query: 220 FYLTELALKEYIGILIAY 237
             + E A  E++G L+AY
Sbjct: 234 IGVVEFAAHEWMG-LVAY 250


>gi|260662077|ref|ZP_05862973.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
 gi|260553460|gb|EEX26352.1| conserved hypothetical protein [Lactobacillus fermentum 28-3-CHN]
          Length = 308

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 6/106 (5%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R+   + LY+   +  +    I+SGG        E++  +    + GV    I+LET S 
Sbjct: 166 RLLGGLALYQCFPKAEL----IMSGGQGDDEPEPEAVAMHRFARQKGVPESAIRLETNST 221

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           +T  N   +   I +  G  ++LV+S YHL RS LY +  G+N + 
Sbjct: 222 NTATNLSEAKRFINS--GDRVVLVTSDYHLLRSLLYARRQGVNCQG 265


>gi|190149832|ref|YP_001968357.1| hypothetical protein APP7_0563 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307249724|ref|ZP_07531703.1| hypothetical protein appser4_5270 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307263153|ref|ZP_07544774.1| hypothetical protein appser13_5750 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189914963|gb|ACE61215.1| hypothetical protein APP7_0563 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306858232|gb|EFM90309.1| hypothetical protein appser4_5270 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306871515|gb|EFN03238.1| hypothetical protein appser13_5750 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 252

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 75/179 (41%), Gaps = 24/179 (13%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI------FETMRLYKSCKQHSMHCTII 117
           K    IV+LG G           +  S + + R        E MR Y +         I+
Sbjct: 80  KKAQAIVVLGGG-----------VRNSHELFGRYAIAAAPLERMR-YAAYLHKQTGLPIL 127

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ++GG P+       I+     L          +E+ S  T QNA  S +M+K      II
Sbjct: 128 VTGGSPEGREPEAKIIAQE--LHDFFNVSVKWVESASNTTEQNAILSKAMLKQEGIDRII 185

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY----YSIIPLSANFYLTELALKEYIG 232
           LV++ +H+KR+++ F+  G N  A+ +    A        IP +     + +ALKE+IG
Sbjct: 186 LVTNQWHMKRAKMLFEREGFNVLAAGTTAHQALDIGILPFIPQAQALQNSSIALKEWIG 244


>gi|114765476|ref|ZP_01444586.1| hypothetical protein 1100011001321_R2601_10319 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542186|gb|EAU45217.1| hypothetical protein R2601_10319 [Roseovarius sp. HTCC2601]
          Length = 156

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
           EPS     R    + L++S +        I+  G    H  +E+ V      E+GV  + 
Sbjct: 14  EPSPTLRRRAKRAVALWQSGE-----VGAILGCGGEGAHAPSEAEVICRLAREAGVPEEA 68

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL 207
           +  E +S  T +N +F+  +++ M   ++++VS AYHL R+ L  +  G+  + +     
Sbjct: 69  LFREDRSTTTEENLRFALPVLEEMGAHDVVIVSEAYHLPRALLVARRLGLRARGAAPGLG 128

Query: 208 NA 209
            A
Sbjct: 129 GA 130


>gi|238916610|ref|YP_002930127.1| hypothetical protein EUBELI_00667 [Eubacterium eligens ATCC 27750]
 gi|238871970|gb|ACR71680.1| Hypothetical protein EUBELI_00667 [Eubacterium eligens ATCC 27750]
          Length = 258

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query: 115 TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK 174
           TII+SGG  +     E+    N L+  G++   I  E  S DT +N ++S   I+N    
Sbjct: 142 TIIVSGGRGKGENTTEAFAMYNYLVSKGIDGSRIIQEDNSTDTSENMKYSVQYIENTDSL 201

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYL-TELALKEYIGI 233
            + +V++ +H+ RS+L  +H G+N   +C          +P  ++  L     ++E IGI
Sbjct: 202 -VGIVTNNFHIARSRLLARHAGLNN--TCG---------MPAESDHVLFINYMVREAIGI 249

Query: 234 LIAYYRGN 241
           +  +  GN
Sbjct: 250 VKDFVFGN 257


>gi|145223836|ref|YP_001134514.1| hypothetical protein Mflv_3249 [Mycobacterium gilvum PYR-GCK]
 gi|145216322|gb|ABP45726.1| protein of unknown function DUF218 [Mycobacterium gilvum PYR-GCK]
          Length = 202

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
              II++GG+P ++G  E+      L   G  R+ I LE ++  T QNA FS  + +   
Sbjct: 87  QAPIIVTGGNP-RNGNTEAEQMGKMLRLYGTPRERIILEERANSTVQNAAFSVPLAEQAG 145

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
              IILV+S+ H  R+   F   G N  A+ S
Sbjct: 146 ASGIILVTSSSHQDRADGIFADAGGNVLATVS 177


>gi|270291245|ref|ZP_06197467.1| hypothetical protein HMPREF9024_01427 [Pediococcus acidilactici
           7_4]
 gi|270280091|gb|EFA25927.1| hypothetical protein HMPREF9024_01427 [Pediococcus acidilactici
           7_4]
          Length = 342

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 15/127 (11%)

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN- 175
           I+SGG      ++E+      L    V  D I LE QS  T QN +FS   I+    K+ 
Sbjct: 204 IVSGGQGPDEPVSEAYAMAKYLKSQHVPEDKIILEDQSTTTLQNMKFSKQKIEKDWKKSG 263

Query: 176 ---IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIG 232
              +I  ++ YH+ RS +Y +  G+N     S            ++ ++L    ++EYI 
Sbjct: 264 VPKVIFATNNYHVLRSAIYARKAGLNANGVGSP-----------TSFYFLPSALIREYIA 312

Query: 233 ILIAYYR 239
           +L+ Y +
Sbjct: 313 LLVIYKK 319


>gi|219855730|ref|YP_002472852.1| hypothetical protein CKR_2387 [Clostridium kluyveri NBRC 12016]
 gi|219569454|dbj|BAH07438.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 199

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           II+SGG      ++E+    N L+  G++   + +E +S+ T +N   S  +++    K 
Sbjct: 79  IIVSGGKGPGENISEAKAMKNYLVYKGIDSSRVIMEDKSMSTMENLSNSKRVMEEKGLKT 138

Query: 176 IILVSSAYHLKRSQLYFQHFGIN 198
            ++VS+ YHLKR+ L  +  GI 
Sbjct: 139 AVIVSNKYHLKRASLMAESHGIE 161


>gi|229190360|ref|ZP_04317361.1| hypothetical protein bcere0002_20280 [Bacillus cereus ATCC 10876]
 gi|228593144|gb|EEK50962.1| hypothetical protein bcere0002_20280 [Bacillus cereus ATCC 10876]
          Length = 185

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             II+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 72  AKIIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY---NV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 160


>gi|206973669|ref|ZP_03234587.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217959789|ref|YP_002338341.1| hypothetical protein BCAH187_A2388 [Bacillus cereus AH187]
 gi|206747825|gb|EDZ59214.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217068109|gb|ACJ82359.1| conserved hypothetical protein [Bacillus cereus AH187]
          Length = 185

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 63/121 (52%), Gaps = 14/121 (11%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS   I     
Sbjct: 72  VKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDERRILIEDQSTNTYENVKFS---IDLYDV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           K+ ++VS+ YHL R+++  +  G+  +A  ++         P+ +     ++ ++EY+ I
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE--------TPIRSK---RKMYVREYVAI 177

Query: 234 L 234
           +
Sbjct: 178 M 178


>gi|228900868|ref|ZP_04065083.1| hypothetical protein bthur0014_20700 [Bacillus thuringiensis IBL
           4222]
 gi|228858794|gb|EEN03239.1| hypothetical protein bthur0014_20700 [Bacillus thuringiensis IBL
           4222]
          Length = 166

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 52/92 (56%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   ++E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 53  AKVIVSGGQGEDEDISEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY---NV 109

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 110 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 141


>gi|153955310|ref|YP_001396075.1| hypothetical protein CKL_2692 [Clostridium kluyveri DSM 555]
 gi|146348168|gb|EDK34704.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
          Length = 196

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           II+SGG      ++E+    N L+  G++   + +E +S+ T +N   S  +++    K 
Sbjct: 76  IIVSGGKGPGENISEAKAMKNYLVYKGIDSSRVIMEDKSMSTMENLSNSKRVMEEKGLKT 135

Query: 176 IILVSSAYHLKRSQLYFQHFGIN 198
            ++VS+ YHLKR+ L  +  GI 
Sbjct: 136 AVIVSNKYHLKRASLMAESHGIE 158


>gi|229155866|ref|ZP_04283967.1| hypothetical protein bcere0010_20560 [Bacillus cereus ATCC 4342]
 gi|228627473|gb|EEK84199.1| hypothetical protein bcere0010_20560 [Bacillus cereus ATCC 4342]
          Length = 166

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 63/121 (52%), Gaps = 14/121 (11%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS   I     
Sbjct: 53  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENVKFS---IDLYDV 109

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           K+ ++VS+ YHL R+++  +  G+  +A  ++         P+ +     ++ ++EY+ I
Sbjct: 110 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE--------TPIRSK---RKMYVREYVAI 158

Query: 234 L 234
           +
Sbjct: 159 M 159


>gi|254504841|ref|ZP_05116992.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222440912|gb|EEE47591.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 268

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 105/248 (42%), Gaps = 27/248 (10%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKD 65
           + LIVS    L +  R+  ++    L+    G+     +L++ L+  + RP     +   
Sbjct: 25  VGLIVSMGTRLQKWGRRFIWVGALGLVIC--GFSPAANLLIQPLEDRFSRPAELGSF--- 79

Query: 66  GNIIVLLGNGTTIIPTIPAIRIEPSFQ-SYSRIFETMRLYKSCKQ----HSMHCTIIISG 120
            N +++LG     + T    R E +   S  R+    RL K   +    H+     II+G
Sbjct: 80  -NGVIILGGAVDTVVT--GARGETALTVSGERLTIAARLAKQLPEALIIHTGGQGTIITG 136

Query: 121 GDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILV 179
              +  G        ++L +  G+    I LE +S +T++NA  +  ++    G+  +LV
Sbjct: 137 QATESEG-------ASRLFDDFGIASQRIILEDESRNTWENAVLTKELVDPKPGQTWLLV 189

Query: 180 SSAYHLKRSQLYFQHFG-INTKASCSDYLNAYYSIIPL-----SANFYLTELALKEYIGI 233
           +SAYH+ RS   F+  G     A   DY     +   L     S      ++ ++E+IG+
Sbjct: 190 TSAYHMPRSMGVFEAAGWTGVTAYPVDYRTRGGADWGLGFDGASKGLRRLDIGVREWIGL 249

Query: 234 LIAYYRGN 241
            + +  G 
Sbjct: 250 TVYWMTGR 257


>gi|322807220|emb|CBZ04794.1| hypothetical protein H04402_02990 [Clostridium botulinum H04402
           065]
          Length = 197

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           II+SG       ++E+      L++ G+++  I LE +S +T +N +FS   +++    +
Sbjct: 81  IIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIILEDKSRNTLENIKFSKKKMEDNNLSS 140

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCS 204
            I+VS+ YHLKR++L  Q  GI  KAS S
Sbjct: 141 SIIVSNKYHLKRAELLCQKEGI--KASYS 167


>gi|304384982|ref|ZP_07367328.1| conserved hypothetical protein [Pediococcus acidilactici DSM 20284]
 gi|304329176|gb|EFL96396.1| conserved hypothetical protein [Pediococcus acidilactici DSM 20284]
          Length = 338

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 15/127 (11%)

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN- 175
           I+SGG      ++E+      L    V  D I LE QS  T QN +FS   I+    K+ 
Sbjct: 204 IVSGGQGPDEPVSEAYAMAKYLKSQHVPEDKIILEDQSTTTLQNMKFSKQKIEKDWKKSG 263

Query: 176 ---IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIG 232
              +I  ++ YH+ RS +Y +  G+N     S            ++ ++L    ++EYI 
Sbjct: 264 VPKVIFATNNYHVLRSAIYARKAGLNANGVGSP-----------TSFYFLPSALIREYIA 312

Query: 233 ILIAYYR 239
           +L+ Y +
Sbjct: 313 LLVIYKK 319


>gi|117921230|ref|YP_870422.1| hypothetical protein Shewana3_2789 [Shewanella sp. ANA-3]
 gi|117613562|gb|ABK49016.1| protein of unknown function DUF218 [Shewanella sp. ANA-3]
          Length = 244

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 84/171 (49%), Gaps = 15/171 (8%)

Query: 68  IIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG--GDPQK 125
           ++++LG+  + IP   A++   S  + +R+ E +R  K  +     CT+++SG  G+  +
Sbjct: 78  VVMVLGSAHSDIPGATAVQ-SLSTVALARLTEGLRQLKLGQD----CTLVVSGWEGELTQ 132

Query: 126 HGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHL 185
           H  AE  V     +E GV+   I       DT + A +     ++   + + LV+SA H+
Sbjct: 133 HPHAE--VMAKAAVELGVDATRIVQLPLPRDTIEEAHY---FKEHFGDQAVRLVTSASHM 187

Query: 186 KRSQLYFQHFGINTKASCSDY--LNAYYSIIPLSANFYLTELALKEYIGIL 234
            RS   F   G+   A+ +D+   + +Y  +  + N   ++ A+ EYIG L
Sbjct: 188 PRSMAIFSGQGLTASAAPTDFRARDGFYWRL-TADNLLASQRAIHEYIGRL 237


>gi|114776481|ref|ZP_01451526.1| probable transmembrane protein [Mariprofundus ferrooxydans PV-1]
 gi|114553311|gb|EAU55709.1| probable transmembrane protein [Mariprofundus ferrooxydans PV-1]
          Length = 257

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 85/186 (45%), Gaps = 15/186 (8%)

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           Q K D + IV+LG G  + P  P    + S      +  T  LY +      +  +  +G
Sbjct: 76  QMKADDSAIVVLGGG--LYPRAPEYGGQDSLHD-DGLMRT--LYAADLALKSNLDVYATG 130

Query: 121 GDPQKHGLAE--SIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIIL 178
           G   K G AE   ++    L+  GV+ + I  E ++  T++N  +   M+K      IIL
Sbjct: 131 G-AFKPGQAEPEGLIMARMLIRFGVDPEHIHSENRARTTWENGLYIRDMMKKAGIHRIIL 189

Query: 179 VSSAYHLKRSQLYFQHFGINTKASCSDY---LNAY--YSIIPLSANFYLTELALKEYIGI 233
           V++A+H+ RS   F+  G++  A+   Y     AY   S +P       +   L EY+G+
Sbjct: 190 VTTAWHMPRSVRVFESLGMHVIAAPCSYRAGRQAYDLRSYLPRWNVLSDSGDGLHEYLGL 249

Query: 234 LIAYYR 239
           L  +YR
Sbjct: 250 L--WYR 253


>gi|307245325|ref|ZP_07527413.1| hypothetical protein appser1_5300 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307254278|ref|ZP_07536118.1| hypothetical protein appser9_5280 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258738|ref|ZP_07540470.1| hypothetical protein appser11_5360 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306853666|gb|EFM85883.1| hypothetical protein appser1_5300 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306862757|gb|EFM94711.1| hypothetical protein appser9_5280 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867089|gb|EFM98945.1| hypothetical protein appser11_5360 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 252

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 75/179 (41%), Gaps = 24/179 (13%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI------FETMRLYKSCKQHSMHCTII 117
           K    IV+LG G           +  S + + R        E MR Y +         I+
Sbjct: 80  KKAQAIVVLGGG-----------VRNSHELFGRYTIAAAPLERMR-YAAYLHKQTGLPIL 127

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ++GG P+       I+     L          +E+ S  T QNA  S +M+K      II
Sbjct: 128 VTGGSPEGREPEAKIMAQE--LHDFFNVSVKWVESASNTTEQNAILSKAMLKQESIDRII 185

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY----YSIIPLSANFYLTELALKEYIG 232
           LV++ +H+KR+++ F+  G N  A+ +    A        IP +     + +ALKE+IG
Sbjct: 186 LVTNQWHMKRTKMLFEREGFNVLAAGTTAHQALDIGILPFIPQAQALQNSSIALKEWIG 244


>gi|223933030|ref|ZP_03625024.1| protein of unknown function DUF218 [Streptococcus suis 89/1591]
 gi|302023799|ref|ZP_07249010.1| membrane protein [Streptococcus suis 05HAS68]
 gi|330832826|ref|YP_004401651.1| hypothetical protein SSUST3_1032 [Streptococcus suis ST3]
 gi|223898347|gb|EEF64714.1| protein of unknown function DUF218 [Streptococcus suis 89/1591]
 gi|329307049|gb|AEB81465.1| protein of unknown function DUF218 [Streptococcus suis ST3]
          Length = 336

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 11/121 (9%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SRI + + +Y    Q      +I+SGG      +AE     N  LE G+  +DI +E QS
Sbjct: 186 SRIDKGIAIY----QKQPGSKLIMSGGQGPDELIAEGQAMANYALEQGIPAEDIIIENQS 241

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS-----QLYFQHFGINTKASCSDYLNA 209
            +T +N +FS +++K   G    LV++ YH+ R+     QL  +  G   K      LNA
Sbjct: 242 TNTEENLKFSYALMK--PGSRFALVTNYYHVFRALLLARQLKIKCIGYGAKTKFYFSLNA 299

Query: 210 Y 210
           +
Sbjct: 300 F 300


>gi|191639632|ref|YP_001988798.1| hypothetical protein LCABL_28900 [Lactobacillus casei BL23]
 gi|190713934|emb|CAQ67940.1| Putative exported protein [Lactobacillus casei BL23]
 gi|327383745|gb|AEA55221.1| hypothetical protein LC2W_2892 [Lactobacillus casei LC2W]
          Length = 377

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 7/114 (6%)

Query: 83  PAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESG 142
           P  +++P+ +    I       K+ K++     I+++GG P+ + L E+ V    L+  G
Sbjct: 213 PNGKMQPTMKKRLEI-----ALKAAKKYP-KSKILVAGGVPE-NKLTEATVMQKWLVAHG 265

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG 196
           + +  I+LE  S +T +NA FS   + N +  +  L++SA H++R+ L +Q  G
Sbjct: 266 IAKKRIELEDLSTNTVENALFSVRELVNREATSATLITSATHMRRAFLLYQMAG 319


>gi|218233505|ref|YP_002366978.1| hypothetical protein BCB4264_A2261 [Bacillus cereus B4264]
 gi|218161462|gb|ACK61454.1| conserved hypothetical protein [Bacillus cereus B4264]
          Length = 185

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 72  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY---NV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 160


>gi|225024219|ref|ZP_03713411.1| hypothetical protein EIKCOROL_01091 [Eikenella corrodens ATCC
           23834]
 gi|224943244|gb|EEG24453.1| hypothetical protein EIKCOROL_01091 [Eikenella corrodens ATCC
           23834]
          Length = 221

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           PS     RI   + LY++ +   +    I +GG P+   + E+ V        GV   DI
Sbjct: 62  PSPVFRERINHGITLYRNNRVGKL----IFTGGTPKAGYMTEAEVARRYARGHGVPNKDI 117

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
            LET S DT QN + + +++ N   ++++++S  YHL R+     + G++
Sbjct: 118 LLETTSRDTQQNLENTKALMYNNGLESVVIISDPYHLARAAAVADYVGLD 167


>gi|120403947|ref|YP_953776.1| hypothetical protein Mvan_2964 [Mycobacterium vanbaalenii PYR-1]
 gi|119956765|gb|ABM13770.1| protein of unknown function DUF218 [Mycobacterium vanbaalenii
           PYR-1]
          Length = 233

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 47/92 (51%), Gaps = 1/92 (1%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
              II++GG+P ++G  E+    N L   G+  + I +E ++  T QNA FS  + K   
Sbjct: 118 QSPIIVTGGNP-RNGKTEARQMRNMLRLYGIPDERIIVEDRANSTVQNAAFSVPLAKQAG 176

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
              IILV+S+ H  R+   F   G N  A+ S
Sbjct: 177 TTGIILVTSSSHQDRADGNFADAGGNVLATVS 208


>gi|165975946|ref|YP_001651539.1| hypothetical protein APJL_0514 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|303250279|ref|ZP_07336479.1| hypothetical protein APP6_1694 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252044|ref|ZP_07533944.1| hypothetical protein appser6_5630 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|165876047|gb|ABY69095.1| hypothetical protein APJL_0514 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|302650895|gb|EFL81051.1| hypothetical protein APP6_1694 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860513|gb|EFM92526.1| hypothetical protein appser6_5630 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 252

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 75/179 (41%), Gaps = 24/179 (13%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI------FETMRLYKSCKQHSMHCTII 117
           K    IV+LG G           +  S + + R        E MR Y +         I+
Sbjct: 80  KKAQAIVVLGGG-----------VRNSHELFGRYTIAAAPLERMR-YAAYLHKQTGLPIL 127

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ++GG P+       I+     L          +E+ S  T QNA  S +M+K      II
Sbjct: 128 VTGGSPEGREPEAKIMAQE--LHDFFNVSVKWVESASNTTEQNAILSKAMLKQESIDRII 185

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY----YSIIPLSANFYLTELALKEYIG 232
           LV++ +H+KR+++ F+  G N  A+ +    A        IP +     + +ALKE+IG
Sbjct: 186 LVTNQWHMKRTKMLFEREGFNVLAAGTTAHQALDIGILPFIPQAQALQNSSIALKEWIG 244


>gi|329768261|ref|ZP_08259762.1| hypothetical protein HMPREF0428_01459 [Gemella haemolysans M341]
 gi|328837460|gb|EGF87089.1| hypothetical protein HMPREF0428_01459 [Gemella haemolysans M341]
          Length = 340

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 14/120 (11%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           +V+LG G      +   R+ P   S  RI + +++YKS     +    I+SGG      +
Sbjct: 171 VVVLGAG------LIGERVTPLLAS--RIRKGIKVYKSNPGSKL----IMSGGQGPDEVV 218

Query: 129 AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS 188
           +E+    N  LE GV+  DI LE +S  T QN  FS   I     K+  +V++ YH+ R+
Sbjct: 219 SEAFAMKNYALEQGVDEKDIILEDKSTSTEQNIIFSKKFIP--ADKSFAVVTNYYHVYRA 276


>gi|298291473|ref|YP_003693412.1| hypothetical protein Snov_1483 [Starkeya novella DSM 506]
 gi|296927984|gb|ADH88793.1| protein of unknown function DUF218 [Starkeya novella DSM 506]
          Length = 274

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 80/186 (43%), Gaps = 16/186 (8%)

Query: 65  DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP- 123
           DG I++    G   +  I A R + SFQ      E M       +      I+ +GG   
Sbjct: 79  DGVIVL----GGAELAGITAARGQSSFQEAG---ERMLAMGELARRYPGARIVFAGGSSN 131

Query: 124 --QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
             +   + E+ V    L + GV+   ++ E  S +T +NA+ +  ++K    +  +LV+S
Sbjct: 132 LVEASPMQEADVVRLALPQIGVDPARVEFERYSRNTAENARLARELVKPQPDQRWLLVTS 191

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYLNAYYSII-----PLSANFYLTELALKEYIGILIA 236
           A+H+ R+   F+  G        DY       +      ++      +LA +E++G L+A
Sbjct: 192 AFHMPRAIGCFRAAGFPVIPYPVDYRTIGRPELFRLFGTVADGLSFVDLATREWMG-LVA 250

Query: 237 YYRGNR 242
           YY   R
Sbjct: 251 YYLAGR 256


>gi|324326310|gb|ADY21570.1| putative cytoplasmic protein [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 185

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS   I     
Sbjct: 72  VKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENVKFS---IDLYDV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 160


>gi|167757031|ref|ZP_02429158.1| hypothetical protein CLORAM_02580 [Clostridium ramosum DSM 1402]
 gi|237735899|ref|ZP_04566380.1| membrane associated protein [Mollicutes bacterium D7]
 gi|167703206|gb|EDS17785.1| hypothetical protein CLORAM_02580 [Clostridium ramosum DSM 1402]
 gi|229381644|gb|EEO31735.1| membrane associated protein [Coprobacillus sp. D7]
          Length = 190

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 84/164 (51%), Gaps = 18/164 (10%)

Query: 36  IGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPA-IRIEPSFQSY 94
           IG+GI+   LL  L   +++P    ++KK             II   PA I  EPS    
Sbjct: 7   IGFGILN--LLAFL-LVFKKPYKKQRYKK---------YDCAIICGYPANIDGEPSTIMK 54

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SR+   + LYK  K       +I+SGG   K+   E+ +  +  +  GV+++DI +E QS
Sbjct: 55  SRVEMGVTLYKKDKIK----FLILSGG-AVKNEYQEAKIMASYAISLGVKKEDILIEGQS 109

Query: 155 LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
             T+ N  +S  +++    KN ++V++++HL+++  Y + F ++
Sbjct: 110 RSTYHNLMYSRDIMQINGLKNALVVTNSWHLRKADHYARKFKLD 153


>gi|158424456|ref|YP_001525748.1| hypothetical protein AZC_2832 [Azorhizobium caulinodans ORS 571]
 gi|158331345|dbj|BAF88830.1| uncharacterized conserved protein [Azorhizobium caulinodans ORS
           571]
          Length = 271

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 87/195 (44%), Gaps = 20/195 (10%)

Query: 60  PQWKKDG---NIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTI 116
           P +  DG   + I++LG        +P + +     + +   E +  + +  +      +
Sbjct: 72  PPFVGDGRPVDGIIMLGGAE-----VPEVSVVRGVTALNDAAERVLAFAALARRYPQAKL 126

Query: 117 IISGGDPQ--KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK 174
           + SGG  +  +   A          + G++   +  E +S +T QNA  +  +I  + G+
Sbjct: 127 VFSGGSGEYDESMPAAQDAVRLAFADVGLDVTRVIYERRSRNTAQNAVETRKLITPVPGE 186

Query: 175 NIILVSSAYHLKRSQLYFQHFGINTKASCSDY-------LNAYYSIIPLSANFYLTELAL 227
             +LV+SA+H+ R+   F+  G    A   DY       LN  +  +  ++   +T++A+
Sbjct: 187 RWLLVTSAFHMPRAIGCFREVGFPVTAYPVDYRTLGPGRLNGVFRRV--ASGLDITDIAV 244

Query: 228 KEYIGILIAYYRGNR 242
           +E++G L AYY   R
Sbjct: 245 REWMG-LGAYYASGR 258


>gi|228952619|ref|ZP_04114695.1| hypothetical protein bthur0006_20170 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|229069806|ref|ZP_04203089.1| hypothetical protein bcere0025_20080 [Bacillus cereus F65185]
 gi|229150501|ref|ZP_04278717.1| hypothetical protein bcere0011_20520 [Bacillus cereus m1550]
 gi|228632994|gb|EEK89607.1| hypothetical protein bcere0011_20520 [Bacillus cereus m1550]
 gi|228713341|gb|EEL65233.1| hypothetical protein bcere0025_20080 [Bacillus cereus F65185]
 gi|228807085|gb|EEM53628.1| hypothetical protein bthur0006_20170 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
          Length = 185

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 72  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY---NV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 160


>gi|30020365|ref|NP_831996.1| putative cytoplasmic protein [Bacillus cereus ATCC 14579]
 gi|229109718|ref|ZP_04239304.1| hypothetical protein bcere0018_19790 [Bacillus cereus Rock1-15]
 gi|229127675|ref|ZP_04256664.1| hypothetical protein bcere0015_21240 [Bacillus cereus BDRD-Cer4]
 gi|229144871|ref|ZP_04273268.1| hypothetical protein bcere0012_20310 [Bacillus cereus BDRD-ST24]
 gi|296502841|ref|YP_003664541.1| hypothetical protein BMB171_C2008 [Bacillus thuringiensis BMB171]
 gi|29895916|gb|AAP09197.1| hypothetical Cytosolic Protein [Bacillus cereus ATCC 14579]
 gi|228638593|gb|EEK95026.1| hypothetical protein bcere0012_20310 [Bacillus cereus BDRD-ST24]
 gi|228655752|gb|EEL11601.1| hypothetical protein bcere0015_21240 [Bacillus cereus BDRD-Cer4]
 gi|228673759|gb|EEL29017.1| hypothetical protein bcere0018_19790 [Bacillus cereus Rock1-15]
 gi|296323893|gb|ADH06821.1| putative cytoplasmic protein [Bacillus thuringiensis BMB171]
          Length = 185

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 72  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY---NV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 160


>gi|313617350|gb|EFR89766.1| conserved hypothetical protein [Listeria innocua FSL S4-378]
          Length = 189

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 80/176 (45%), Gaps = 20/176 (11%)

Query: 23  IFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTI 82
           I F   F++L   I  G I  +++    FS  R     +  ++ N +++LG      P  
Sbjct: 2   IRFKKFFVIL---IVIGFIYVLIVAAFMFSGTRA----KPDENVNTVLILGAKINGDPAT 54

Query: 83  PAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESG 142
           P++ +E    +       +  Y   K       +I+SGG        E+ V    L+  G
Sbjct: 55  PSLVLEERLDT---AVAYLNEYPKAK-------VIVSGGQGADESTTEAAVMEEYLVNEG 104

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           + R+ IK ET+S  T +N ++S+   K   GK +I V+S YH+ R+ +  +  GIN
Sbjct: 105 IARNRIKKETKSKRTEENIKYSNE--KFDLGKTVI-VTSDYHMYRALMLAKRQGIN 157


>gi|229074933|ref|ZP_04207940.1| hypothetical protein bcere0024_19940 [Bacillus cereus Rock4-18]
 gi|228708161|gb|EEL60327.1| hypothetical protein bcere0024_19940 [Bacillus cereus Rock4-18]
          Length = 166

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E +S +T++N +FS  +      
Sbjct: 53  VKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILMEDRSTNTYENLKFSMDLF---DV 109

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  GI  +A  ++
Sbjct: 110 KHAVVVSNTYHLYRTKIIARRLGIKMEALAAE 141


>gi|86355763|ref|YP_467655.1| hypothetical protein RHE_CH00103 [Rhizobium etli CFN 42]
 gi|86279865|gb|ABC88928.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 262

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 104/265 (39%), Gaps = 38/265 (14%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIP--------------------TIL 45
           +FLI     + CQ +   F +  F L+   + W  +                      +L
Sbjct: 1   MFLISKLVWIFCQPLSLAFLLVFFTLIAILLRWRALSILGATASALILFVTLYTTAGNLL 60

Query: 46  LKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYS-RIFETMRLY 104
           ++ L+  + +P   P+     N+  ++  G      +   R    F   + R  E +RL 
Sbjct: 61  MQGLEQRFAKPAADPE-----NLQCVIVLGGAFENEVNTARHGIEFNGGADRFIEALRLA 115

Query: 105 KSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES--GVERDDIKLETQSLDTFQNAQ 162
           +   Q      I+ISGGD    G+ E     ++      G+ +D +  E QS  TF+NA 
Sbjct: 116 QKFPQSR----ILISGGDGSISGIYEGDAAASERFFPLFGIGKDRLIEERQSRTTFENAV 171

Query: 163 FSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY-----LNAYYSIIPLS 217
            +   + +    + +L++S +H+ RS   F+  GI+     +DY     +         +
Sbjct: 172 NTREFLASQGLSHCLLITSGFHMPRSVGIFRKLGIDIVPWPTDYRTDGQVRPGLDFTQPN 231

Query: 218 ANFYLTELALKEYIGILIAYYRGNR 242
            N      A++E+ G LI YY   R
Sbjct: 232 LNAQSMATAIREWYG-LIGYYLAGR 255


>gi|167035834|ref|YP_001671065.1| hypothetical protein PputGB1_4845 [Pseudomonas putida GB-1]
 gi|166862322|gb|ABZ00730.1| protein of unknown function DUF218 [Pseudomonas putida GB-1]
          Length = 253

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 85/197 (43%), Gaps = 22/197 (11%)

Query: 50  QFSYQRPLLSPQWK---KDGNIIVLLGNGTTIIPTIPAIRIEPSF----QSYSRIFETMR 102
           Q   + PL+   W       + IV+LG G          R +P++    Q  +   E MR
Sbjct: 61  QLETEPPLVVDDWAGLASRADAIVVLGAGRE--------RGDPAWGGSDQPTATALERMR 112

Query: 103 LYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
                 + S    ++ SGG       +E+ +  ++L E        + E  S  T++NAQ
Sbjct: 113 FAARLAKAS-GLPVLTSGGLHYGTPPSEARLMADRLQEDFAVAVKWR-EEASRTTWENAQ 170

Query: 163 FSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS-----CSDYLNAYYSIIPLS 217
            ++ +++ +  + ++LV+ A+H++RS+  F+  G     +       D+   +  ++P S
Sbjct: 171 LTAKVLQPLGIRRVVLVTQAWHMQRSRWSFEQAGFEVVPAPVGFLGRDHARPFAGLLPES 230

Query: 218 ANFYLTELALKEYIGIL 234
              + +     E +G++
Sbjct: 231 RAMWQSGQLFNEVVGLV 247


>gi|229138983|ref|ZP_04267560.1| hypothetical protein bcere0013_20960 [Bacillus cereus BDRD-ST26]
 gi|228644338|gb|EEL00593.1| hypothetical protein bcere0013_20960 [Bacillus cereus BDRD-ST26]
          Length = 162

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 63/121 (52%), Gaps = 14/121 (11%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS   I     
Sbjct: 49  VKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDERRILIEDQSTNTYENVKFS---IDLYDV 105

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
           K+ ++VS+ YHL R+++  +  G+  +A  ++         P+ +     ++ ++EY+ I
Sbjct: 106 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE--------TPIRSK---RKMYVREYVAI 154

Query: 234 L 234
           +
Sbjct: 155 M 155


>gi|262275607|ref|ZP_06053416.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Grimontia hollisae CIP 101886]
 gi|262219415|gb|EEY70731.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Grimontia hollisae CIP 101886]
          Length = 271

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 87/165 (52%), Gaps = 16/165 (9%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLY 104
           LL  L+  YQ P L    K+  + +++LG+G  +   +P           SR+   MRL 
Sbjct: 61  LLIKLERQYQ-PFLPT--KEPVDYVMVLGHGHVVDDELPPT------SELSRV-ALMRLM 110

Query: 105 KSCKQHSMHCT--IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQ 162
           +  + H M+ T  +I+SG D   + ++ + +     L  GV +++I L   + DT++ A 
Sbjct: 111 EGIRIHFMYPTSKLILSGYD-GGYEVSHARMLARVALAMGVNKNNILLLETAKDTWEEAF 169

Query: 163 FSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL 207
            ++S++ +    N++LV+SA H+ R+   FQ+ G+N   + ++++
Sbjct: 170 QAASVVGD---SNLVLVTSANHMPRAVYEFQNAGLNPIPAPTNFM 211


>gi|126433493|ref|YP_001069184.1| hypothetical protein Mjls_0884 [Mycobacterium sp. JLS]
 gi|126233293|gb|ABN96693.1| protein of unknown function DUF218 [Mycobacterium sp. JLS]
          Length = 193

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
              II++GG+P ++G++E+      LL  G     I +E ++  T QNA+FS  + +   
Sbjct: 78  QSPIIVTGGNP-RNGVSEAAAMRRMLLVLGFPDHRIIVEDRANSTVQNARFSVPLAEKAG 136

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
              IILV+S+ H  R+   F   G N  A+ S
Sbjct: 137 TSGIILVTSSTHQDRADGNFVDAGANLLATVS 168


>gi|108797853|ref|YP_638050.1| hypothetical protein Mmcs_0878 [Mycobacterium sp. MCS]
 gi|119866947|ref|YP_936899.1| hypothetical protein Mkms_0895 [Mycobacterium sp. KMS]
 gi|108768272|gb|ABG06994.1| protein of unknown function DUF218 [Mycobacterium sp. MCS]
 gi|119693036|gb|ABL90109.1| protein of unknown function DUF218 [Mycobacterium sp. KMS]
          Length = 193

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
              II++GG+P ++G++E+      LL  G     I +E ++  T QNA+FS  + +   
Sbjct: 78  QSPIIVTGGNP-RNGVSEAAAMRRMLLVLGFPDHRIIVEDKANSTVQNARFSVPLAEKAG 136

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
              IILV+S+ H  R+   F   G N  A+ S
Sbjct: 137 TSGIILVTSSTHQDRADGNFVDAGANLLATVS 168


>gi|75911018|ref|YP_325314.1| hypothetical protein Ava_4822 [Anabaena variabilis ATCC 29413]
 gi|75704743|gb|ABA24419.1| Protein of unknown function DUF218 [Anabaena variabilis ATCC 29413]
          Length = 215

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 58/116 (50%), Gaps = 5/116 (4%)

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
           EPS     RI   + LYK    +     II +GG  + +  AE+IV  +     GV+  D
Sbjct: 72  EPSPVFRERINHAINLYK----NGAISKIIFTGGVGEINEPAEAIVGKHYATARGVKTAD 127

Query: 148 IKLETQSLDTFQNAQFSSSMIK-NMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
           I  ETQS  T+QN + +  ++  N +    +++S   HLKR+ L  ++ GI+   S
Sbjct: 128 IITETQSRTTYQNLKNAIEVVDTNEKFTKFLIISDPLHLKRAVLMARNLGIDAYPS 183


>gi|157146390|ref|YP_001453709.1| hypothetical protein CKO_02149 [Citrobacter koseri ATCC BAA-895]
 gi|157083595|gb|ABV13273.1| hypothetical protein CKO_02149 [Citrobacter koseri ATCC BAA-895]
          Length = 259

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 90/208 (43%), Gaps = 30/208 (14%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIF 98
           LLK ++ SY      P W+    +  IV+LG G T  P     +  PS      S  R+ 
Sbjct: 62  LLKPIEDSY------PTWQGTQKVDYIVVLGGGYTWNP-----QWAPSSNLINNSLPRLN 110

Query: 99  ETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTF 158
           E +RL+ +    +    +I +G   + + ++ +          GV R DI    Q  DT 
Sbjct: 111 EGVRLWLA----NPGSKLIFTGAAAKTNRVSTAEAGARVAQSLGVPRSDIITLDQPKDTE 166

Query: 159 QNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY------LNAYYS 212
           + A+     I +      +LV+SA HL R+ ++FQH G++   + ++       LN +  
Sbjct: 167 EEAEAVKQAIGDAP---FLLVTSASHLPRAMIFFQHVGLHPLPAPANQLAIDSPLNPWER 223

Query: 213 IIPLSANFYLTELALKEYIGILIAYYRG 240
            IP       ++ A  E +G +  + +G
Sbjct: 224 AIPSPVWLMHSDRAGYETLGRIWQWLKG 251


>gi|307260971|ref|ZP_07542653.1| hypothetical protein appser12_5380 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306869273|gb|EFN01068.1| hypothetical protein appser12_5380 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 252

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 75/179 (41%), Gaps = 24/179 (13%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI------FETMRLYKSCKQHSMHCTII 117
           K    IV+LG G           +  S + + R        E MR Y +         I+
Sbjct: 80  KKAQAIVVLGGG-----------VRNSHELFGRYAIAAAPLERMR-YAAYLHKQTGLPIL 127

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ++GG P+       I+     L          +E+ S  T QNA  S +M+K      II
Sbjct: 128 VTGGSPEGREPEAKIMAQE--LHDFFNVSVKWVESASNTTEQNAILSKAMLKQEGIDRII 185

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY----YSIIPLSANFYLTELALKEYIG 232
           LV++ +H+KR+++ F+  G N  A+ +    A        IP +     + +ALKE+IG
Sbjct: 186 LVTNQWHMKRAKMLFEREGFNVLAAGTTAHQALDIGILPFIPQAQALQNSSIALKEWIG 244


>gi|317047567|ref|YP_004115215.1| hypothetical protein Pat9b_1338 [Pantoea sp. At-9b]
 gi|316949184|gb|ADU68659.1| protein of unknown function DUF218 [Pantoea sp. At-9b]
          Length = 261

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 86/196 (43%), Gaps = 28/196 (14%)

Query: 60  PQWKKDGNI--IVLLGNGTTIIPTIPAIRIEPS----FQSYSRIFETMRLYKSCKQHSMH 113
           P W ++ ++  IV+LG G T  P        PS      S  R+ E +R ++   Q  M 
Sbjct: 71  PTWNRNVSVDYIVVLGGGYTFNPDW-----APSSNLIGNSLPRVAEGVRQWRRYPQAKMI 125

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
            T   +G +P  +    +     ++ ES GV    I +  Q  DT + AQ     +K   
Sbjct: 126 FTGAAAGNNPMSNARVAA-----QVAESLGVPESVIIVLDQPKDTREEAQ----AVKIAV 176

Query: 173 GKN-IILVSSAYHLKRSQLYFQHFGIN------TKASCSDYLNAYYSIIPLSANFYLTEL 225
           G++  +LV+SA HL R+  +FQ  G+N       + + +  LN +   +P       +E 
Sbjct: 177 GQHPFLLVTSANHLPRAMQFFQGAGLNPLPAPANQMAITSPLNGWERALPSPLWLSHSER 236

Query: 226 ALKEYIGILIAYYRGN 241
           A+ E +G      RG+
Sbjct: 237 AIYETLGRAWQALRGD 252


>gi|302877595|ref|YP_003846159.1| hypothetical protein Galf_0351 [Gallionella capsiferriformans ES-2]
 gi|302580384|gb|ADL54395.1| protein of unknown function DUF218 [Gallionella capsiferriformans
           ES-2]
          Length = 254

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 82/176 (46%), Gaps = 16/176 (9%)

Query: 66  GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFET--MRL-YKSCKQHSMHCTIIISGGD 122
            + IV+LG GT            P + +   + E   +RL Y +  Q  ++  I+++GG 
Sbjct: 78  ASAIVILGGGTYFHA--------PEYDNQDTVSEATLLRLRYGARLQRELNAPILVTGGK 129

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSA 182
           P  +G +E+      +LE          E  S +TF+NA++S   ++    ++I LV+ A
Sbjct: 130 PLGNGTSEAHQMRT-VLEEDFRIPARWTEDASDNTFENARYSYQTLQKAGIRDIYLVTHA 188

Query: 183 YHLKRSQLYFQHFG--INTKASC--SDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           +H+ RS   F+  G  +    +C  + Y     + IP +     +++ + E IG+L
Sbjct: 189 WHMLRSAAAFRAAGFVVIEAPTCFTTRYQTNLLAFIPRAEALRDSKIFVHEVIGLL 244


>gi|46143233|ref|ZP_00135637.2| COG1434: Uncharacterized conserved protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126207969|ref|YP_001053194.1| hypothetical protein APL_0485 [Actinobacillus pleuropneumoniae L20]
 gi|126096761|gb|ABN73589.1| hypothetical protein APL_0485 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
          Length = 252

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 75/179 (41%), Gaps = 24/179 (13%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI------FETMRLYKSCKQHSMHCTII 117
           K    IV+LG G           +  S + + R        E MR Y +         I+
Sbjct: 80  KKAQAIVVLGGG-----------VRNSHELFGRYAIAAAPLERMR-YAAYLHKQTGLPIL 127

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ++GG P+       I+     L          +E+ S  T QNA  S +M+K      II
Sbjct: 128 VTGGSPEGREPEAKIMAQE--LHDFFNVSVKWVESASNTTEQNAILSKAMLKQEGIDRII 185

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY----YSIIPLSANFYLTELALKEYIG 232
           LV++ +H+KR+++ F+  G N  A+ +    A        IP +     + +ALKE+IG
Sbjct: 186 LVTNQWHMKRAKMLFEREGFNVLAAGTTAHQALDIGILPFIPQAQALQNSSIALKEWIG 244


>gi|229096776|ref|ZP_04227746.1| hypothetical protein bcere0020_20230 [Bacillus cereus Rock3-29]
 gi|229115758|ref|ZP_04245160.1| hypothetical protein bcere0017_20490 [Bacillus cereus Rock1-3]
 gi|228667641|gb|EEL23081.1| hypothetical protein bcere0017_20490 [Bacillus cereus Rock1-3]
 gi|228686618|gb|EEL40526.1| hypothetical protein bcere0020_20230 [Bacillus cereus Rock3-29]
          Length = 166

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E +S +T++N +FS  +      
Sbjct: 53  VKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILMEDRSTNTYENLKFSMDLF---DV 109

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  GI  +A  ++
Sbjct: 110 KHAVVVSNTYHLYRTKIIARRLGIKMEALAAE 141


>gi|229178646|ref|ZP_04306010.1| hypothetical protein bcere0005_20040 [Bacillus cereus 172560W]
 gi|228604804|gb|EEK62261.1| hypothetical protein bcere0005_20040 [Bacillus cereus 172560W]
          Length = 166

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 53  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY---NV 109

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 110 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 141


>gi|326803127|ref|YP_004320945.1| hypothetical protein HMPREF9243_0621 [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651604|gb|AEA01787.1| conserved hypothetical protein [Aerococcus urinae ACS-120-V-Col10a]
          Length = 190

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 54/94 (57%), Gaps = 4/94 (4%)

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G ER+++  E Q+  T+ NA  S  ++ ++   + I+V+S YH++R++L FQ    +   
Sbjct: 87  GAERENLIEENQATSTWTNATTSLDLMDDLGYHSAIVVTSDYHMRRTRLAFQRANRDYGF 146

Query: 202 SCSDYLNAYYSIIPLSANFYLTELALKE---YIG 232
             + Y++AYY   P   + Y  ++AL+E   YIG
Sbjct: 147 QLT-YVSAYYQGQPYPKHPYTQKMALQELYKYIG 179


>gi|163852963|ref|YP_001641006.1| hypothetical protein Mext_3555 [Methylobacterium extorquens PA1]
 gi|163664568|gb|ABY31935.1| protein of unknown function DUF218 [Methylobacterium extorquens
           PA1]
          Length = 275

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 94/219 (42%), Gaps = 23/219 (10%)

Query: 26  MSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAI 85
           ++ F  L     W ++P       Q    RP+       DG  I++L  G  +  +    
Sbjct: 35  LATFSGLTPLANWALLPLEQRFPAQVDDVRPV-------DG--IIVLSGGIDLTTSRTRG 85

Query: 86  RIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHG----LAESIVYNNKLLES 141
           R+E +  +  RI   + L     Q      ++ +GGDP   G      E+++    L   
Sbjct: 86  RLELN-DAGDRITALIDLAHRYPQ----ARLVYTGGDPYPTGGRARPTEAVLAAAYLEGI 140

Query: 142 GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA 201
           G+    I +E +S  T +NA     +++   G+  +L++SA+H+ R+   F+  G+  + 
Sbjct: 141 GIAPARITVEARSRTTAENASEVRKLLEPHPGERWLLITSAWHMPRAMGAFRRVGLELEP 200

Query: 202 SCSDYLNA-----YYSIIPLSANFYLTELALKEYIGILI 235
              D+  A      ++    +   +L ++A KE+ G+++
Sbjct: 201 YPVDFRTAGPFATRFTFRHAADGLHLLDVAAKEWAGLVV 239


>gi|312881496|ref|ZP_07741288.1| hypothetical protein VIBC2010_02326 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370862|gb|EFP98322.1| hypothetical protein VIBC2010_02326 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 254

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 97/218 (44%), Gaps = 27/218 (12%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQR--PLLSPQWKKDGNIIVLLGNGTTIIP 80
           C ++LFSFIG     +  I + LL  L+  Y    P+  P      + +++LG+G  +  
Sbjct: 27  CVIVLFSFIGLFLASFQPISSRLLMPLERQYTAFFPIDEPI-----DYVMVLGSGHIVDD 81

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLE 140
            IP    E S     R+ E +R+ +      +  +   +G D     +   +      L 
Sbjct: 82  KIPPTS-ELSRSGLMRLAEGIRILRMYPGSKLILSGYAAGSDVSNARMMAKVA-----LA 135

Query: 141 SGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTK 200
            GV + DI L   + DT++ A+ +++ + N   KN+I+V+SA ++KR+   F   G+   
Sbjct: 136 LGVAKPDIILLETAKDTWEEARQAAAFVNN---KNLIVVTSASNMKRALNEFYSAGLKPY 192

Query: 201 ASCSDYL------NAYYSIIPLSANFYLTELALKEYIG 232
            + ++YL        +    P S     TEL   E +G
Sbjct: 193 PAPTNYLAQKNIDTPWVKYTPKSTYLEQTELYWHETLG 230


>gi|148380856|ref|YP_001255397.1| hypothetical protein CBO2900 [Clostridium botulinum A str. ATCC
           3502]
 gi|153931082|ref|YP_001385163.1| hypothetical protein CLB_2864 [Clostridium botulinum A str. ATCC
           19397]
 gi|153935289|ref|YP_001388632.1| hypothetical protein CLC_2797 [Clostridium botulinum A str. Hall]
 gi|148290340|emb|CAL84464.1| putative exported protein [Clostridium botulinum A str. ATCC 3502]
 gi|152927126|gb|ABS32626.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           19397]
 gi|152931203|gb|ABS36702.1| conserved hypothetical protein [Clostridium botulinum A str. Hall]
          Length = 197

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 6/109 (5%)

Query: 96  RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           R+ E +RLY           II+SG       ++E+      L++ G+++  I  E +S 
Sbjct: 65  RLDEGLRLY----NDGYGKYIIVSGAKGPGENISEAEAMQKYLVQKGLDKKFIIPEDKSR 120

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS 204
           +T +N +FS   +++    + I+VS+ YHLKR++L  Q  GI  KAS S
Sbjct: 121 NTLENIKFSKKKMEDNNLSSSIIVSNKYHLKRAELLCQKEGI--KASYS 167


>gi|289209654|ref|YP_003461720.1| hypothetical protein TK90_2494 [Thioalkalivibrio sp. K90mix]
 gi|288945285|gb|ADC72984.1| protein of unknown function DUF218 [Thioalkalivibrio sp. K90mix]
          Length = 215

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 67/142 (47%), Gaps = 11/142 (7%)

Query: 104 YKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQF 163
           Y +   H     +++SGG P++  + E+      L E GV    I  E  + DT+ NA+ 
Sbjct: 73  YAAYLHHRTGLPVMVSGGGPEER-VPEADYMAEVLKEYGVH--PILREPNARDTWGNARH 129

Query: 164 SSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN-TKASCSDYL---NAY--YSIIPLS 217
           S+  +     + + LVS A+H+ R+   F+  G+    A    Y+   N +      P +
Sbjct: 130 SAEQLHAEGIERVALVSHAHHMPRATWSFERAGLEIIPAPTGAYVPRDNGWSLEGFRPQA 189

Query: 218 ANFYLTELALKEYIGILIAYYR 239
           +  + + LAL EY G  +A+YR
Sbjct: 190 SAVWASWLALHEYWG--MAWYR 209


>gi|42781376|ref|NP_978623.1| hypothetical protein BCE_2312 [Bacillus cereus ATCC 10987]
 gi|229196506|ref|ZP_04323250.1| hypothetical protein bcere0001_20640 [Bacillus cereus m1293]
 gi|42737298|gb|AAS41231.1| conserved hypothetical protein [Bacillus cereus ATCC 10987]
 gi|228586862|gb|EEK44936.1| hypothetical protein bcere0001_20640 [Bacillus cereus m1293]
          Length = 185

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS   I     
Sbjct: 72  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFS---IDLYDV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMRMEALAAE 160


>gi|229161248|ref|ZP_04289235.1| hypothetical protein bcere0009_20370 [Bacillus cereus R309803]
 gi|228622344|gb|EEK79183.1| hypothetical protein bcere0009_20370 [Bacillus cereus R309803]
          Length = 166

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 53  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDDSRILIEDQSTNTYENVKFSMDLY---DV 109

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 110 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 141


>gi|255744859|ref|ZP_05418809.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholera CIRS 101]
 gi|262161858|ref|ZP_06030876.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae INDRE 91/1]
 gi|262189661|ref|ZP_06048039.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae CT 5369-93]
 gi|255737330|gb|EET92725.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholera CIRS 101]
 gi|262028590|gb|EEY47245.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae INDRE 91/1]
 gi|262034459|gb|EEY52821.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae CT 5369-93]
 gi|327484319|gb|AEA78726.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio cholerae LMA3894-4]
          Length = 273

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 102/227 (44%), Gaps = 39/227 (17%)

Query: 27  SCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            C ++LFS  G     +  + T LL  L+ +Y   L       +G +  +++LGNG  I 
Sbjct: 38  GCLVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFL-----PVEGTLDYVMVLGNGHVID 92

Query: 80  PTIPAIRIEPSFQSYSRIFETMR---LYKSCKQHSMHCTIIISG---GDPQKHGLAESIV 133
             IP    E +  +  R+ E +R   +Y   K       +I+SG   G    H    + V
Sbjct: 93  DDIPPTS-ELTRAALMRLTEGIRISRMYPGSK-------LILSGYAGGSEVSHARMMARV 144

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
                L  GV + DI L   + DT++ A+ +++ +   Q K ++LV+SA H+KR+   F+
Sbjct: 145 A----LALGVPKSDIILLETAKDTWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFE 197

Query: 194 HFGINTKASCSDYLN------AYYSIIPLSANFYLTELALKEYIGIL 234
             G+    + ++YL        +   IP S     TE    E +G++
Sbjct: 198 SAGLTPIPAPTNYLGHLNIIQPWDKYIPRSRYLEQTEQYWHETLGLM 244


>gi|303252155|ref|ZP_07338323.1| hypothetical protein APP2_1129 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307247491|ref|ZP_07529536.1| hypothetical protein appser2_4870 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|302648938|gb|EFL79126.1| hypothetical protein APP2_1129 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306855994|gb|EFM88152.1| hypothetical protein appser2_4870 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 252

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 75/179 (41%), Gaps = 24/179 (13%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI------FETMRLYKSCKQHSMHCTII 117
           K    IV+LG G           +  S + + R        E MR Y +         I+
Sbjct: 80  KKAQAIVVLGGG-----------VRNSHELFGRYAIAAAPLERMR-YAAYLHKQTGLPIL 127

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           ++GG P+       I+     L          +E+ S  T QNA  S +M+K      II
Sbjct: 128 VTGGSPEGREPEAKIMAQE--LHDFFNVSVKWVESASNTTEQNAILSKAMLKQEGIDRII 185

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY----YSIIPLSANFYLTELALKEYIG 232
           LV++ +H+KR+++ F+  G N  A+ +    A        IP +     + +ALKE+IG
Sbjct: 186 LVTNQWHMKRTKMLFEREGFNVLAAGTTAHQALDIGILPFIPQAQALQNSSIALKEWIG 244


>gi|262165878|ref|ZP_06033615.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio mimicus VM223]
 gi|262025594|gb|EEY44262.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio mimicus VM223]
          Length = 278

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 89/188 (47%), Gaps = 21/188 (11%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           C ++LFS  G     +  + T LL  L+ +Y   L       +G+I  +++LG+G  +  
Sbjct: 39  CLVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFL-----PVEGSIDYVMILGSGHVVDD 93

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLE 140
            IP    E S  +  R+ E +R+ +      M  +    G +      + + +     L 
Sbjct: 94  DIPPTS-ELSRAALMRLTEGIRISRMYPGSKMILSGYAGGSE-----FSHARMMARVALA 147

Query: 141 SGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTK 200
            GV + DI L   + DT++ A+ +++ +   Q K ++LV+SA H+KR+   F+  G+   
Sbjct: 148 LGVPKSDIILLETAKDTWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFESAGLTPI 204

Query: 201 ASCSDYLN 208
            + ++YL 
Sbjct: 205 PAPTNYLG 212


>gi|163940067|ref|YP_001644951.1| hypothetical protein BcerKBAB4_2098 [Bacillus weihenstephanensis
           KBAB4]
 gi|163862264|gb|ABY43323.1| protein of unknown function DUF218 [Bacillus weihenstephanensis
           KBAB4]
          Length = 185

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 52/92 (56%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++ + I +E +S +T++N +FS  +      
Sbjct: 72  VKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDENRILIEDRSTNTYENLKFSMDL---YDV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  GI  +A  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGIKMEALAAE 160


>gi|308048831|ref|YP_003912397.1| hypothetical protein Fbal_1114 [Ferrimonas balearica DSM 9799]
 gi|307631021|gb|ADN75323.1| protein of unknown function DUF218 [Ferrimonas balearica DSM 9799]
          Length = 243

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 84/179 (46%), Gaps = 18/179 (10%)

Query: 62  WKKDGNI--IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIIS 119
           W+    +  +++LG+  +  P   A   + S  +  R+ E +R++++        T+++S
Sbjct: 71  WQPGAEVAYVLVLGSSHSSHPDR-AATAQLSATALGRLMEGIRVWRANPD----ATLVLS 125

Query: 120 G---GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI 176
           G    DP  H  AE  +     +E GV    I    Q+ DT Q A+ ++ ++        
Sbjct: 126 GFAGSDPTPH--AE--LMKCAAIEQGVPESHIHTFPQARDTEQEARLTAPLVG---AAPA 178

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSA-NFYLTELALKEYIGIL 234
           +LV+SA H+ R+   +Q  G++   + +D++         SA N + ++  + EY+G L
Sbjct: 179 VLVTSASHMDRALSLYQAQGLSVTPAATDFIAQPTRAWYFSARNLWTSQRVIHEYLGQL 237


>gi|330938257|gb|EGH41926.1| hypothetical protein PSYPI_05668 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 256

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 84/196 (42%), Gaps = 31/196 (15%)

Query: 56  PLLSPQWK---KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI---FETMRLYKSCKQ 109
           PL   QW    +  + IV+LGNG          R  P++ + +      E +RL     +
Sbjct: 67  PLPQQQWATLAQQADAIVVLGNGRE--------RNSPTWGTDTPTGLGLERLRLAARLAK 118

Query: 110 HSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL-----ETQSLDTFQNAQFS 164
            S    I+ SGG       +E+ +    L      +DD  +     E  S  T++NA  S
Sbjct: 119 ES-GLPILTSGGLHFDQPPSEASIMAQSL------QDDFAVAVRWQEGLSRTTWENATMS 171

Query: 165 SSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN-----AYYSIIPLSAN 219
           +++++    K ++LV+ A+H+ R++  F+  G     +   +L       +   +P S  
Sbjct: 172 AAILQPQGIKRVVLVTQAWHMPRARWSFEQAGFTVVGAPVGFLGVDNARPFGGWLPESRV 231

Query: 220 FYLTELALKEYIGILI 235
           F  + + L E  G+L+
Sbjct: 232 FTQSGVLLNEAAGLLV 247


>gi|260779195|ref|ZP_05888087.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605359|gb|EEX31654.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 267

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 94/195 (48%), Gaps = 37/195 (18%)

Query: 28  CFMLLFSFIGWGIIP-----TILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           CF++LFSFIG  +I      + LL  L+  Y     S  +  D  I  +++LG+G  +  
Sbjct: 39  CFVVLFSFIGIFLIAFQPVSSRLLMPLERQY-----SAFFPVDETIDYVMVLGSGHVVDD 93

Query: 81  TIPAIRIEPSFQSYSRIFE---TMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNK 137
            IP    E S     R+ E    MR+Y   K       +I+SG      G +E  V N +
Sbjct: 94  KIPPTS-ELSRTGLMRLAEGIRIMRIYPGSK-------LILSG----YAGGSE--VSNAR 139

Query: 138 LLES-----GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYF 192
           ++       GV + DI L   + DT++ A+ +++ +K    K +++V+SA H+KR+   F
Sbjct: 140 MMAKVALALGVSKSDIILLETAKDTWEEARQAAAFVKR---KKLVVVTSASHMKRALNEF 196

Query: 193 QHFGINTKASCSDYL 207
              G+    + ++YL
Sbjct: 197 HSAGLKPYPAPTNYL 211


>gi|121727926|ref|ZP_01680974.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|147675084|ref|YP_001217265.1| hypothetical protein VC0395_A1321 [Vibrio cholerae O395]
 gi|121629776|gb|EAX62192.1| conserved hypothetical protein [Vibrio cholerae V52]
 gi|146316967|gb|ABQ21506.1| conserved hypothetical protein [Vibrio cholerae O395]
 gi|227013622|gb|ACP09832.1| conserved hypothetical protein [Vibrio cholerae O395]
          Length = 282

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 102/226 (45%), Gaps = 39/226 (17%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           C ++LFS  G     +  + T LL  L+ +Y   L       +G +  +++LGNG  I  
Sbjct: 48  CLVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFL-----PVEGTLDYVMVLGNGHVIDD 102

Query: 81  TIPAIRIEPSFQSYSRIFETMR---LYKSCKQHSMHCTIIISG---GDPQKHGLAESIVY 134
            IP    E +  +  R+ E +R   +Y   K       +I+SG   G    H    + V 
Sbjct: 103 DIPPTS-ELTRAALMRLTEGIRISRMYPGSK-------LILSGYAGGSEVSHARMMARVA 154

Query: 135 NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQH 194
               L  GV + DI L   + DT++ A+ +++ +   Q K ++LV+SA H+KR+   F+ 
Sbjct: 155 ----LALGVPKSDIILLETAKDTWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFES 207

Query: 195 FGINTKASCSDYLN------AYYSIIPLSANFYLTELALKEYIGIL 234
            G+    + ++YL        +   IP S     TE    E +G++
Sbjct: 208 AGLTPIPAPTNYLGHLNIIQPWDKYIPRSRYLEQTEQYWHETLGLM 253


>gi|254409849|ref|ZP_05023630.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
 gi|196183846|gb|EDX78829.1| conserved hypothetical protein [Microcoleus chthonoplastes PCC
           7420]
          Length = 325

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 97/212 (45%), Gaps = 23/212 (10%)

Query: 49  LQFSYQRPLLSPQ--WKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKS 106
           L  S ++ +++P+    +  + IV+LG GTT     P  +++ +  +  RI    +LY+ 
Sbjct: 110 LAASTEQAVVTPESAAAQTASAIVVLGQGTTQPDEPPRTQVQLT-DTGDRILYAAQLYRQ 168

Query: 107 CKQHSMHCTIIISGGDPQKHGLAESIVYNNK----LLESGVERDDIKLETQSLDTFQNAQ 162
              + +   ++ +G  P   G  + IV  N     L++ GV +  I LE   ++   +A+
Sbjct: 169 SGNNPL--VVVSAGPRPNLQGNQDQIVEANDIRSLLVQFGVPQSRIVLEPTGINLRTSAE 226

Query: 163 FSSSMIKN--MQGKNIILVSSAYHLKRSQLYFQHFGINT-----------KASCSDYLNA 209
               ++++  +    + LV+SAY+ +R+Q  F+  G+N            +   +  +N 
Sbjct: 227 EVEDILRDRGIADNRVFLVTSAYNSRRAQQAFRSVGLNNVVAKPTGFFTVQPGTTSTINQ 286

Query: 210 Y-YSIIPLSANFYLTELALKEYIGILIAYYRG 240
           +  S IP      +T   ++E+   +  Y RG
Sbjct: 287 WIESFIPSVEALTVTTRIVEEFYASIYYYLRG 318


>gi|152969504|ref|YP_001334613.1| hypothetical protein KPN_00947 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238893976|ref|YP_002918710.1| hypothetical protein KP1_1920 [Klebsiella pneumoniae NTUH-K2044]
 gi|262040981|ref|ZP_06014203.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|150954353|gb|ABR76383.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238546292|dbj|BAH62643.1| putative enzyme [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259041675|gb|EEW42724.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 259

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 90/210 (42%), Gaps = 32/210 (15%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDG--NIIVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIF 98
           LLK ++ +Y      P W+ +   N +V+LG G T  P        PS      S  R+ 
Sbjct: 62  LLKPIEDTY------PTWRGEQPVNYVVVLGGGYTWNP-----EWAPSSNLINNSLPRLT 110

Query: 99  ETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDT 157
           E +RL+++     M  T     G   K     +     ++ ES GV R DI +  +  DT
Sbjct: 111 EGIRLWQANPGSKMIFT-----GAAAKTNPVSTAEAGARVAESLGVPRSDIIVLDRPKDT 165

Query: 158 FQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN------TKASCSDYLNAYY 211
            + A      I +      +LV+SA HL R+ ++F+H G++       + + +  LN + 
Sbjct: 166 EEEALAVKRAIGDAP---FLLVTSASHLPRAMIFFRHAGLDPLPAPANQLAVTSPLNPWE 222

Query: 212 SIIPLSANFYLTELALKEYIGILIAYYRGN 241
             IP       ++    E +G +  + +G+
Sbjct: 223 RAIPSPVWLMHSDRVGYETLGRVWQWLKGS 252


>gi|229044023|ref|ZP_04191712.1| hypothetical protein bcere0027_20620 [Bacillus cereus AH676]
 gi|228725304|gb|EEL76572.1| hypothetical protein bcere0027_20620 [Bacillus cereus AH676]
          Length = 162

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 49  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDL---YNV 105

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 106 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 137


>gi|66047577|ref|YP_237418.1| hypothetical protein Psyr_4350 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258284|gb|AAY39380.1| Protein of unknown function DUF218 [Pseudomonas syringae pv.
           syringae B728a]
          Length = 256

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 90/208 (43%), Gaps = 36/208 (17%)

Query: 49  LQFSYQR-----PLLSPQWK---KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI--- 97
           ++F+ +R     PL   +W    +  + IV+LGNG          R  P++ + +     
Sbjct: 55  VEFAARRLEQIPPLPQQRWAMLAQQADAIVVLGNGRE--------RNSPTWGTDTPTGLG 106

Query: 98  FETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL-----ET 152
            E +RL     + S    I+ SGG       +E+ +    L      +DD  +     E 
Sbjct: 107 LERLRLAARLAKES-GLPILTSGGLHFDQPPSEAAIMAQSL------QDDFAVTVRWQEG 159

Query: 153 QSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN---- 208
            S  T++NA  S+++++    K ++LV+ A+H+ R++  F+  G     +   +L     
Sbjct: 160 LSRTTWENATMSAAILQPQGIKRVVLVTQAWHMPRARWSFEQAGFTVVGAPVGFLGVDNA 219

Query: 209 -AYYSIIPLSANFYLTELALKEYIGILI 235
             +   +P S  F  + + L E  G+L+
Sbjct: 220 RPFGGWLPESRVFTQSGMLLNEAAGLLV 247


>gi|229029997|ref|ZP_04186062.1| hypothetical protein bcere0028_20790 [Bacillus cereus AH1271]
 gi|229079448|ref|ZP_04211988.1| hypothetical protein bcere0023_21020 [Bacillus cereus Rock4-2]
 gi|228703818|gb|EEL56264.1| hypothetical protein bcere0023_21020 [Bacillus cereus Rock4-2]
 gi|228731258|gb|EEL82175.1| hypothetical protein bcere0028_20790 [Bacillus cereus AH1271]
          Length = 162

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 49  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDL---YNV 105

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 106 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 137


>gi|311105207|ref|YP_003978060.1| hypothetical protein AXYL_02016 [Achromobacter xylosoxidans A8]
 gi|310759896|gb|ADP15345.1| hypothetical protein AXYL_02016 [Achromobacter xylosoxidans A8]
          Length = 254

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 94/229 (41%), Gaps = 16/229 (6%)

Query: 20  IRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTII 79
           +RK         L   + W +  T L        + P L+P      + IV+LG  T   
Sbjct: 32  LRKTGGALIVAGLLWALAWSLPATSLWLGGALESRYPHLAPSESPTADAIVVLGGNT--- 88

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQH--SMHCTIIISGGDPQKHGLAESIVYNNK 137
               A      F  Y +    +R+  + + +       +++SGG  +   ++E+    + 
Sbjct: 89  ----ANGRANWFLPYDKDTAVVRVDTAAQLYLAGRAPKVLLSGGALEGD-VSEARGMAHA 143

Query: 138 LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
           + + GV    + LE  S  T++NA  +   +K+     ++LV+SA H+ R+   F   G+
Sbjct: 144 IRQQGVPETALILENSSRTTYENAALTEDQLKSRGIGKVLLVTSALHMPRAMAAFSKQGV 203

Query: 198 NTKASCSD---YLNAYYSI---IPLSANFYLTELALKEYIGILIAYYRG 240
              A+ +       A  S+   +P    F  +   +KEY G+ + + RG
Sbjct: 204 EAVAAPAPPQIVAPADGSLPLWLPDQRTFDASRSIIKEYAGLFVYWLRG 252


>gi|289675765|ref|ZP_06496655.1| hypothetical protein PsyrpsF_21006 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 256

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 84/196 (42%), Gaps = 31/196 (15%)

Query: 56  PLLSPQWK---KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI---FETMRLYKSCKQ 109
           PL   QW    +  + IV+LGNG          R  P++ + +      E +RL     +
Sbjct: 67  PLPQQQWATLAQQADAIVVLGNGRE--------RNSPTWGTDTPTGLGLERLRLAARLAK 118

Query: 110 HSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL-----ETQSLDTFQNAQFS 164
            S    I+ SGG       +E+ +    L      +DD  +     E  S  T++NA  S
Sbjct: 119 ES-GLPILTSGGLHFDQPPSEASIMAQSL------QDDFAVAVRWQEGLSRTTWENATMS 171

Query: 165 SSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN-----AYYSIIPLSAN 219
           +++++    K ++LV+ A+H+ R++  F+  G     +   +L       +   +P S  
Sbjct: 172 AAILQPQGIKRVVLVTQAWHMPRARWSFEQAGFTVVGAPVGFLGVDNARPFGGWLPESRV 231

Query: 220 FYLTELALKEYIGILI 235
           F  + + L E  G+L+
Sbjct: 232 FTQSGVLLNEAAGLLV 247


>gi|15641722|ref|NP_231354.1| hypothetical protein VC1718 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121585785|ref|ZP_01675579.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|153212106|ref|ZP_01947923.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|153817128|ref|ZP_01969795.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|153823662|ref|ZP_01976329.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|153825454|ref|ZP_01978121.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|153827934|ref|ZP_01980601.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|227081867|ref|YP_002810418.1| hypothetical protein VCM66_1658 [Vibrio cholerae M66-2]
 gi|229508174|ref|ZP_04397679.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae BX 330286]
 gi|229511588|ref|ZP_04401067.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae B33]
 gi|229515111|ref|ZP_04404571.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae TMA 21]
 gi|229518727|ref|ZP_04408170.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae RC9]
 gi|229520681|ref|ZP_04410104.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae TM 11079-80]
 gi|229607747|ref|YP_002878395.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae MJ-1236]
 gi|254224867|ref|ZP_04918482.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|254285337|ref|ZP_04960302.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|254848836|ref|ZP_05238186.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297579300|ref|ZP_06941228.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298498204|ref|ZP_07008011.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9656238|gb|AAF94868.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121549923|gb|EAX59941.1| conserved hypothetical protein [Vibrio cholerae 2740-80]
 gi|124116902|gb|EAY35722.1| conserved hypothetical protein [Vibrio cholerae 1587]
 gi|125622555|gb|EAZ50874.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|126512277|gb|EAZ74871.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457]
 gi|126518811|gb|EAZ76034.1| conserved hypothetical protein [Vibrio cholerae B33]
 gi|148876515|gb|EDL74650.1| conserved hypothetical protein [Vibrio cholerae 623-39]
 gi|149740866|gb|EDM54951.1| conserved hypothetical protein [Vibrio cholerae MZO-2]
 gi|150424609|gb|EDN16545.1| conserved hypothetical protein [Vibrio cholerae AM-19226]
 gi|227009755|gb|ACP05967.1| conserved hypothetical protein [Vibrio cholerae M66-2]
 gi|229342236|gb|EEO07231.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae TM 11079-80]
 gi|229343416|gb|EEO08391.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae RC9]
 gi|229347816|gb|EEO12775.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae TMA 21]
 gi|229351553|gb|EEO16494.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae B33]
 gi|229355679|gb|EEO20600.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae BX 330286]
 gi|229370402|gb|ACQ60825.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae MJ-1236]
 gi|254844541|gb|EET22955.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|297536894|gb|EFH75727.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297542537|gb|EFH78587.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 282

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 102/226 (45%), Gaps = 39/226 (17%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           C ++LFS  G     +  + T LL  L+ +Y   L       +G +  +++LGNG  I  
Sbjct: 48  CLVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFL-----PVEGTLDYVMVLGNGHVIDD 102

Query: 81  TIPAIRIEPSFQSYSRIFETMR---LYKSCKQHSMHCTIIISG---GDPQKHGLAESIVY 134
            IP    E +  +  R+ E +R   +Y   K       +I+SG   G    H    + V 
Sbjct: 103 DIPPTS-ELTRAALMRLTEGIRISRMYPGSK-------LILSGYAGGSEVSHARMMARVA 154

Query: 135 NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQH 194
               L  GV + DI L   + DT++ A+ +++ +   Q K ++LV+SA H+KR+   F+ 
Sbjct: 155 ----LALGVPKSDIILLETAKDTWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFES 207

Query: 195 FGINTKASCSDYLN------AYYSIIPLSANFYLTELALKEYIGIL 234
            G+    + ++YL        +   IP S     TE    E +G++
Sbjct: 208 AGLTPIPAPTNYLGHLNIIQPWDKYIPRSRYLEQTEQYWHETLGLM 253


>gi|229529254|ref|ZP_04418644.1| membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio cholerae 12129(1)]
 gi|229333028|gb|EEN98514.1| membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Vibrio cholerae 12129(1)]
          Length = 282

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 102/226 (45%), Gaps = 39/226 (17%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           C ++LFS  G     +  + T LL  L+ +Y   L       +G +  +++LGNG  I  
Sbjct: 48  CLVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFL-----PVEGTLDYVMVLGNGHVIDD 102

Query: 81  TIPAIRIEPSFQSYSRIFETMR---LYKSCKQHSMHCTIIISG---GDPQKHGLAESIVY 134
            IP    E +  +  R+ E +R   +Y   K       +I+SG   G    H    + V 
Sbjct: 103 DIPPTS-ELTRAALMRLTEGIRISRMYPGSK-------LILSGYAGGSEVSHARMMARVA 154

Query: 135 NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQH 194
               L  GV + DI L   + DT++ A+ +++ +   Q K ++LV+SA H+KR+   F+ 
Sbjct: 155 ----LALGVPKSDIILLETAKDTWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFES 207

Query: 195 FGINTKASCSDYLN------AYYSIIPLSANFYLTELALKEYIGIL 234
            G+    + ++YL        +   IP S     TE    E +G++
Sbjct: 208 AGLTPIPAPTNYLGHLNIIQPWDKYIPRSRYLEQTEQYWHETLGLM 253


>gi|228991260|ref|ZP_04151218.1| hypothetical protein bpmyx0001_20190 [Bacillus pseudomycoides DSM
           12442]
 gi|228768484|gb|EEM17089.1| hypothetical protein bpmyx0001_20190 [Bacillus pseudomycoides DSM
           12442]
          Length = 185

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 49/86 (56%), Gaps = 3/86 (3%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           +I+SGG  +   + E+    N L++ G+E + I +E +S  T++N +FS  +   M    
Sbjct: 74  VIVSGGQGEDEDIPEAHSMRNYLIKHGIEENRIFIEDRSTSTYENLKFSMDLYHVMHA-- 131

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKA 201
            ++VS+ YHL R+++  +  G+  ++
Sbjct: 132 -VVVSNTYHLYRTKIIAKRLGMQMES 156


>gi|301053815|ref|YP_003792026.1| hypothetical protein BACI_c22410 [Bacillus anthracis CI]
 gi|300375984|gb|ADK04888.1| conserved hypothetical protein [Bacillus cereus biovar anthracis
           str. CI]
          Length = 185

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 50/92 (54%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 72  VKVIVSGGQGEDEDIPEAHSMRNYLMARGIDESRILIEDQSTNTYENVKFSMDLY---DV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +   ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMKMETLAAE 160


>gi|295695151|ref|YP_003588389.1| protein of unknown function DUF218 [Bacillus tusciae DSM 2912]
 gi|295410753|gb|ADG05245.1| protein of unknown function DUF218 [Bacillus tusciae DSM 2912]
          Length = 188

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 7/126 (5%)

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
           EP     +R+   + LY+          I++SGG  +    +E+ V  + L   GV    
Sbjct: 43  EPGAALRARLEAGLDLYR----RGYAPRILVSGGQRRPGAPSEADVMADYLRVRGVPPRA 98

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKA---SCS 204
           + +E  S DT +N  FSS ++K    +  ++V+SAYHL R+    +  G++      + +
Sbjct: 99  LIVEDLSSDTVENLLFSSRLMKIHGWRRAVVVTSAYHLPRALWLARLAGLDASGYAPASA 158

Query: 205 DYLNAY 210
           D L  +
Sbjct: 159 DVLGTW 164


>gi|2196513|gb|AAB61159.1| putative membrane protein [Staphylococcus epidermidis]
          Length = 330

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 78/171 (45%), Gaps = 32/171 (18%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           I++LG+G      +   ++ P  QS  RI      + S K    H   ++SGG  +   +
Sbjct: 162 IIVLGSG------LIEDKVPPLLQS--RIDIGKNFWDSKKDK--HTKFLLSGGQGKDERI 211

Query: 129 AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS 188
           +ES      L+  GV  + I  E +S  T++N +FS S+I   +   II+ S+ YH+ R+
Sbjct: 212 SESQAMKKYLIAQGVNENRIICENKSQSTYENLKFSKSLIS--KNATIIICSNNYHILRA 269

Query: 189 -----QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
                +L + HF               YS+   + N++ T   ++E + IL
Sbjct: 270 VFIAKKLKYSHF---------------YSLGSKTKNYFFTNAFIRELVAIL 305


>gi|330013999|ref|ZP_08307835.1| hypothetical protein HMPREF9538_05555 [Klebsiella sp. MS 92-3]
 gi|328533292|gb|EGF60043.1| hypothetical protein HMPREF9538_05555 [Klebsiella sp. MS 92-3]
          Length = 259

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 90/210 (42%), Gaps = 32/210 (15%)

Query: 45  LLKHLQFSYQRPLLSPQWKKDG--NIIVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIF 98
           LLK ++ +Y      P W+ +   N +V+LG G T  P        PS      S  R+ 
Sbjct: 62  LLKPIEDTY------PTWRGEQPVNYVVVLGGGYTWNP-----EWAPSSNLINNSLPRLT 110

Query: 99  ETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDT 157
           E +RL+++     M  T     G   K     +     ++ ES GV R DI +  +  DT
Sbjct: 111 EGIRLWQANPGSKMIFT-----GAAAKTNPVSTAEAGARVAESLGVPRSDIIVLGRPKDT 165

Query: 158 FQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN------TKASCSDYLNAYY 211
            + A      I +      +LV+SA HL R+ ++F+H G++       + + +  LN + 
Sbjct: 166 EEEALAVKRAIGDAP---FLLVTSASHLPRAMIFFRHAGLDPLPAPANQLAVTSPLNPWE 222

Query: 212 SIIPLSANFYLTELALKEYIGILIAYYRGN 241
             IP       ++    E +G +  + +G+
Sbjct: 223 RAIPSPVWLMHSDRVGYETLGRVWQWLKGS 252


>gi|328543434|ref|YP_004303543.1| hypothetical protein [polymorphum gilvum SL003B-26A1]
 gi|326413179|gb|ADZ70242.1| DUF218 protein [Polymorphum gilvum SL003B-26A1]
          Length = 265

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 93/210 (44%), Gaps = 23/210 (10%)

Query: 44  ILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRL 103
           +L+  L+  +  P   P+   DG I+VL G   T++        +  F   +   E + +
Sbjct: 60  LLMVPLEDRFPAPSTLPE-TVDG-ILVLGGAIDTVVTG------KRPFPGLTTAGERVAV 111

Query: 104 YKSCKQHSMHCTIIISGGDPQKHGLAESIVYNN-KLLES-GVERDDIKLETQSLDTFQNA 161
                +      I+ SGG     G + +      +L ES G+  D + LE +SL+T+QNA
Sbjct: 112 IPGLARRYPQALIVHSGGSGLLFGNSSTEAEGAAQLFESFGLAPDRLVLEDRSLNTWQNA 171

Query: 162 QFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT---------KASCSDYLNAYYS 212
            ++ ++++   G+  +LV+SA H+ R+   F+  G                 D L  + +
Sbjct: 172 VYTKALVEPRAGQTWLLVTSAMHMPRAVGVFRKAGWTGVVPYPVDWRTRGPEDRLRVFGA 231

Query: 213 IIPLSANFYLTELALKEYIGILIAYYRGNR 242
           +   S      ++A +E++G L+AY    R
Sbjct: 232 V---SDGLTRLDIAFREWVG-LVAYRASGR 257


>gi|229011547|ref|ZP_04168733.1| hypothetical protein bmyco0001_19960 [Bacillus mycoides DSM 2048]
 gi|229059943|ref|ZP_04197317.1| hypothetical protein bcere0026_20500 [Bacillus cereus AH603]
 gi|229133107|ref|ZP_04261943.1| hypothetical protein bcere0014_20300 [Bacillus cereus BDRD-ST196]
 gi|228650316|gb|EEL06315.1| hypothetical protein bcere0014_20300 [Bacillus cereus BDRD-ST196]
 gi|228719356|gb|EEL70960.1| hypothetical protein bcere0026_20500 [Bacillus cereus AH603]
 gi|228749702|gb|EEL99541.1| hypothetical protein bmyco0001_19960 [Bacillus mycoides DSM 2048]
          Length = 166

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 52/92 (56%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++ + I +E +S +T++N +FS  +      
Sbjct: 53  VKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDENRILIEDRSTNTYENLKFSMDL---YDV 109

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  GI  +A  ++
Sbjct: 110 KHAVVVSNTYHLYRTKIIAKRLGIKMEALAAE 141


>gi|258404265|ref|YP_003197007.1| hypothetical protein Dret_0127 [Desulfohalobium retbaense DSM 5692]
 gi|257796492|gb|ACV67429.1| protein of unknown function DUF218 [Desulfohalobium retbaense DSM
           5692]
          Length = 258

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 85/191 (44%), Gaps = 33/191 (17%)

Query: 65  DGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
           D   +V+LG G    P +P +  +    +  R+ E +R+ +         T+++SG   +
Sbjct: 82  DAQWVVVLGGGHASDPGLP-VSAKVGTSTMYRLVEGVRIVRQLP----GATLLLSGYAGK 136

Query: 125 --------KHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN- 175
                   K  LA+++ Y   L+          LE +  DT Q A    +MI    G+  
Sbjct: 137 EAVSNARIKADLAKALGYEGPLV----------LEERPRDTAQEA----AMITERLGQAP 182

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSI-----IPLSANFYLTELALKEY 230
            +LV+SA H+ R+   FQ  G +  A+ + +L    ++      P + + Y  + A+ EY
Sbjct: 183 FVLVTSASHMPRAMALFQGQGSHPIAAPTGHLAPREALQAWDWFPNAQDAYCLQRAVYEY 242

Query: 231 IGILIAYYRGN 241
           +G+  A+ RG 
Sbjct: 243 LGLGWAWLRGQ 253


>gi|187478721|ref|YP_786745.1| membrane protein [Bordetella avium 197N]
 gi|115423307|emb|CAJ49841.1| putative membrane protein [Bordetella avium 197N]
          Length = 254

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/211 (20%), Positives = 88/211 (41%), Gaps = 16/211 (7%)

Query: 38  WGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI 97
           W +  T L       ++ P L P      + IV+LG  T       A      F  Y + 
Sbjct: 50  WSLPATSLWLGGALEHRYPYLEPDSAPTADAIVVLGGNT-------ANGRANWFLPYDKD 102

Query: 98  FETMRLYKSCKQH--SMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
              +R+  +   +       +++SGG  + + ++E+    +++ + GV    + LE  S 
Sbjct: 103 TAVVRVDTATDLYLADRAPKVVLSGGALEGN-VSEAQGMAHRMRQRGVPDSALVLENASR 161

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCS------DYLNA 209
           +T++NA  +   ++      ++LV+SA H+ R+   F   G+   A+ +          +
Sbjct: 162 NTYENAALTEDTLRANHISKVLLVTSALHMPRAMAAFSKQGVEAIAAPTPPQIVPPTDGS 221

Query: 210 YYSIIPLSANFYLTELALKEYIGILIAYYRG 240
               +P       +   +KEY G+L+ + RG
Sbjct: 222 LSPWMPDMRTLDASRSIIKEYAGLLVYWLRG 252


>gi|146308799|ref|YP_001189264.1| hypothetical protein Pmen_3784 [Pseudomonas mendocina ymp]
 gi|145577000|gb|ABP86532.1| protein of unknown function DUF218 [Pseudomonas mendocina ymp]
          Length = 256

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 79/193 (40%), Gaps = 16/193 (8%)

Query: 50  QFSYQRPLLSPQWK---KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKS 106
           Q   +  L   QW    +  + IV+LG G         +  +P   +  R+    RL ++
Sbjct: 61  QLEREPALAEAQWPSLAQRADAIVILGAGREQGDPGWGLVDQPGLMALERLRYAARLARA 120

Query: 107 CKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL-ETQSLDTFQNAQFSS 165
                     +  G  P +  L   ++  +  LE       I+  E QS  T++NAQ S+
Sbjct: 121 SGLPLAATGGLHYGQPPSEAALMADVMQRDYGLE-------IRWREEQSRTTWENAQLSA 173

Query: 166 SMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYY-----SIIPLSANF 220
            +++    + ++LV+ A+H+ R++  F+  G     +   +L+  Y       +P S   
Sbjct: 174 ELLQAQGVRRVVLVTQAWHMPRARWCFEQAGFEVITAPMGFLSKGYERPLGGWLPESRAI 233

Query: 221 YLTELALKEYIGI 233
           +     L E +G+
Sbjct: 234 WQNSQLLNEALGL 246


>gi|229172971|ref|ZP_04300523.1| hypothetical protein bcere0006_20790 [Bacillus cereus MM3]
 gi|228610491|gb|EEK67761.1| hypothetical protein bcere0006_20790 [Bacillus cereus MM3]
          Length = 201

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 51/93 (54%), Gaps = 3/93 (3%)

Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ 172
              +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +     
Sbjct: 87  EAKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY---D 143

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
            K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 144 VKHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 176


>gi|227496423|ref|ZP_03926709.1| integral membrane protein [Actinomyces urogenitalis DSM 15434]
 gi|226834042|gb|EEH66425.1| integral membrane protein [Actinomyces urogenitalis DSM 15434]
          Length = 363

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 65/145 (44%), Gaps = 20/145 (13%)

Query: 99  ETMRLYKSC---KQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSL 155
           E  R  KS    +  S    +++SGG       +E+       +  GV R+DI LE +S 
Sbjct: 201 EAARRQKSSSDGEAASGRPVLVMSGGQGDDEPTSEASAMAEYAVGLGVPREDIVLEDRST 260

Query: 156 DTFQNAQFSSSMIKNMQGKN------IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA 209
            T +N  F+  ++ ++  ++      ++LV+S+YH  R+ +             SD   +
Sbjct: 261 TTRENIAFTRELLADLGARHNVSYDQVLLVTSSYHAVRTAIL-----------ASDMETS 309

Query: 210 YYSIIPLSANFYLTELALKEYIGIL 234
           +      +A +Y+    L+EY+ +L
Sbjct: 310 WAVAPAPTARYYVINAWLREYVAVL 334


>gi|16801598|ref|NP_471866.1| hypothetical protein lin2536 [Listeria innocua Clip11262]
 gi|16415058|emb|CAC97763.1| lin2536 [Listeria innocua Clip11262]
          Length = 189

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 79/174 (45%), Gaps = 20/174 (11%)

Query: 25  FMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPA 84
           F   F++L   I  G I  +++    FS  R     +  ++ N +++LG      P  P+
Sbjct: 4   FKKFFVIL---IVIGFIYVLIVAAFMFSGTRA----KPDENVNTVLILGAKINGDPATPS 56

Query: 85  IRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVE 144
           + +E    +       +  Y   K       +I+SGG        E+ V    L+  G+ 
Sbjct: 57  LVLEERLDT---AVAYLNEYPKAK-------VIVSGGQGADESTTEAAVMEEYLVNEGIA 106

Query: 145 RDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN 198
           R+ IK ET+S  T +N ++S+   K   GK +I V+S YH+ R+ +  +  GIN
Sbjct: 107 RNRIKKETKSKRTEENIKYSNE--KFDLGKTVI-VTSDYHMYRALMLAKRQGIN 157


>gi|228958546|ref|ZP_04120266.1| hypothetical protein bthur0005_20520 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228801173|gb|EEM48070.1| hypothetical protein bthur0005_20520 [Bacillus thuringiensis
           serovar pakistani str. T13001]
          Length = 162

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 49  VKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDL---YNV 105

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 106 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 137


>gi|71280901|ref|YP_268732.1| hypothetical protein CPS_2002 [Colwellia psychrerythraea 34H]
 gi|71146641|gb|AAZ27114.1| conserved hypothetical protein [Colwellia psychrerythraea 34H]
          Length = 254

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 109/250 (43%), Gaps = 28/250 (11%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           +LL  IF +V +     QSI+ +      +L+ +F  +      ++  ++  Y      P
Sbjct: 20  VLLLLIFALVVHRKKPKQSIKSLSTAIVILLISAFAPFS---DTVMTAIENDY-----PP 71

Query: 61  QWKKDGNI--IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
             K + ++  IV+LG G      +P +  +    S  R+ E +R+Y    Q      II 
Sbjct: 72  YVKTNVSVDYIVVLGCGHNTNAELP-VTSQLKTCSLQRMVEAVRIY----QLHPEARIIT 126

Query: 119 SG-GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           SG G       AE++     L+  GV    I  E    DT + AQ    +   +QG  +I
Sbjct: 127 SGYGGHNPVSNAETV--KQSLILLGVPAQKIITENFPKDTEEEAQL---IAPRVQGTQVI 181

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYL-------NAYYSIIPLSANFYLTELALKEY 230
           LV++A H+ RS  YFQ  GI   A+ + Y         ++   IP S     T +A  E 
Sbjct: 182 LVTNADHMPRSINYFQAEGIYPIAAPTGYWVKNPDSSKSWVHYIPTSKKLEQTTIAWYES 241

Query: 231 IGILIAYYRG 240
           +G+++ +++ 
Sbjct: 242 LGLIVQWFKS 251


>gi|182417046|ref|ZP_02948424.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237668527|ref|ZP_04528511.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
 gi|182379055|gb|EDT76559.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237656875|gb|EEP54431.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
          Length = 273

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 8/117 (6%)

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
           EPS     R+   +      K ++ H  I++SGG      ++E+      L+  G+    
Sbjct: 129 EPSLTLSGRLDAAIEY---IKDYNNHSKIVVSGGKGNDEKISEAEAMKKYLVSKGMPEGQ 185

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGK-----NIILVSSAYHLKRSQLYFQHFGINT 199
           I +E +S  T++N +FS  +I+    K     N+ +V++ +H  RS+L  Q  G N 
Sbjct: 186 ILMENKSTTTYENFKFSKELIEEDSNKEIDEINVKVVTTDFHAFRSKLLAQKNGYNN 242


>gi|160935020|ref|ZP_02082406.1| hypothetical protein CLOLEP_03896 [Clostridium leptum DSM 753]
 gi|156866473|gb|EDO59845.1| hypothetical protein CLOLEP_03896 [Clostridium leptum DSM 753]
          Length = 262

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 61/130 (46%), Gaps = 7/130 (5%)

Query: 74  NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIV 133
           NGT +I        +PS     R+ E  + Y      +M    I SGG      ++E+  
Sbjct: 110 NGTVVILGCQVKGTQPSLMLTKRL-EAAKEYLDRNPEAM---CIPSGGKGNGELVSEAQA 165

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG--KNIILVSSAYHLKRSQLY 191
               L+E G++ + I  E QS DT +N + +S  I + +G  K++ILVS  +H  R+ L 
Sbjct: 166 MKAWLVEHGIDENRIYPEAQSRDTVENIR-NSKEIMDSKGLPKDMILVSDGFHQYRAGLI 224

Query: 192 FQHFGINTKA 201
            Q  GI   A
Sbjct: 225 AQKQGIEAGA 234


>gi|302039339|ref|YP_003799661.1| hypothetical protein NIDE4067 [Candidatus Nitrospira defluvii]
 gi|300607403|emb|CBK43736.1| conserved protein of unknown function DUF218 [Candidatus Nitrospira
           defluvii]
          Length = 270

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 74/169 (43%), Gaps = 20/169 (11%)

Query: 90  SFQSYSRIFETMRLYKSCK----QHSMHCTIIISGGDPQ--KHGLAESIVYNNKLLESGV 143
           S +    + +  R   SC     + ++   ++++GGD    + GL ES       +  GV
Sbjct: 104 SLRPADEVSDASRQRTSCGTDLWKQNLAPKLLLTGGDATVFRTGLMESHEMKRWAIRLGV 163

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG-INTKAS 202
               I  E QS  T++NA  + SM+ +     I+LV++AYHL R+   F+  G + T   
Sbjct: 164 PESAILTEEQSRTTYENAVQTKSMLGS---GRILLVTAAYHLPRAVRLFEKQGFVVTPFP 220

Query: 203 CS---------DYLNA-YYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
           C           +  A  +  +P +    +T  A+ E  GI++ +  G 
Sbjct: 221 CGFESQHTPQQAWEQATLFDFLPTAKALLITSQAVDEVAGIIVYWLAGK 269


>gi|89069286|ref|ZP_01156649.1| hypothetical protein OG2516_14486 [Oceanicola granulosus HTCC2516]
 gi|89045162|gb|EAR51230.1| hypothetical protein OG2516_14486 [Oceanicola granulosus HTCC2516]
          Length = 156

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 61/143 (42%), Gaps = 17/143 (11%)

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           PS     R      LY     H+    ++I  G   +HG  E+ V    LL +GV    I
Sbjct: 16  PSPTLRRRTLHAAGLY-----HAGRGRLLIPCGGQGRHGPPEAEVMRALLLGAGVPDAAI 70

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
             E +S  T++N  F+  ++       +++V+  YH+ R++L  +  G          L 
Sbjct: 71  LQERRSTSTWENLLFARPLLAAQGETRVLIVTDRYHVPRARLAARRMG----------LT 120

Query: 209 AYYSIIPLSANFYLTEL--ALKE 229
           A  +  PL  +   T+L  AL+E
Sbjct: 121 AAGAPPPLRGSHVPTQLRQALRE 143


>gi|332653075|ref|ZP_08418820.1| hypothetical protein HMPREF0866_00773 [Ruminococcaceae bacterium
           D16]
 gi|332518221|gb|EGJ47824.1| hypothetical protein HMPREF0866_00773 [Ruminococcaceae bacterium
           D16]
          Length = 205

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 62/118 (52%), Gaps = 9/118 (7%)

Query: 115 TIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK----N 170
           T+++SGG       +E+    + L E GV+ D I LE +S +T +N  +S  +++    +
Sbjct: 84  TVVVSGGQGSNEPTSEAACMADYLEEHGVDPDQILLEDKSSNTKENLIYSRELLEEQGVD 143

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTE-LAL 227
           +    +++VS+ +HL RS++  + FG    ++    L A  + IP     Y+ E LAL
Sbjct: 144 VGEGGVLVVSNGFHLTRSRMLAERFGYGHVST----LAAPTTHIPSRIQMYIREPLAL 197


>gi|291458721|ref|ZP_06598111.1| putative membrane protein [Oribacterium sp. oral taxon 078 str.
           F0262]
 gi|291418638|gb|EFE92357.1| putative membrane protein [Oribacterium sp. oral taxon 078 str.
           F0262]
          Length = 382

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 66/135 (48%), Gaps = 15/135 (11%)

Query: 57  LLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRL-YKSCKQHSMHCT 115
           L  P+ ++D + IV+LG G       P +         SRI   +RL Y++ +       
Sbjct: 187 LFHPRKRRDLDYIVVLGAGIRGEAVTPLL--------ASRIERGIRLLYENPR-----AL 233

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           +I+SGG  +   + E        L  GV+   I  E +SL+T QN  FS +++   + K 
Sbjct: 234 LILSGGQGEGEDIPEGEAMRRYALSQGVDPGRILTEEKSLNTRQNLLFSRALMGGEKPK- 292

Query: 176 IILVSSAYHLKRSQL 190
           I +V+++YH+ R+ L
Sbjct: 293 IAVVTTSYHVFRALL 307


>gi|212634481|ref|YP_002311006.1| hypothetical protein swp_1641 [Shewanella piezotolerans WP3]
 gi|212555965|gb|ACJ28419.1| Conserved hypothetical protein [Shewanella piezotolerans WP3]
          Length = 280

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 82/170 (48%), Gaps = 9/170 (5%)

Query: 66  GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQK 125
           G ++++LG+G   +   PA++ + S    +R+ E +R     +     C +++SG     
Sbjct: 111 GCLVMVLGSGHDEVENQPAVQ-QLSNTGLARLSEGIRQLSLGQD----CQLVVSGWSGGL 165

Query: 126 HGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHL 185
           +  A + V  +  +E GV  + I     + DT + AQF    + +   +   LV+SA H+
Sbjct: 166 NTRAHADVMFDAAVELGVNPNAIIKFPLAKDTIEEAQFMQWEVADAPFR---LVTSASHM 222

Query: 186 KRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYL-TELALKEYIGIL 234
            RS   F++ G+N  A+ +D+           A   L ++ A+ EY+G+L
Sbjct: 223 PRSMAIFENSGLNATAAPTDFAQRKTYWWYFDAQSLLSSQRAIHEYLGLL 272


>gi|327386938|gb|AEA58412.1| hypothetical protein LCBD_2918 [Lactobacillus casei BD-II]
          Length = 360

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 7/114 (6%)

Query: 83  PAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESG 142
           P  +++P+ +    I       K+ K++     I+++GG P+ + L E+ V    L+  G
Sbjct: 196 PNGKMQPTMKKRLEI-----ALKAAKKYP-KSKILVAGGVPE-NKLTEATVMQKWLVAHG 248

Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFG 196
           + +  I+LE  S +T +NA FS   + N +  +  L++SA H++R+ L +Q  G
Sbjct: 249 IAKKRIELEDLSTNTVENALFSVRELVNREATSATLITSATHMRRAFLLYQMAG 302


>gi|228920990|ref|ZP_04084327.1| hypothetical protein bthur0011_20010 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228838684|gb|EEM83988.1| hypothetical protein bthur0011_20010 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 162

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +      
Sbjct: 49  SKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY---NV 105

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 106 KHAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 137


>gi|134103151|ref|YP_001108812.1| integral membrane protein [Saccharopolyspora erythraea NRRL 2338]
 gi|133915774|emb|CAM05887.1| integral membrane protein [Saccharopolyspora erythraea NRRL 2338]
          Length = 196

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI 176
           +I  G P   G +E +V  + L+  GV  +D+ L+   +DT  +A+ ++   +    + I
Sbjct: 82  LIVSGSPHSRGYSEPVVMRDYLVARGVPPEDVLLDESGVDTCSSARAAA---RTFGLRAI 138

Query: 177 ILVSSAYHLKRSQLYFQHFGINT 199
            +V++ +HL+RS   F+  GI+T
Sbjct: 139 TVVTTNFHLRRSVALFRRAGIDT 161


>gi|256390075|ref|YP_003111639.1| hypothetical protein Caci_0865 [Catenulispora acidiphila DSM 44928]
 gi|256356301|gb|ACU69798.1| protein of unknown function DUF218 [Catenulispora acidiphila DSM
           44928]
          Length = 350

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN--MQG 173
           +I+SGG      L+E+    N L+E+G   D I  E QS  T +N  +S+++++    +G
Sbjct: 217 LIVSGGKGSDERLSEAEAMENYLVEAGFPADRILKEDQSSTTEENLLYSAALMRENRPEG 276

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
              ++V++ +H  R+ L  +   +  +   S            +A ++L    ++E+I +
Sbjct: 277 YRCVVVTNDFHSYRAALIARDLDVPAQVVGSP-----------TAAYFLPSATIREFIAV 325

Query: 234 LIAYYRGN 241
            + Y++ N
Sbjct: 326 FVRYWKWN 333


>gi|28871924|ref|NP_794543.1| hypothetical protein PSPTO_4809 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28855177|gb|AAO58238.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 256

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 107/252 (42%), Gaps = 31/252 (12%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTIL-LKHLQFSYQRPLLSPQWK- 63
           + LI+ +W    +  R     +CF      +    +P ++     +    RPL   QW  
Sbjct: 19  LLLILGWW---LRRSRPRLATACFAAGLGGLWLMSVPVVVEFAARKMEQIRPLPQQQWAT 75

Query: 64  --KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI---FETMRLYKSCKQHSMHCTIII 118
             +  + IV+LGNG          R  P++ + +      E +RL     + S    I+ 
Sbjct: 76  LAQQADAIVVLGNGRE--------RNSPTWGADTPTGLGLERLRLAARLAKES-GLPILT 126

Query: 119 SGGDPQKHGLAESIVYNNKLLES-GVERDDIKL-ETQSLDTFQNAQFSSSMIKNMQGKNI 176
           +GG       +E+ +    L +  GV    ++  E  S  T++NA  ++++++    K +
Sbjct: 127 AGGLHFDQPPSEASIMAQALQQDFGV---TVRWQEGLSRTTWENATMTAAVLQPQGIKRV 183

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYLN-----AYYSIIPLSANFYLTELALKEYI 231
           +LV+ A+H+ R++  F+  G    ++   +L       +   +P S  F  + + L E  
Sbjct: 184 VLVTQAWHMSRARWSFEQAGFTVVSAPVGFLGVDNARPFGGWLPESRVFTQSGVLLNEAA 243

Query: 232 GILI--AYYRGN 241
           G+L+    YRG 
Sbjct: 244 GLLVYPWIYRGG 255


>gi|238749759|ref|ZP_04611264.1| hypothetical protein yrohd0001_30790 [Yersinia rohdei ATCC 43380]
 gi|238712414|gb|EEQ04627.1| hypothetical protein yrohd0001_30790 [Yersinia rohdei ATCC 43380]
          Length = 255

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 19/182 (10%)

Query: 69  IVLLGNGTTIIPT-IPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHG 127
           IV+LG G T  P   P+  +     S  R+ E +RLY++   H     +   G  P    
Sbjct: 82  IVVLGGGYTFNPNWAPSANL--FANSLPRVTEGIRLYRA---HPNAKLVFTGGAAPHNQS 136

Query: 128 LAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLK 186
            A++     ++ ES GV  +DI    Q  DT + A   ++++ +   K  +LV+SA HL 
Sbjct: 137 SAKTAA---QVAESLGVPAEDIIALDQPKDTIEEAAAVANLVGD---KPFLLVTSANHLP 190

Query: 187 RSQLYFQHFGIN------TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
           R+  +F   G+N       + + +  L ++   IP +     +E +  E +G++      
Sbjct: 191 RAMNFFVAKGLNPIPAPANQLAITTPLQSWERAIPAAVYLGHSERSWYETLGLMWQKLTA 250

Query: 241 NR 242
           N+
Sbjct: 251 NK 252


>gi|254455840|ref|ZP_05069269.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082842|gb|EDZ60268.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 228

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 87/198 (43%), Gaps = 12/198 (6%)

Query: 40  IIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFE 99
           I+   L+ +L+  YQ  L  P   +  + IV+L      I +   +  E   ++  RIF 
Sbjct: 30  IVSDKLVAYLESDYQ--LSKPSNIEPADSIVVLSGMIRTINSKDGLDYEFG-EASDRIFA 86

Query: 100 TMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQ 159
            + L+K  K   +   I+  G  P   G+ E        + +G+  ++I L     +T Q
Sbjct: 87  GINLFKEKKAPKL---ILTRGKLPWSVGIPEGEYLKEIAINNGISENNILLTENVENTDQ 143

Query: 160 NAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA-----YYSII 214
            A+    ++   + K ++LV+SA+H+ R+Q  F+  GIN      D+        + S I
Sbjct: 144 EAKAIKKLLSEDKSK-VLLVTSAFHMPRAQKVFEAAGINVVPFPVDFQKGLSKITFMSFI 202

Query: 215 PLSANFYLTELALKEYIG 232
           P +     T   ++E IG
Sbjct: 203 PSANALSGTSFFVREMIG 220


>gi|229494703|ref|ZP_04388461.1| integral membrane protein [Rhodococcus erythropolis SK121]
 gi|229318370|gb|EEN84233.1| integral membrane protein [Rhodococcus erythropolis SK121]
          Length = 336

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/224 (18%), Positives = 100/224 (44%), Gaps = 27/224 (12%)

Query: 15  LLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGN 74
           LL Q       +  F L+ S++G+ +  + LL    +  Q+      ++   + IV+ G 
Sbjct: 113 LLTQRYWLAVVLGSFSLVASYLGF-LFTSFLLYSYVYGRQK------YQPGMDAIVVHGA 165

Query: 75  GTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVY 134
           G +     P +         SR+ +   ++++  +      +++SGG      ++E+   
Sbjct: 166 GLSGADVTPLLA--------SRLDKAADVFRAEVREGRSPLLVVSGGKGSDEVVSEAEAM 217

Query: 135 NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIK-NMQGKNIILVSSAYHLKRSQLYFQ 193
              L++ G+ R+ + LE +S  T +N +++  +++ N     ++LV+S +H+ R+  + +
Sbjct: 218 CVYLVDHGIPRESVILEDRSTTTLENLEYTRDLLRANTTKPRMVLVTSNFHILRTATFAR 277

Query: 194 HFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
              ++ +   S            +A +YL    L+E+  + + +
Sbjct: 278 SLDLDAEVIGSH-----------TARYYLPSAILREFAAVTVEH 310


>gi|293604449|ref|ZP_06686856.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
 gi|292817326|gb|EFF76400.1| conserved hypothetical protein [Achromobacter piechaudii ATCC
           43553]
          Length = 254

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 92/229 (40%), Gaps = 16/229 (6%)

Query: 20  IRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTII 79
           +RK         L   + W +  T L        + P L+P      + IV+LG  T   
Sbjct: 32  LRKTGAAIIAAGLLWALAWSLPVTSLWLGGALENRYPHLAPADSPTADAIVVLGGNT--- 88

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQH--SMHCTIIISGGDPQKHGLAESIVYNNK 137
               A      F  Y +    +R+  + + +       +++SGG  +   ++E+    + 
Sbjct: 89  ----ANGRANWFLPYDKDTAVVRVDTAAQLYLAGRAPKVLLSGGALEGD-VSEARGMAHA 143

Query: 138 LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
           + + GV    + LE  S  T++NA  +   +K+     ++LV+SA H+ R+   F   G+
Sbjct: 144 IRQQGVPESALILENSSRTTYENAALTEDALKSRGITKVLLVTSALHMPRAMAAFSKQGV 203

Query: 198 NTKAS------CSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
              A+       +    +    +P    F  +   +KEY G+ + + RG
Sbjct: 204 EAIAAPAPPQIVAPADGSLSPWVPDQRTFDASRSIIKEYAGLFVYWLRG 252


>gi|307702098|ref|ZP_07639105.1| integral membrane protein [Streptococcus mitis NCTC 12261]
 gi|307707431|ref|ZP_07643913.1| integral membrane protein [Streptococcus mitis NCTC 12261]
 gi|307616383|gb|EFN95574.1| integral membrane protein [Streptococcus mitis NCTC 12261]
 gi|307616585|gb|EFN95775.1| integral membrane protein [Streptococcus mitis NCTC 12261]
          Length = 339

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 95/212 (44%), Gaps = 36/212 (16%)

Query: 27  SCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIR 86
           S F+  F+F+G+ ++ +IL           L  P+ KK  + I++ G G      +   +
Sbjct: 135 SYFIFGFAFVGF-MLYSILY----------LFIPK-KKHYDFIIIHGAGL-----LDGEK 177

Query: 87  IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL-ESGVER 145
           + P  +   RI + +  Y + K    H  II SGG      ++E+    N LL E+ V +
Sbjct: 178 VTPLLKR--RIDKAVEAYHNSKNP--HIKIIASGGQGGDEKISEAQAITNYLLEETDVPQ 233

Query: 146 DDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKA-SC 203
           D I LE QS  T++N  FS  + + +  K   + V++ YH+ R+  Y +   +      C
Sbjct: 234 DGIILEDQSRTTYENLLFSKELGEKLVAKPQFLFVTNDYHVFRTSTYARKLKMKGDGLGC 293

Query: 204 SDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
                        +A +Y+    ++EY+ + +
Sbjct: 294 R------------TAGYYIPSAFIREYVALCV 313


>gi|313500771|gb|ADR62137.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 253

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 85/193 (44%), Gaps = 26/193 (13%)

Query: 56  PLLSPQWK---KDGNIIVLLGNGTTIIPTIPAIRIEPSF----QSYSRIFETMRLYKSCK 108
           PL    W    +  + IV+LG G          R +P++    Q  +   E MR      
Sbjct: 67  PLAVSDWAGLARRADAIVVLGAGRE--------RGDPAWGGGDQPTATALERMRFAARLA 118

Query: 109 QHSMHCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKL-ETQSLDTFQNAQFSSS 166
           + S    ++ SGG       +E+ +   +L E   VE   +K  E  S  T++NAQ ++ 
Sbjct: 119 KAS-GLPVLTSGGLHYGTPPSEARLMAERLHEDFAVE---VKWREEASRTTWENAQLTAK 174

Query: 167 MIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS-----CSDYLNAYYSIIPLSANFY 221
           +++ +  + ++LV+ A+H++RS+  F+  G     +       D+   +  ++P S   +
Sbjct: 175 VLQPLGFRRVVLVTQAWHMQRSRWSFEQAGFEVVPAPVGFLGRDHARPFGGLLPESRAMW 234

Query: 222 LTELALKEYIGIL 234
            +     E +G++
Sbjct: 235 QSGQLFNEVVGLM 247


>gi|307687370|ref|ZP_07629816.1| hypothetical protein Ccel74_04393 [Clostridium cellulovorans 743B]
          Length = 254

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 22/146 (15%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISGGDPQKH 126
           +V+LG G      +   RI  S Q        +RL  + + HS+H    II+SGG     
Sbjct: 105 VVVLGAG------LIGDRISTSLQ--------LRLDAALEFHSIHPEIPIIVSGGQGPDE 150

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---IILVSSAY 183
            L+E+    + L+E G++ + I +E +S  T++N  FS  +I N   K    + ++++ +
Sbjct: 151 LLSEARAMKDYLIEKGIDPNLITMEDKSTSTYENFMFSKELISNKCSKTPIKVTVITNNF 210

Query: 184 HLKRSQLYFQHFGINT---KASCSDY 206
           H  R+ +  +  G        SC  Y
Sbjct: 211 HQFRANMIAKAQGFEVHGYPGSCHPY 236


>gi|261211840|ref|ZP_05926127.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. RC341]
 gi|260839190|gb|EEX65822.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio sp. RC341]
          Length = 273

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 102/227 (44%), Gaps = 39/227 (17%)

Query: 27  SCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            C ++LFS  G     +  + T LL  L+ +Y   L       +G +  +++LGNG  + 
Sbjct: 38  GCLVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFL-----PVEGTLDYVMVLGNGHVVD 92

Query: 80  PTIPAIRIEPSFQSYSRIFETMR---LYKSCKQHSMHCTIIISG---GDPQKHGLAESIV 133
             IP    E +  +  R+ E +R   +Y   K       +I+SG   G    H    + V
Sbjct: 93  DDIPPTS-ELTRAALMRLTEGIRISRMYPGSK-------LILSGYAGGSEVSHARMMARV 144

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
                L  GV + DI L   + DT++ A+ +++ +   Q K ++LV+SA H+KR+   F+
Sbjct: 145 A----LALGVPKSDIILLETAKDTWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFE 197

Query: 194 HFGINTKASCSDYLN------AYYSIIPLSANFYLTELALKEYIGIL 234
             G+    + ++YL        +   IP S     TE    E +G+L
Sbjct: 198 SAGLTPIPAPTNYLGHLNIVQPWDKYIPKSRYLEQTEQYWYETLGLL 244


>gi|226309357|ref|YP_002769317.1| hypothetical protein RER_58700 [Rhodococcus erythropolis PR4]
 gi|226188474|dbj|BAH36578.1| conserved hypothetical membrane protein [Rhodococcus erythropolis
           PR4]
          Length = 336

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/224 (18%), Positives = 101/224 (45%), Gaps = 27/224 (12%)

Query: 15  LLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGN 74
           LL Q       +  F L+ S++G+ +  + LL    +  Q+      ++   + IV+ G 
Sbjct: 113 LLTQRYWLAVVLGSFSLVASYLGF-LFTSFLLYSYVYGRQK------YQPGMDAIVVHGA 165

Query: 75  GTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVY 134
           G +     P +         SR+ +   ++++  +      +++SGG      ++E+   
Sbjct: 166 GLSGADVTPLLA--------SRLDKAADIFRAEVREGRSPLLVVSGGKGSDEVVSEAEAM 217

Query: 135 NNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQ 193
              L++ G+ R+++ LE +S  T +N +++  +++    K  ++LV+S +H+ R+  + +
Sbjct: 218 CVYLVDHGIPRENVMLEDRSTTTLENLEYTRDLLRADTTKPRMVLVTSNFHILRTATFAR 277

Query: 194 HFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
              ++ +   S            +A +YL    L+E+  + + +
Sbjct: 278 SLDLDAEVIGSH-----------TARYYLPSAILREFAAVTVEH 310


>gi|217969248|ref|YP_002354482.1| hypothetical protein Tmz1t_0817 [Thauera sp. MZ1T]
 gi|217506575|gb|ACK53586.1| protein of unknown function DUF218 [Thauera sp. MZ1T]
          Length = 259

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 80/190 (42%), Gaps = 24/190 (12%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSF--QSYSRI-FETMRLYKSCKQHSMHCTIIISG 120
           ++   IV+LG G             P F  ++ +R+  E +R Y +         +++SG
Sbjct: 83  REAQAIVVLGAGKRTH--------APEFGGETVNRLALERLR-YAAALARETRLPVLVSG 133

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           G P   G          LL          +E+ S DT +NA+FS+  ++    K I+LV+
Sbjct: 134 GAPA--GDTPEAYLMEALLRDEYGVPPRWVESASRDTRENARFSAVHLQAAGVKRILLVT 191

Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYS--------IIPLSANFYLTELALKEYIG 232
            A H++R++  F+  G++   + + +L    S          P     Y    AL E +G
Sbjct: 192 HAMHMERARPEFEAAGLDVIPAPTAWLGGGDSPGDAQPLPFAPSQNTAYAAWFALHELLG 251

Query: 233 ILIAYYRGNR 242
            L   YR +R
Sbjct: 252 RLA--YRWSR 259


>gi|302876695|ref|YP_003845328.1| hypothetical protein Clocel_3898 [Clostridium cellulovorans 743B]
 gi|302579552|gb|ADL53564.1| protein of unknown function DUF218 [Clostridium cellulovorans 743B]
          Length = 257

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 22/146 (15%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH--CTIIISGGDPQKH 126
           +V+LG G      +   RI  S Q        +RL  + + HS+H    II+SGG     
Sbjct: 105 VVVLGAG------LIGDRISTSLQ--------LRLDAALEFHSIHPEIPIIVSGGQGPDE 150

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN---IILVSSAY 183
            L+E+    + L+E G++ + I +E +S  T++N  FS  +I N   K    + ++++ +
Sbjct: 151 LLSEARAMKDYLIEKGIDPNLITMEDKSTSTYENFMFSKELISNKCSKTPIKVTVITNNF 210

Query: 184 HLKRSQLYFQHFGINT---KASCSDY 206
           H  R+ +  +  G        SC  Y
Sbjct: 211 HQFRANMIAKAQGFEVHGYPGSCHPY 236


>gi|70732742|ref|YP_262505.1| hypothetical protein PFL_5437 [Pseudomonas fluorescens Pf-5]
 gi|68347041|gb|AAY94647.1| conserved hypothetical protein [Pseudomonas fluorescens Pf-5]
          Length = 253

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 72/164 (43%), Gaps = 26/164 (15%)

Query: 56  PLLSPQWK---KDGNIIVLLGNGTTIIPTIPAIRIEPSF---QSYSRIFETMRLYKSCKQ 109
           PL   QW    +  ++IV+LG+G          R +P++   Q      E  R Y S   
Sbjct: 67  PLPQSQWASLAEQADVIVVLGSGRE--------RGDPAWGSDQPTGVGLERER-YASRLA 117

Query: 110 HSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKL-----ETQSLDTFQNAQFS 164
            +    ++ SGG        E+ +    LL      DD  +     E +S  T++NAQFS
Sbjct: 118 KASGLPVLTSGGLHYGTPPTEAALMAQSLL------DDFGVTVRWQEGRSRTTWENAQFS 171

Query: 165 SSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
           + ++  +  K +++V+ A+H+ RS   F+H G     +   +L 
Sbjct: 172 AEVLLPLGIKRVVVVTQAWHMPRSVWSFEHAGFEVVPAPVGFLG 215


>gi|291003905|ref|ZP_06561878.1| integral membrane protein [Saccharopolyspora erythraea NRRL 2338]
          Length = 189

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 117 IISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI 176
           +I  G P   G +E +V  + L+  GV  +D+ L+   +DT  +A+ ++   +    + I
Sbjct: 75  LIVSGSPHSRGYSEPVVMRDYLVARGVPPEDVLLDESGVDTCSSARAAA---RTFGLRAI 131

Query: 177 ILVSSAYHLKRSQLYFQHFGINT 199
            +V++ +HL+RS   F+  GI+T
Sbjct: 132 TVVTTNFHLRRSVALFRRAGIDT 154


>gi|196232487|ref|ZP_03131340.1| protein of unknown function DUF218 [Chthoniobacter flavus Ellin428]
 gi|196223559|gb|EDY18076.1| protein of unknown function DUF218 [Chthoniobacter flavus Ellin428]
          Length = 193

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 57/111 (51%), Gaps = 5/111 (4%)

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           PS +  +R+  T+  Y++         II+SGG   K G  E+IV  + L+  G+  + I
Sbjct: 56  PSTRLRARLDRTLECYRA----GYFPEIIVSGG-IGKEGYDEAIVMRDYLVAHGLPGEHI 110

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
            L+ + + TF +A+ +  + +     ++ ++S  +HL R++L    FG  T
Sbjct: 111 LLDNKGVTTFASARNTRDIAQQRNFHSVFVISQYFHLPRARLALHRFGFTT 161


>gi|327331177|gb|EGE72917.1| hypothetical protein HMPREF9344_01832 [Propionibacterium acnes
           HL097PA1]
          Length = 349

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 64/155 (41%), Gaps = 26/155 (16%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SR+   +  +++ +    H  II SGG       AE       L+E G+ R+ + +E Q+
Sbjct: 180 SRLDRGIGQWRTDRDAGFHSVIIPSGGKGDDEPRAEGEAMAEYLVEHGIPRECVVVENQA 239

Query: 155 LDTFQNAQFSSSMI---------------KNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
            +T +N   S  ++               +  Q   +++ +S+YH  R+    +  G+  
Sbjct: 240 ANTDENISLSRQVMPTQVRSVPSRRAEAARERQNPQVVVATSSYHAVRAAELCRRQGLRV 299

Query: 200 KASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           +   +            +A ++L    L+EYI +L
Sbjct: 300 RVLGAP-----------TATYFLPSAMLREYIALL 323


>gi|317407644|gb|EFV87583.1| hypothetical protein HMPREF0005_04608 [Achromobacter xylosoxidans
           C54]
          Length = 254

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 90/232 (38%), Gaps = 22/232 (9%)

Query: 20  IRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTII 79
           +RK         L   + W +  T L        + P L P      + IV+LG  T   
Sbjct: 32  LRKTGGALILAGLLWALAWSLPVTSLWLGGALENRYPHLPPAESPTADAIVVLGGNT--- 88

Query: 80  PTIPAIRIEPSFQSYSRIFETMRLYKSCKQH--SMHCTIIISGGDPQKHGLAESIVYNNK 137
               A      F  Y +    +R+  + + +       +++SGG  +   ++E+    + 
Sbjct: 89  ----ANGRANWFLPYDKDTAVVRVDTAAQLYLAGRAPKVVLSGGALEGD-VSEARGMAHA 143

Query: 138 LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
           + + GV    + LE  S  T++NA  +   +K      ++LV+SA H+ R+   F   G+
Sbjct: 144 IRQQGVPESALILENASRTTYENAALTEDQLKTRGIGKVLLVTSALHMPRAMAAFSKQGV 203

Query: 198 ---------NTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
                       A     LN +   +P    F  +   +KEY G+ + + RG
Sbjct: 204 IAIAAPAPPQIVAPADGSLNPW---LPDQRTFDASRSIIKEYAGLFVYWLRG 252


>gi|226365146|ref|YP_002782929.1| hypothetical protein ROP_57370 [Rhodococcus opacus B4]
 gi|226243636|dbj|BAH53984.1| hypothetical protein [Rhodococcus opacus B4]
          Length = 280

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 102 RLYKSCKQH--SMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQ 159
           RL  +  Q   S    II++GG+PQ +G+ E+      L   GV  D I  E ++  T  
Sbjct: 140 RLQAAMVQSWVSPMSPIIVTGGNPQ-NGITEAAAMEGWLRSHGVPADRIHPEHRAGSTVG 198

Query: 160 NAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA 209
           NA  S  + +++     ILV+SA H++R+ + F   G+    + S   +A
Sbjct: 199 NALNSVPLARSLGAGGAILVTSANHIRRATVDFNVAGLPVVGAMSAVTSA 248


>gi|50842156|ref|YP_055383.1| hypothetical protein PPA0669 [Propionibacterium acnes KPA171202]
 gi|289426845|ref|ZP_06428571.1| conserved hypothetical protein [Propionibacterium acnes J165]
 gi|295130244|ref|YP_003580907.1| hypothetical protein HMPREF0675_3738 [Propionibacterium acnes
           SK137]
 gi|50839758|gb|AAT82425.1| hypothetical protein PPA0669 [Propionibacterium acnes KPA171202]
 gi|289159934|gb|EFD08112.1| conserved hypothetical protein [Propionibacterium acnes J165]
 gi|291375530|gb|ADD99384.1| conserved hypothetical protein [Propionibacterium acnes SK137]
 gi|313763888|gb|EFS35252.1| conserved hypothetical protein [Propionibacterium acnes HL013PA1]
 gi|313771407|gb|EFS37373.1| conserved hypothetical protein [Propionibacterium acnes HL074PA1]
 gi|313808239|gb|EFS46713.1| conserved hypothetical protein [Propionibacterium acnes HL087PA2]
 gi|313811298|gb|EFS49012.1| conserved hypothetical protein [Propionibacterium acnes HL083PA1]
 gi|313814824|gb|EFS52538.1| conserved hypothetical protein [Propionibacterium acnes HL059PA1]
 gi|313819005|gb|EFS56719.1| conserved hypothetical protein [Propionibacterium acnes HL046PA2]
 gi|313820836|gb|EFS58550.1| conserved hypothetical protein [Propionibacterium acnes HL036PA1]
 gi|313822403|gb|EFS60117.1| conserved hypothetical protein [Propionibacterium acnes HL036PA2]
 gi|313825802|gb|EFS63516.1| conserved hypothetical protein [Propionibacterium acnes HL063PA1]
 gi|313828147|gb|EFS65861.1| conserved hypothetical protein [Propionibacterium acnes HL063PA2]
 gi|313830950|gb|EFS68664.1| conserved hypothetical protein [Propionibacterium acnes HL007PA1]
 gi|313833376|gb|EFS71090.1| conserved hypothetical protein [Propionibacterium acnes HL056PA1]
 gi|314915093|gb|EFS78924.1| conserved hypothetical protein [Propionibacterium acnes HL005PA4]
 gi|314918753|gb|EFS82584.1| conserved hypothetical protein [Propionibacterium acnes HL050PA1]
 gi|314920554|gb|EFS84385.1| conserved hypothetical protein [Propionibacterium acnes HL050PA3]
 gi|314925593|gb|EFS89424.1| conserved hypothetical protein [Propionibacterium acnes HL036PA3]
 gi|314932228|gb|EFS96059.1| conserved hypothetical protein [Propionibacterium acnes HL067PA1]
 gi|314954656|gb|EFS99062.1| conserved hypothetical protein [Propionibacterium acnes HL027PA1]
 gi|314958523|gb|EFT02625.1| conserved hypothetical protein [Propionibacterium acnes HL002PA1]
 gi|314959880|gb|EFT03982.1| conserved hypothetical protein [Propionibacterium acnes HL002PA2]
 gi|314968297|gb|EFT12396.1| conserved hypothetical protein [Propionibacterium acnes HL037PA1]
 gi|314973834|gb|EFT17930.1| conserved hypothetical protein [Propionibacterium acnes HL053PA1]
 gi|314976488|gb|EFT20583.1| conserved hypothetical protein [Propionibacterium acnes HL045PA1]
 gi|314979234|gb|EFT23328.1| conserved hypothetical protein [Propionibacterium acnes HL072PA2]
 gi|314983400|gb|EFT27492.1| conserved hypothetical protein [Propionibacterium acnes HL005PA1]
 gi|314986818|gb|EFT30910.1| conserved hypothetical protein [Propionibacterium acnes HL005PA2]
 gi|314989379|gb|EFT33470.1| conserved hypothetical protein [Propionibacterium acnes HL005PA3]
 gi|315080102|gb|EFT52078.1| conserved hypothetical protein [Propionibacterium acnes HL078PA1]
 gi|315083984|gb|EFT55960.1| conserved hypothetical protein [Propionibacterium acnes HL027PA2]
 gi|315085185|gb|EFT57161.1| conserved hypothetical protein [Propionibacterium acnes HL002PA3]
 gi|315089022|gb|EFT60998.1| conserved hypothetical protein [Propionibacterium acnes HL072PA1]
 gi|315096455|gb|EFT68431.1| conserved hypothetical protein [Propionibacterium acnes HL038PA1]
 gi|315099022|gb|EFT70998.1| conserved hypothetical protein [Propionibacterium acnes HL059PA2]
 gi|315100897|gb|EFT72873.1| conserved hypothetical protein [Propionibacterium acnes HL046PA1]
 gi|315107172|gb|EFT79148.1| conserved hypothetical protein [Propionibacterium acnes HL030PA1]
 gi|315108116|gb|EFT80092.1| conserved hypothetical protein [Propionibacterium acnes HL030PA2]
 gi|327326860|gb|EGE68643.1| hypothetical protein HMPREF9338_01734 [Propionibacterium acnes
           HL096PA2]
 gi|327442936|gb|EGE89590.1| hypothetical protein HMPREF9570_02441 [Propionibacterium acnes
           HL043PA1]
 gi|327445060|gb|EGE91714.1| hypothetical protein HMPREF9571_02045 [Propionibacterium acnes
           HL043PA2]
 gi|327447433|gb|EGE94087.1| hypothetical protein HMPREF9568_00729 [Propionibacterium acnes
           HL013PA2]
 gi|327450039|gb|EGE96693.1| hypothetical protein HMPREF9581_02486 [Propionibacterium acnes
           HL087PA3]
 gi|327455410|gb|EGF02065.1| hypothetical protein HMPREF9586_01447 [Propionibacterium acnes
           HL083PA2]
 gi|328752707|gb|EGF66323.1| hypothetical protein HMPREF9579_02249 [Propionibacterium acnes
           HL087PA1]
 gi|328752927|gb|EGF66543.1| hypothetical protein HMPREF9563_02180 [Propionibacterium acnes
           HL020PA1]
 gi|328759376|gb|EGF72992.1| hypothetical protein HMPREF9588_00221 [Propionibacterium acnes
           HL025PA2]
 gi|328760301|gb|EGF73872.1| hypothetical protein HMPREF9343_01965 [Propionibacterium acnes
           HL099PA1]
 gi|332675082|gb|AEE71898.1| hypothetical protein PAZ_c07120 [Propionibacterium acnes 266]
          Length = 349

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 64/155 (41%), Gaps = 26/155 (16%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SR+   +  +++ +    H  II SGG       AE       L+E G+ R+ + +E Q+
Sbjct: 180 SRLDRGIGQWRTDRDAGFHSVIIPSGGKGDDEPRAEGEAMAEYLVEHGIPRECVVVENQA 239

Query: 155 LDTFQNAQFSSSMI---------------KNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
            +T +N   S  ++               +  Q   +++ +S+YH  R+    +  G+  
Sbjct: 240 ANTDENISLSRQVMPTQVRSVPSRRAEAARQRQNPQVVVATSSYHAVRAAELCRRQGLRV 299

Query: 200 KASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           +   +            +A ++L    L+EYI +L
Sbjct: 300 RVLGAP-----------TATYFLPSAMLREYIALL 323


>gi|327330943|gb|EGE72687.1| hypothetical protein HMPREF9337_01510 [Propionibacterium acnes
           HL096PA3]
          Length = 349

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 64/155 (41%), Gaps = 26/155 (16%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SR+   +  +++ +    H  II SGG       AE       L+E G+ R+ + +E Q+
Sbjct: 180 SRLDRGIGQWRTDRDAGFHSVIIPSGGKGDDEPRAEGEAMAEYLVEHGIPRECVVVENQA 239

Query: 155 LDTFQNAQFSSSMI---------------KNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
            +T +N   S  ++               +  Q   +++ +S+YH  R+    +  G+  
Sbjct: 240 ANTDENISLSRQVMPTQVRSVPSRRAEAARQRQNPQVVVATSSYHAVRAAELCRRQGLRV 299

Query: 200 KASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           +   +            +A ++L    L+EYI +L
Sbjct: 300 RVLGAP-----------TATYFLPSAMLREYIALL 323


>gi|163857424|ref|YP_001631722.1| hypothetical protein Bpet3112 [Bordetella petrii DSM 12804]
 gi|163261152|emb|CAP43454.1| conserved hypothetical protein [Bordetella petrii]
          Length = 252

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 72/158 (45%), Gaps = 9/158 (5%)

Query: 91  FQSYSRIFETMRLYKSCKQHSMH--CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           F  Y +    +R+  + K +  H    +++SGG   +  ++E+      + + GV  D +
Sbjct: 94  FLPYDKETAVVRVDTAIKLYQAHRAPKVVLSGGA-LEGDVSEARGMAFLMKQQGVPEDAL 152

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSD--- 205
            LE  S  T++NA  +   +K      I+LV+SA H+ R+   F   G+    + +    
Sbjct: 153 LLENSSRTTYENAMLTEEELKEHGFGKILLVTSALHMPRAMAAFSKQGVAAIPASTPPQI 212

Query: 206 YLNAYYSIIPLSANFYLTELA---LKEYIGILIAYYRG 240
            L    S+ P   +    + +   +KEY G+L+ + RG
Sbjct: 213 VLPPDGSVSPWLPHMRTLDASRSIIKEYAGLLVYWLRG 250


>gi|289426184|ref|ZP_06427930.1| conserved hypothetical protein [Propionibacterium acnes SK187]
 gi|289153349|gb|EFD02064.1| conserved hypothetical protein [Propionibacterium acnes SK187]
 gi|313791546|gb|EFS39664.1| conserved hypothetical protein [Propionibacterium acnes HL110PA1]
 gi|313802367|gb|EFS43593.1| conserved hypothetical protein [Propionibacterium acnes HL110PA2]
 gi|313812480|gb|EFS50194.1| conserved hypothetical protein [Propionibacterium acnes HL025PA1]
 gi|313838950|gb|EFS76664.1| conserved hypothetical protein [Propionibacterium acnes HL086PA1]
 gi|314962443|gb|EFT06544.1| conserved hypothetical protein [Propionibacterium acnes HL082PA1]
 gi|315077359|gb|EFT49419.1| conserved hypothetical protein [Propionibacterium acnes HL053PA2]
 gi|327455232|gb|EGF01887.1| hypothetical protein HMPREF9584_01188 [Propionibacterium acnes
           HL092PA1]
          Length = 349

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 64/155 (41%), Gaps = 26/155 (16%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
           SR+   +  +++ +    H  II SGG       AE       L+E G+ R+ + +E Q+
Sbjct: 180 SRLDRGIGQWRTDRDAGFHSVIIPSGGKGDDEPRAEGEAMAEYLVEHGIPRECVVVENQA 239

Query: 155 LDTFQNAQFSSSMI---------------KNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
            +T +N   S  ++               +  Q   +++ +S+YH  R+    +  G+  
Sbjct: 240 ANTDENISLSRQVMPTQVRSVPSRRAEAARQRQNPQVVVATSSYHAVRAAELCRRQGLRV 299

Query: 200 KASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
           +   +            +A ++L    L+EYI +L
Sbjct: 300 RVLGAP-----------TATYFLPSAMLREYIALL 323


>gi|261252465|ref|ZP_05945038.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio orientalis CIP 102891]
 gi|260935856|gb|EEX91845.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio orientalis CIP 102891]
          Length = 267

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 95/195 (48%), Gaps = 37/195 (18%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           CF++LFSFIG     +  + + LL  L+  Y     S  +  D +I  +++LG+G  +  
Sbjct: 39  CFVVLFSFIGIFLIAFQPVSSRLLMPLERQY-----SAFFPVDESIDYVMVLGSGHVVDD 93

Query: 81  TIPAIRIEPSFQSYSRIFE---TMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNK 137
            IP    E S     R+ E    MR+Y   K       +I+SG      G +E  V N +
Sbjct: 94  KIPPTS-ELSRTGLMRLAEGIRVMRIYPGSK-------LILSG----YAGGSE--VSNAR 139

Query: 138 LLES-----GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYF 192
           ++       GV + DI L   + DT++ A+ +++ +     K +++V+SA H+KR+   F
Sbjct: 140 MMAKVALSLGVSKSDIILLETAKDTWEEARQAAAFVTT---KKLVVVTSASHMKRALNEF 196

Query: 193 QHFGINTKASCSDYL 207
              G++   + ++YL
Sbjct: 197 HSAGMDPYPAPTNYL 211


>gi|260772652|ref|ZP_05881568.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio metschnikovii CIP 69.14]
 gi|260611791|gb|EEX36994.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio metschnikovii CIP 69.14]
          Length = 268

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 80/179 (44%), Gaps = 25/179 (13%)

Query: 67  NIIVLLGNGTTIIPTIPAIR--IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG---G 121
           + +++LGNG  +  +IP        +    S     MR+Y   K       +I+SG   G
Sbjct: 80  DYVMVLGNGHVVDDSIPPTSELTRAALMRLSEGIRVMRMYPGAK-------LILSGYAGG 132

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
               H    + V     L  GV + DI L   + DT++ A+ +++ +   Q + ++LV+S
Sbjct: 133 SEMSHARMLAKVA----LALGVAKSDIILLETAQDTWEEARQAAAFV---QQRTLVLVTS 185

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIGIL 234
           A H+ R+   FQ  G+    + ++YL       A+   IP +     TE    E +G++
Sbjct: 186 ASHMPRAMNEFQSAGLTPIPAPTNYLAQTNISQAWDKYIPRALYLEQTERYWYETMGLI 244


>gi|229017592|ref|ZP_04174486.1| hypothetical protein bcere0030_21400 [Bacillus cereus AH1273]
 gi|229023809|ref|ZP_04180294.1| hypothetical protein bcere0029_21380 [Bacillus cereus AH1272]
 gi|228737494|gb|EEL88004.1| hypothetical protein bcere0029_21380 [Bacillus cereus AH1272]
 gi|228743661|gb|EEL93767.1| hypothetical protein bcere0030_21400 [Bacillus cereus AH1273]
          Length = 166

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E +S +T++N +FS  +      
Sbjct: 53  VKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILMEDRSTNTYENLKFSMDLF---DV 109

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
           K+ ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 110 KHAVVVSNTYHLYRTKIIARRLGMKMEALAAE 141


>gi|158321219|ref|YP_001513726.1| hypothetical protein Clos_2195 [Alkaliphilus oremlandii OhILAs]
 gi|158141418|gb|ABW19730.1| protein of unknown function DUF218 [Alkaliphilus oremlandii OhILAs]
          Length = 191

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 70/139 (50%), Gaps = 10/139 (7%)

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
           +PS     R+ +T+ LY          TII+SG       + E++     L+ +GV    
Sbjct: 51  KPSPMLQYRLEKTLTLY----NEGFADTIIVSGARGDDELITEALAMKIYLMNNGVPESA 106

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN-TKASCSDY 206
           I  E  S  T++N  +S++++K    K+ I+VS+++H+ R+ +  +   ++ + A+  +Y
Sbjct: 107 ILEEDHSYSTYENLSYSNAIMKEKDLKSAIIVSNSFHMSRALMIAKRLDMSASGAAAKNY 166

Query: 207 LNAYYSIIPLSANFYLTEL 225
            N +     L+  +Y+ E+
Sbjct: 167 PNIF-----LTTKYYIREV 180


>gi|152993138|ref|YP_001358859.1| hypothetical protein SUN_1551 [Sulfurovum sp. NBC37-1]
 gi|151424999|dbj|BAF72502.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 248

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 77/181 (42%), Gaps = 14/181 (7%)

Query: 65  DGNIIVLLGNGTTIIPTIP-AIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           +   I +LG        IP +  ++PS    +R+ E + LYK  K   M       G D 
Sbjct: 77  NAGYIHVLGTAHVAREGIPLSSELDPS--GLARVTEGVLLYKQHK--GMKLVFSGYGKDE 132

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
                  S      L   GV  +DI +     DT + A   S M    QGK+++LV+SA 
Sbjct: 133 PLSNAKCSAALAQAL---GVREEDIIVFETPKDTLEEAGAMSEM---AQGKHVVLVTSAS 186

Query: 184 HLKRSQLYFQHFGINTKASCSDYLNAYYSI---IPLSANFYLTELALKEYIGILIAYYRG 240
           H+ R+   F+  GI    + +D+          +P +     +E A  EY+G+L  + +G
Sbjct: 187 HMLRASRLFKKAGIKVIEAPTDFKVKKPDDLLQLPGAEGLRRSETAFHEYLGLLWFWLKG 246

Query: 241 N 241
           +
Sbjct: 247 D 247


>gi|229085219|ref|ZP_04217462.1| hypothetical protein bcere0022_18350 [Bacillus cereus Rock3-44]
 gi|228698086|gb|EEL50828.1| hypothetical protein bcere0022_18350 [Bacillus cereus Rock3-44]
          Length = 185

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 49/88 (55%), Gaps = 3/88 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L++ G+E   I +E +S  T++N +FS  +      
Sbjct: 72  AKVIVSGGQGEDEDIPEAHSMRNYLIQHGIEEGRIFIEDRSTSTYENLKFSMDLY---HV 128

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKA 201
           K+ ++VS+ YHL R+++  +  G+  ++
Sbjct: 129 KHAVVVSNTYHLYRTKIIAKRLGMQMES 156


>gi|260854211|ref|YP_003228102.1| hypothetical protein ECO26_1046 [Escherichia coli O26:H11 str.
           11368]
 gi|257752860|dbj|BAI24362.1| conserved predicted inner membrane protein [Escherichia coli
           O26:H11 str. 11368]
 gi|323157193|gb|EFZ43316.1| hypothetical protein ECEPECA14_0984 [Escherichia coli EPECa14]
          Length = 259

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 100/224 (44%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG+G T  P     + 
Sbjct: 41  IFISIGWLALLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGDGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++    E +G +  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKG 251


>gi|261256154|ref|ZP_05948687.1| conserved inner membrane protein [Escherichia coli O157:H7 str.
           FRIK966]
          Length = 259

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 100/225 (44%), Gaps = 28/225 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG G T  P     + 
Sbjct: 41  IFISIGWLALLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
            ++       LN +   IP       ++    E +G +  + +G+
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGCIWQWLKGS 252


>gi|115372876|ref|ZP_01460181.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310818526|ref|YP_003950884.1| hypothetical protein STAUR_1253 [Stigmatella aurantiaca DW4/3-1]
 gi|115370143|gb|EAU69073.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309391598|gb|ADO69057.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 210

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 16/145 (11%)

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           Q ++     VL+  G  ++P        PS    +R+ + + LY       +   ++ SG
Sbjct: 40  QQERAAPADVLVVLGARVLPGG-----VPSGALLARVEKAVALY----HQGLASRLLFSG 90

Query: 121 G---DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
           G   +P     +E+ V     +  GV  +   LE QS  T QNA+FS+ +++ +  + ++
Sbjct: 91  GVGVNPP----SEAQVMRALAVRLGVPAEACFLEEQSHSTEQNARFSAQVLRALGAERVV 146

Query: 178 LVSSAYHLKRSQLYFQHFGINTKAS 202
           +VS  YHL R++ YF+  G     S
Sbjct: 147 VVSDPYHLLRARQYFRLEGWEVATS 171


>gi|312892082|ref|ZP_07751582.1| protein of unknown function DUF218 [Mucilaginibacter paludis DSM
           18603]
 gi|311295454|gb|EFQ72623.1| protein of unknown function DUF218 [Mucilaginibacter paludis DSM
           18603]
          Length = 260

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 75/158 (47%), Gaps = 19/158 (12%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ---KHGLAESIVYNNKLLESGVERDDIK 149
           S  R  +T++L    K       I++SGG+ Q      L E+    ++     +    I 
Sbjct: 97  SADRFIKTLQL----KVTGRVPLILMSGGNGQLIKTSNLKEADYVFSQFKAFNIPDSCIM 152

Query: 150 LETQSLDTFQNAQFSSSMI--KNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYL 207
           +E QS +T +NA F+  ++  K + G   +LV+SA+H++RS   F+  GIN      D++
Sbjct: 153 IENQSRNTLENAMFTKRILIDKKVPGP-YLLVTSAFHMRRSAYIFKKIGINVTPYPCDFI 211

Query: 208 NAYYSIIPLSANFYLTELAL-------KEYIGILIAYY 238
            A  S + LS       LAL       KE +G  +AYY
Sbjct: 212 -AGKSAVSLSDFIIPDPLALAQWNIYIKEVVG-FVAYY 247


>gi|254992747|ref|ZP_05274937.1| hypothetical protein LmonocytoFSL_06569 [Listeria monocytogenes FSL
           J2-064]
          Length = 189

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 66/135 (48%), Gaps = 13/135 (9%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDP 123
           ++ + +++LG   T  P +P++ ++    +       +  Y   K       +I+SGG  
Sbjct: 36  ENADTVLILGAKVTGTPAVPSLVLQERLDA---AVAYLNEYPKAK-------VIVSGGQG 85

Query: 124 QKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
                 E+ V    L+  G+ R  I+ ET+S  T +N ++S++  K   GK +I V+S Y
Sbjct: 86  ADESATEASVMEEYLVNEGIARKRIETETKSKRTEENIKYSNA--KFNLGKTVI-VTSDY 142

Query: 184 HLKRSQLYFQHFGIN 198
           H+ R+ +  +  GI+
Sbjct: 143 HMYRALMLAKRQGID 157


>gi|327393342|dbj|BAK10764.1| uncharacterized conserved protein YcbC [Pantoea ananatis AJ13355]
          Length = 342

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 70/146 (47%), Gaps = 18/146 (12%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           + IV+LG G T  P        PS      S  R+ E +R +    Q +M  T   +G +
Sbjct: 164 DYIVVLGGGYTYNPAW-----APSSNLLNNSLPRVTEGVRQWLRNPQATMVFTGAAAGHN 218

Query: 123 PQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
           P+ +    +     ++ ES GV    I +  Q  DT Q A+  S++I +    + +LV+S
Sbjct: 219 PKSNAWVAA-----QVAESLGVPDAHIHILDQPKDTEQEARAVSAVIGH---HSFLLVTS 270

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYL 207
           A H+ R+  +FQ  G+N  A+ ++ L
Sbjct: 271 ANHMPRAMRFFQQAGLNPIAAPANQL 296


>gi|228997359|ref|ZP_04156981.1| hypothetical protein bmyco0003_19410 [Bacillus mycoides Rock3-17]
 gi|229004990|ref|ZP_04162717.1| hypothetical protein bmyco0002_19350 [Bacillus mycoides Rock1-4]
 gi|228756338|gb|EEM05656.1| hypothetical protein bmyco0002_19350 [Bacillus mycoides Rock1-4]
 gi|228762451|gb|EEM11376.1| hypothetical protein bmyco0003_19410 [Bacillus mycoides Rock3-17]
          Length = 168

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 49/86 (56%), Gaps = 3/86 (3%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           +I+SGG  +   + E+    N L++ G+E + I +E +S  T++N +FS  +   M    
Sbjct: 57  VIVSGGQGEDEDIPEAHSMRNYLIKHGIEENRIFIEDRSTSTYENLKFSMDLYHVMHA-- 114

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKA 201
            ++VS+ YHL R+++  +  G+  ++
Sbjct: 115 -VVVSNTYHLYRTKIIAKRLGMQMES 139


>gi|228908043|ref|ZP_04071891.1| hypothetical protein bthur0013_22050 [Bacillus thuringiensis IBL
           200]
 gi|228851461|gb|EEM96267.1| hypothetical protein bthur0013_22050 [Bacillus thuringiensis IBL
           200]
          Length = 162

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 53/92 (57%), Gaps = 3/92 (3%)

Query: 114 CTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
             +I+SGG  +   + E+    N L+  G++   I +E QS +T++N +FS  +  N++ 
Sbjct: 49  AKVIVSGGQGEDEDIPEAHSMRNYLMVHGIDESRILIEDQSTNTYENLKFSMDLY-NVE- 106

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINTKASCSD 205
            + ++VS+ YHL R+++  +  G+  +A  ++
Sbjct: 107 -HAVVVSNTYHLYRTKIIAKRLGMKMEALAAE 137


>gi|325965245|ref|YP_004243151.1| hypothetical protein Asphe3_39290 [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323471332|gb|ADX75017.1| uncharacterized conserved protein [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 331

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 82/182 (45%), Gaps = 27/182 (14%)

Query: 58  LSPQWKKDGNIIVLLGNGTT--IIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCT 115
           L P+ + +   +V+LG+G     +P + A R++            + LY+     ++   
Sbjct: 149 LPPRRRPE--YVVVLGSGLAGNAVPPLLAARLD----------AAVSLYRGKHGGTIRA- 195

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           +I SGG        E       L E G+    I +E ++  T +N  FS +++ +   + 
Sbjct: 196 LIPSGGRGADELTTEGAAMARYLQEQGIPAASILIEDKATTTLENLVFSRNLM-DRPDRP 254

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           + +V+S+YH+ R+ ++ +  G+    + +            +A +++    L+E+I IL+
Sbjct: 255 VTVVTSSYHVFRAAMFTRRAGMRAHVTGAR-----------TAGYFMPSAFLREFIAILV 303

Query: 236 AY 237
            Y
Sbjct: 304 KY 305


>gi|225568301|ref|ZP_03777326.1| hypothetical protein CLOHYLEM_04375 [Clostridium hylemonae DSM
           15053]
 gi|225163020|gb|EEG75639.1| hypothetical protein CLOHYLEM_04375 [Clostridium hylemonae DSM
           15053]
          Length = 242

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 5/102 (4%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           +I+SGG      +AE+    + L + G++R  I LE +S  T +N +FS++ + +M  K 
Sbjct: 129 VIVSGGQGPGEDIAEAEAMADFLADCGIKRSRILLEDRSKSTEENLRFSAAYLPDMTVK- 187

Query: 176 IILVSSAYHLKRSQLYFQHFG----INTKASCSDYLNAYYSI 213
           + +VS+ +H+ R+  Y    G        + CS  L A Y +
Sbjct: 188 VGIVSNNFHMYRACCYAGRTGYKNVCRIPSDCSPLLFANYMV 229


>gi|146311096|ref|YP_001176170.1| hypothetical protein Ent638_1439 [Enterobacter sp. 638]
 gi|145317972|gb|ABP60119.1| protein of unknown function DUF218 [Enterobacter sp. 638]
          Length = 259

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 92/211 (43%), Gaps = 34/211 (16%)

Query: 45  LLKHLQFSYQRPLLSPQW--KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIF 98
           LL+ ++  Y      P W  KK  + IV+LG G T  P        PS      S  R+ 
Sbjct: 62  LLRPIEDKY------PTWQGKKKVDYIVVLGGGYTWDPNW-----APSSNLINNSLPRLN 110

Query: 99  ETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDT 157
           E +RL+ +     M  T     G P K     +     ++ ES GV R  I     +LD+
Sbjct: 111 EGIRLWLANPGSKMIFT-----GAPAKTNPVSTAEAGARVAESLGVPRSAII----TLDS 161

Query: 158 FQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKASCSDY------LNAY 210
            ++ +  ++ +K   G    +LV+SA HL R+ ++F+H G++   + ++       LN +
Sbjct: 162 PKDTEEEAAAVKQAIGNAPFLLVTSASHLPRAMIFFEHAGLHPLPAPANQLAVDAPLNPW 221

Query: 211 YSIIPLSANFYLTELALKEYIGILIAYYRGN 241
              IP       ++    E +G L  + +G+
Sbjct: 222 ERAIPSPVWLMHSDRVGYETLGRLWQWLKGS 252


>gi|33865854|ref|NP_897413.1| hypothetical protein SYNW1320 [Synechococcus sp. WH 8102]
 gi|33633024|emb|CAE07835.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 250

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 96/225 (42%), Gaps = 20/225 (8%)

Query: 21  RKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIP 80
           R+ + +   M L      G++  +L + ++  YQR   S +     + IV+L  G    P
Sbjct: 30  RRHWPVVAAMSLLWIFSTGVVSQLLWRWVEHPYQR--RSVERAPLADAIVVLSGGRHPAP 87

Query: 81  TIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLA-ESIVYNNKLL 139
               I     +    R    + L++S +   +   +   G +P   GL  E  +Y  + +
Sbjct: 88  GPAQIS---EWHDPDRFLAGVALFQSGRASRL---LFTRGQNPFHPGLPPEGELYRAEAV 141

Query: 140 ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
           + GV    I L  +  +T Q A     ++   Q + ++LV+SA+H++R+Q+ F+  G+  
Sbjct: 142 DLGVPATSIGLTDRVTNTAQEANAIRRLLPQDQPR-VLLVTSAFHMRRAQVLFERQGLTV 200

Query: 200 KASCSDY--LNAYYSII--------PLSANFYLTELALKEYIGIL 234
                D+    A+   I        P S +   +  AL+E +G L
Sbjct: 201 LPYPVDFQARAAWAGFIWRDPLQWLPNSRSLDDSSRALRELMGRL 245


>gi|307256540|ref|ZP_07538321.1| hypothetical protein appser10_5450 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306864950|gb|EFM96852.1| hypothetical protein appser10_5450 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 252

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 74/179 (41%), Gaps = 24/179 (13%)

Query: 64  KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI------FETMRLYKSCKQHSMHCTII 117
           K    IV+LG G           +  S + + R        E MR Y +         I+
Sbjct: 80  KKAQAIVVLGGG-----------VRNSHELFGRYAIAAAPLERMR-YAAYLHKQTGLPIL 127

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177
            +GG P+       I+     L          +E+ S  T QNA  S +M+K      II
Sbjct: 128 ATGGSPEGREPEAKIMAQE--LHDFFNVSVKWVESASNTTEQNAILSKAMLKQEGIDRII 185

Query: 178 LVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY----YSIIPLSANFYLTELALKEYIG 232
           LV++ +H+KR+++ F+  G N  A+ +    A        IP +     + +ALKE+IG
Sbjct: 186 LVTNQWHMKRTKMLFEREGFNVLAAGTTAHQALDIGILPFIPQAQALQNSSIALKEWIG 244


>gi|333006363|gb|EGK25871.1| hypothetical protein SFVA6_1402 [Shigella flexneri VA-6]
          Length = 259

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 99/224 (44%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG G T  P     + 
Sbjct: 41  IFISIGWLALLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGTRVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++    E +G +  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKG 251


>gi|227529308|ref|ZP_03959357.1| conserved hypothetical protein [Lactobacillus vaginalis ATCC 49540]
 gi|227350736|gb|EEJ41027.1| conserved hypothetical protein [Lactobacillus vaginalis ATCC 49540]
          Length = 315

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 74/144 (51%), Gaps = 15/144 (10%)

Query: 100 TMRLYKS--CKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDT 157
           T RL ++  C + + + TII++GG      L+E+      L+  G+ +D I LE Q+++T
Sbjct: 166 TARLQQAIACWKLNHNATIIVTGGILHGEQLSEAQAMAKYLINHGIPQDRIILEEQAMNT 225

Query: 158 FQNAQFSSSMIKNMQG--KNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIP 215
           + N +    +++      + I++++S++H+ R+  Y +   ++     S      + + P
Sbjct: 226 WDNLRNCQRLLQKQADPKQKIVVITSSFHIFRTFNYLRKLKLSWPLVSS---KTPWKLQP 282

Query: 216 LSANFYLTELALKEYIGILIAYYR 239
           L+         +++Y+GI+  +YR
Sbjct: 283 LT--------VVRDYLGIIRDHYR 298


>gi|313681413|ref|YP_004059151.1| hypothetical protein Sulku_0284 [Sulfuricurvum kujiense DSM 16994]
 gi|313154273|gb|ADR32951.1| protein of unknown function DUF218 [Sulfuricurvum kujiense DSM
           16994]
          Length = 248

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 115/248 (46%), Gaps = 29/248 (11%)

Query: 6   IFLIVSYW--HLLCQSIR---KIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
           IFLI S    +LL +  R   KI F+  F  + + + +     +LLK L+ +Y +  L  
Sbjct: 17  IFLISSALALYLLQRGNRRRAKILFVFSFAWI-TILSYPPFSALLLKPLENAYPKVQLHS 75

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
            + +    I +LGNG T    IP      S  S +R+ E + LYKS         +I SG
Sbjct: 76  PFPR---YIHVLGNGHTSSQNIPLSSEL-SLTSLARVNEGILLYKSHPG----MKLIFSG 127

Query: 121 GDPQKHGLAESIVYNNK----LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI 176
                +G  +S+    K     +  GV  +DI +  ++ DT   A+ + ++ K +  + +
Sbjct: 128 -----YGGGDSVSNARKNSQLAIALGVNSNDIVILEEAKDT---AEEAIAVKKIVGSQPL 179

Query: 177 ILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSII---PLSANFYLTELALKEYIGI 233
           ILV+SA H+ R+   F+  GI    + +D+L      +   P S     +E A  EY+G+
Sbjct: 180 ILVTSASHMVRASSIFRKNGICVIEAPTDFLVKKEDTLWQFPSSGGLRRSECAFHEYLGL 239

Query: 234 LIAYYRGN 241
           L    +G+
Sbjct: 240 LWEKLKGS 247


>gi|307705359|ref|ZP_07642221.1| conserved hypothetical protein [Streptococcus mitis SK597]
 gi|307621146|gb|EFO00221.1| conserved hypothetical protein [Streptococcus mitis SK597]
          Length = 259

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 103/229 (44%), Gaps = 47/229 (20%)

Query: 22  KIFFMSCFM-LLFSFI-------GWGIIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLG 73
           ++F+ + F+ +LF+FI       G+  +  IL   L       L  P+ KK  + I++ G
Sbjct: 37  ELFYTNHFLNILFAFIAYSYFIFGFAFVAFILYSILY------LFIPK-KKHYDFIIIHG 89

Query: 74  ----NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLA 129
               +G  + P +   RI+ + ++Y         YKS    + +  II SGG      ++
Sbjct: 90  AGLLDGEKVTPLLKR-RIDKAVEAY---------YKS---KNSNIKIIASGGKGADEKIS 136

Query: 130 ESIVYNNKLL-ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKR 187
           E+    N LL E+ V +D I LE QS  T++N  FS  + + +  K   + V++ YH+ R
Sbjct: 137 EAQAITNYLLEETDVPQDAIILEDQSRTTYENLLFSKELGEELVAKPQFLFVTNDYHVFR 196

Query: 188 SQLYFQHFGINTKA-SCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           +  Y +   +      C             +A +Y+    ++EY+ + +
Sbjct: 197 TSTYARKLNMKGDGLGCR------------TAGYYIPSAFIREYVALCV 233


>gi|226311001|ref|YP_002770895.1| hypothetical protein BBR47_14140 [Brevibacillus brevis NBRC 100599]
 gi|226093949|dbj|BAH42391.1| hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 213

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 89  PSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDI 148
           PS     R+ +   LYK          ++++GG  +   + E+ V  N L+  G+  +DI
Sbjct: 65  PSPGLRERLEQAAILYKE----GYVSKLLVTGGLGEGKTITEAAVSRNYLVAKGIPEEDI 120

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
            LE++S  T++N  +   +++    ++ +++S  YHL R+ +     GI
Sbjct: 121 LLESKSTSTYENLLYGQQVLEEHHIQDALIISHDYHLARAMVMADSLGI 169


>gi|330685387|gb|EGG97045.1| putative membrane protein [Staphylococcus epidermidis VCU121]
          Length = 320

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 61/132 (46%), Gaps = 13/132 (9%)

Query: 59  SPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIII 118
           S  + +  ++I++LG G       P ++         R+   + +Y   +       +++
Sbjct: 140 SRHFNQSVDLIIVLGAGIFTEEVTPMLK--------ERLDRALEIYHYSEHKP---KLLV 188

Query: 119 SGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN--MQGKNI 176
           SGG      + ESI     L++ GV  D+I LE QS +T  N  +S  +I +  +    I
Sbjct: 189 SGGQGPDEPIPESIAMQRYLIKQGVPNDNILLEQQSTNTHTNFVYSKDIIHDYFVNMPKI 248

Query: 177 ILVSSAYHLKRS 188
           + V+S +H+ R+
Sbjct: 249 VCVTSQFHILRA 260


>gi|291616915|ref|YP_003519657.1| YcbC [Pantoea ananatis LMG 20103]
 gi|291151945|gb|ADD76529.1| YcbC [Pantoea ananatis LMG 20103]
          Length = 308

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 69/144 (47%), Gaps = 18/144 (12%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQ 124
           IV+LG G T  P        PS      S  R+ E +R +    Q +M  T   +G +P+
Sbjct: 116 IVVLGGGYTYNPAW-----APSSNLLNNSLPRVTEGVRQWLRNPQATMVFTGAAAGHNPK 170

Query: 125 KHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAY 183
            +    +     ++ ES GV    I +  Q  DT Q A+  S++I +    + +LV+SA 
Sbjct: 171 SNAWVAA-----QVAESLGVPDAHIHILDQPKDTEQEARAVSAVIGH---HSFLLVTSAN 222

Query: 184 HLKRSQLYFQHFGINTKASCSDYL 207
           H+ R+  +FQ  G+N  A+ ++ L
Sbjct: 223 HMPRAMRFFQQAGLNPIAAPANQL 246


>gi|323499476|ref|ZP_08104447.1| hypothetical protein VISI1226_09254 [Vibrio sinaloensis DSM 21326]
 gi|323315463|gb|EGA68503.1| hypothetical protein VISI1226_09254 [Vibrio sinaloensis DSM 21326]
          Length = 267

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 104/223 (46%), Gaps = 37/223 (16%)

Query: 28  CFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTIIP 80
           CF++LFSFIG     +  + T LL  ++  Y     S  +  D +I  +++LG+G  +  
Sbjct: 39  CFIVLFSFIGIFLVAFQPVSTRLLMPIERQY-----SAFFPVDESIDYVMVLGSGHVVDD 93

Query: 81  TIPAIRIEPSFQSYSRIFE---TMRLYKSCKQHSMHCTIIISG--GDPQKHGLAESIVYN 135
            IP    E S     R+ E    MR+Y   K       +I+SG  G  +   ++ + +  
Sbjct: 94  EIPPTS-ELSRTGLMRLAEGIRIMRIYPGSK-------LILSGYAGGSE---ISNARMMA 142

Query: 136 NKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHF 195
              L  GV + DI L   + DT++ A+ +++ +K+   + +++V+SA H++R+   F   
Sbjct: 143 KVALALGVSKSDIVLLETAKDTWEEARQAAAFVKH---RKLVVVTSASHMQRALNEFHSA 199

Query: 196 GINTKASCSDYL------NAYYSIIPLSANFYLTELALKEYIG 232
           G+    + ++YL       A+    P +     TE    E +G
Sbjct: 200 GLKPYPAPTNYLAHDNVTQAWTKYTPRAVYLEQTERYWHETLG 242


>gi|229827667|ref|ZP_04453736.1| hypothetical protein GCWU000182_03056 [Abiotrophia defectiva ATCC
           49176]
 gi|229788127|gb|EEP24241.1| hypothetical protein GCWU000182_03056 [Abiotrophia defectiva ATCC
           49176]
          Length = 319

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 74/153 (48%), Gaps = 19/153 (12%)

Query: 86  RIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAES-IVYNNKLLESGVE 144
           R+ P  +   RI + +  +K  K  + +  +I SGG      ++E+  ++N  + E+ V 
Sbjct: 157 RVTPLLKR--RIDKAVEAFK--KSRNSNIKLIASGGQGADEKISEARAIFNYLMEETDVP 212

Query: 145 RDDIKLETQSLDTFQNAQFSSSMIKNM-QGKNIILVSSAYHLKRSQLYFQHFGINTKA-S 202
            + + +E QS  T+QN  FS  + +++ +    + V++ YH+ R+  Y +  GI      
Sbjct: 213 GEAVLMEDQSKTTYQNLLFSKKLGESLVENPRFLFVTNDYHVFRTSTYAKKIGIRGDGLG 272

Query: 203 CSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           CS            +A++YL    ++EY+ + +
Sbjct: 273 CS------------TASYYLPSAFIREYVALCV 293


>gi|323359408|ref|YP_004225804.1| hypothetical protein MTES_2960 [Microbacterium testaceum StLB037]
 gi|323275779|dbj|BAJ75924.1| uncharacterized conserved protein [Microbacterium testaceum
           StLB037]
          Length = 337

 Score = 48.1 bits (113), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 77/169 (45%), Gaps = 23/169 (13%)

Query: 69  IVLLGNG--TTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKH 126
           IV+LG+G     +P +   R++ +  ++ R         + +       ++ SGG     
Sbjct: 161 IVVLGSGLIRGEVPPLLRGRLDRAIAAWRR---------AVRAGGAAPVLVPSGGQGPDE 211

Query: 127 GLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN-IILVSSAYHL 185
              E       L + G+  D I+ ET+SL+T +N +FS  ++  + G   +++V+S YH+
Sbjct: 212 PRPEGEAMAEYLRDQGIPGDLIRPETRSLNTRENLEFSRVIVDGIDGGGPVLIVTSDYHM 271

Query: 186 KRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
            R+ L  +      +   +  + A       +A +++    L+EY+ +L
Sbjct: 272 LRAGLLARR-----RIPRARVVGAR------TAAYFVPSAFLREYVALL 309


>gi|239638178|ref|ZP_04679130.1| putative membrane protein [Staphylococcus warneri L37603]
 gi|239596199|gb|EEQ78744.1| putative membrane protein [Staphylococcus warneri L37603]
          Length = 320

 Score = 48.1 bits (113), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 67/146 (45%), Gaps = 19/146 (13%)

Query: 59  SPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMH-CTII 117
           S  + +  ++I++LG G       P ++         R+   + +Y     HS H   ++
Sbjct: 140 SRHFNQSVDLIIVLGAGIFTEEVTPMLK--------ERLNRALEIY----HHSEHKPQLL 187

Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMI----KNMQG 173
           +SGG      + ESI     L++ GV  D+I LE QS +T  N  +S  +I     NM  
Sbjct: 188 VSGGQGPDEPIPESIAMQRYLIKQGVPNDNILLEQQSTNTHTNFVYSKEIILQYFNNM-- 245

Query: 174 KNIILVSSAYHLKRSQLYFQHFGINT 199
             ++ V+S +H+ R+    Q+  I T
Sbjct: 246 PKMVCVTSQFHILRALKLAQNLDIPT 271


>gi|154500224|ref|ZP_02038262.1| hypothetical protein BACCAP_03888 [Bacteroides capillosus ATCC
           29799]
 gi|150270956|gb|EDM98230.1| hypothetical protein BACCAP_03888 [Bacteroides capillosus ATCC
           29799]
          Length = 230

 Score = 48.1 bits (113), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 65/119 (54%), Gaps = 13/119 (10%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQ--- 172
           +I+SGG      ++E+    + L+E+G   D I LE  S +T +N  +S ++++++    
Sbjct: 91  VIVSGGQGLDEPVSEAASMADYLIEAGYSDDYIYLEDNSHNTAENLGYSVALLESLSLDP 150

Query: 173 -GKNIILVSSAYHLKRSQLYFQHFG---INTKASCSDYLNAYYSIIPLSANFYLTELAL 227
               I++VS+ +HL R+++  + FG   ++T A+ S +L +  S+      F+   LAL
Sbjct: 151 AEDEILIVSNGFHLTRARMLAERFGYGHVSTLAAPSSHLPSRISM------FFREPLAL 203


>gi|194335748|ref|YP_002017542.1| protein of unknown function DUF218 [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308225|gb|ACF42925.1| protein of unknown function DUF218 [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 248

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 92/205 (44%), Gaps = 18/205 (8%)

Query: 40  IIPTILLKHLQFSYQRPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFE 99
           ++   L++ ++    R  +S   K D  I+VL G    +I T+    +     +  R   
Sbjct: 46  VMSDFLMRSVEVGEGRVPVSSVGKADA-IVVLSG----MIVTVDGAPLGEWGGAVDRFDG 100

Query: 100 TMRLYKSCKQHSMHCTIIISGGDPQKHGLA-ESIVYNNKLLESGVERDDIKLETQSLDTF 158
            + L+K+ +       +   G  P + G+  E  +   + L  GV +  I+L  ++ +T 
Sbjct: 101 GVELFKAGRAP---VVVFTRGQVPWQPGVVPEGELLAKRALLLGVPQSAIRLTGKAGNTA 157

Query: 159 QNAQFSSSMI---KNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNA------ 209
             A  +S ++   K    + IILV+SA+H++R++  F+  G   +    DY  +      
Sbjct: 158 DEAAAASVLLGASKKGVPRRIILVTSAFHMRRARFLFERAGFAVEPFLVDYQTSEKSPLT 217

Query: 210 YYSIIPLSANFYLTELALKEYIGIL 234
             S +P +     ++ AL+E IG+L
Sbjct: 218 VLSFLPNAEALAQSDRALREVIGLL 242


>gi|294491966|gb|ADE90722.1| conserved hypothetical protein [Escherichia coli IHE3034]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 100/225 (44%), Gaps = 28/225 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG G T  P     + 
Sbjct: 41  IFISIGWLALLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVSARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
            ++       LN +   IP       ++    E +G +  + +G+
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKGS 252


>gi|239833683|ref|ZP_04682011.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239821746|gb|EEQ93315.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 206

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 68/152 (44%), Gaps = 26/152 (17%)

Query: 87  IEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLL-ESGVER 145
           + P      R  +  RL+K  +       +I+  GD          +YN +++  +GV  
Sbjct: 38  VVPGGDGPPRAAQAARLWKEGRS-----PVILVTGD-------GDCLYNKRIMVRNGVNP 85

Query: 146 DDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASC-- 203
             I +E QS  T+QNAQFS+ +++ ++ ++ ++V++ YH +R+   F       +A+C  
Sbjct: 86  SAIFVECQSGSTWQNAQFSAPVLREIRARSALVVTNWYHSRRAIASF-------RAACPQ 138

Query: 204 ----SDYLNAYYSIIPLSANFYLTELALKEYI 231
               S  +          A     EL  KEY+
Sbjct: 139 MRFISSPIGGDDGRPGFPATPADMELVAKEYV 170


>gi|197105490|ref|YP_002130867.1| hypothetical protein PHZ_c2027 [Phenylobacterium zucineum HLK1]
 gi|196478910|gb|ACG78438.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 186

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 104 YKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQF 163
           +++ + H     ++ SGG   +HG +E+ V   +L   G+  + + L+ +SLDT Q+A  
Sbjct: 43  WQAAQAHP-GAQVLCSGGV-GRHGPSEASVMAERLAALGLAAERLILDEESLDTLQSAGA 100

Query: 164 SSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKAS 202
            +   + +   ++++ S AYH+ R +L     G  + A 
Sbjct: 101 VARWRRRLGAADVVVCSDAYHVPRIRLLLGALGTPSVAG 139


>gi|51891778|ref|YP_074469.1| hypothetical protein STH640 [Symbiobacterium thermophilum IAM
           14863]
 gi|51855467|dbj|BAD39625.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 187

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQS 154
            R      LYK+     +   + I+GGD +  G+ E+    + ++E  V  + I +E + 
Sbjct: 39  ERAERAAELYKA----GLAPKVFITGGDKRGIGVCEAERLRDHMVELSVPAEAIDIECEG 94

Query: 155 LDTFQNAQFSSSMIKNMQG----KNIILVSSAYHLKRSQLYFQHF-GINTKASC 203
           L+T +  Q+S   I+   G    KN++LVS+ +H++R +    ++    TK +C
Sbjct: 95  LNTIEQVQYSVKRIEETIGWKNIKNVLLVSAPHHMRRVKRTIANYIPRETKITC 148


>gi|322514156|ref|ZP_08067222.1| hypothetical protein HMPREF0027_0974 [Actinobacillus ureae ATCC
           25976]
 gi|322119969|gb|EFX91970.1| hypothetical protein HMPREF0027_0974 [Actinobacillus ureae ATCC
           25976]
          Length = 248

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 65/139 (46%), Gaps = 7/139 (5%)

Query: 98  FETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDT 157
            E MR Y +         I+++GG P+       I+     L          +E +S  T
Sbjct: 105 LERMR-YAAYLHKQTGLPILVTGGSPEGREPEAKIMAQE--LNDFFHVPVTWVEEKSNVT 161

Query: 158 FQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY----YSI 213
            +NA FS  ++ +   ++I+LV++ +H+KR+++ F+  G N  A+ +    A        
Sbjct: 162 EENATFSKPILMHAGIQHIVLVTNQWHMKRAKMLFEREGFNVLAASTTAHQALDIGILPF 221

Query: 214 IPLSANFYLTELALKEYIG 232
           IP +     + +ALKE+IG
Sbjct: 222 IPQAQALQNSSIALKEWIG 240


>gi|331646185|ref|ZP_08347288.1| putative KicA protein [Escherichia coli M605]
 gi|330910700|gb|EGH39210.1| membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Escherichia coli AA86]
 gi|331044937|gb|EGI17064.1| putative KicA protein [Escherichia coli M605]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 100/225 (44%), Gaps = 28/225 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG G T  P     + 
Sbjct: 41  IFISIGWLALLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
            ++       LN +   IP       ++    E +G +  + +G+
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKGS 252


>gi|254381969|ref|ZP_04997332.1| conserved hypothetical protein [Streptomyces sp. Mg1]
 gi|194340877|gb|EDX21843.1| conserved hypothetical protein [Streptomyces sp. Mg1]
          Length = 338

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 69/141 (48%), Gaps = 15/141 (10%)

Query: 66  GNI--IVLLGNGTT---IIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
           GN+  +V+LG+G T    +P + A R+E   +       T +L +          ++ SG
Sbjct: 159 GNVDYVVVLGSGLTGGEDVPPLLASRLEKGHR-----IHTAQLARGGPAP----LLLASG 209

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSS-MIKNMQGKNIILV 179
           G      + E+    + L+  GV R+ ++LE +S  T +N +FS   M +   G   ++V
Sbjct: 210 GQGPGEAVPEARAMADWLIARGVAREHVRLEDRSRTTEENLRFSRELMAEENPGYRCVVV 269

Query: 180 SSAYHLKRSQLYFQHFGINTK 200
           ++++H  R+ +  +  G+N +
Sbjct: 270 TNSFHAFRAAMTARRAGVNGQ 290


>gi|218548436|ref|YP_002382227.1| hypothetical protein EFER_1064 [Escherichia fergusonii ATCC 35469]
 gi|218355977|emb|CAQ88593.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia fergusonii ATCC 35469]
 gi|325496858|gb|EGC94717.1| hypothetical protein ECD227_0955 [Escherichia fergusonii ECD227]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 100/225 (44%), Gaps = 28/225 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG G T  P     + 
Sbjct: 41  IFISIGWLALLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
            ++       LN +   IP       ++    E +G +  + +G+
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKGS 252


>gi|134099149|ref|YP_001104810.1| hypothetical protein SACE_2594 [Saccharopolyspora erythraea NRRL
           2338]
 gi|291009369|ref|ZP_06567342.1| hypothetical protein SeryN2_33020 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133911772|emb|CAM01885.1| putative membrane protein [Saccharopolyspora erythraea NRRL 2338]
          Length = 331

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/176 (19%), Positives = 81/176 (46%), Gaps = 20/176 (11%)

Query: 63  KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           ++D + +V+LG+G      +   R+ P   S  R+     ++++ +       +++SGG 
Sbjct: 155 RRDVDFVVVLGSG------LIGSRVPPLLAS--RLDRGREVFETAQAKGRDPMLVVSGGQ 206

Query: 123 PQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSS 181
                + E+    + L   GV  D I +E QS  T +N +FS ++++  +     ++V++
Sbjct: 207 GPGEDVPEARAMADYLGSRGVPEDRILIEDQSRSTEENLRFSKAIMQERRSDYRCLVVTN 266

Query: 182 AYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAY 237
            +H+ R+    +   +N +   S            +A ++     ++E+I I +A+
Sbjct: 267 NFHVMRAARTARSEKVNGQVIGSR-----------TARYFWPSAIIREFIAIFLAH 311


>gi|167854576|ref|ZP_02477357.1| hypothetical protein HPS_02329 [Haemophilus parasuis 29755]
 gi|167854331|gb|EDS25564.1| hypothetical protein HPS_02329 [Haemophilus parasuis 29755]
          Length = 247

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 66/137 (48%), Gaps = 12/137 (8%)

Query: 104 YKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQF 163
           Y +  Q      ++I+G  P+  G +E+ V   K LE         LE ++  T +NA+F
Sbjct: 110 YAAFLQKETGLPLLITGSSPK--GTSEAAVMK-KELEQFFHIPTQWLEEKAKTTAENAKF 166

Query: 164 SSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT--------KASCSDYLNAYYSIIP 215
           S  +++      I+LV++ +H++R+++ F+  G           K   +  LN +Y  IP
Sbjct: 167 SKPILEKEGINKIVLVTNQWHMQRARMLFEREGFKILPASVGAGKMPETYGLNVFY-FIP 225

Query: 216 LSANFYLTELALKEYIG 232
            S   +    ALKE+IG
Sbjct: 226 QSGALHSNMHALKEWIG 242


>gi|15893643|ref|NP_346992.1| hypothetical protein CA_C0352 [Clostridium acetobutylicum ATCC 824]
 gi|15023198|gb|AAK78332.1|AE007549_12 Uncharacterized conserved membrane protein, SANA family
           [Clostridium acetobutylicum ATCC 824]
 gi|325507765|gb|ADZ19401.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 225

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 77/156 (49%), Gaps = 17/156 (10%)

Query: 53  YQRPLLSPQWKKDG-NIIVLLGNGTTIIPTIPAIRI-EPSFQSYSRIFETMRLYKSCKQH 110
           Y+ P+   + ++D  ++I++LG         PA++  +PS     R+ + ++L+     +
Sbjct: 36  YKSPIT--KLRRDSFDVIIILG--------FPALQNGKPSPIMRERVIKAVKLFNKGYAN 85

Query: 111 SMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKN 170
            + C+    GG   K+   ES V  N     G+    +  E +S +T+QN Q S  +++N
Sbjct: 86  KIICS---GGGVYNKY--IESDVMANFAKSLGIPNGCLIKEDKSRNTYQNIQNSIKIMEN 140

Query: 171 MQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDY 206
               + I+V+S +HL+RS  +   F I  +   SDY
Sbjct: 141 KHWSSAIVVTSPWHLRRSNYFLSKFNIAYRMEKSDY 176


>gi|82544659|ref|YP_408606.1| hypothetical protein SBO_2208 [Shigella boydii Sb227]
 gi|187732229|ref|YP_001880883.1| hypothetical protein SbBS512_E2405 [Shigella boydii CDC 3083-94]
 gi|81246070|gb|ABB66778.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|187429221|gb|ACD08495.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
 gi|320173261|gb|EFW48470.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Shigella dysenteriae CDC
           74-1112]
 gi|320187456|gb|EFW62146.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Shigella flexneri CDC 796-83]
 gi|332093351|gb|EGI98409.1| hypothetical protein SB359474_2557 [Shigella boydii 3594-74]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 99/224 (44%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG G T  P     + 
Sbjct: 41  IFISIGWLALLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++    E +G +  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKG 251


>gi|301381971|ref|ZP_07230389.1| hypothetical protein PsyrptM_05027 [Pseudomonas syringae pv. tomato
           Max13]
          Length = 256

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 111/256 (43%), Gaps = 39/256 (15%)

Query: 6   IFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQR-----PLLSP 60
           + LI+ +W    +  R     +CF      +    +P ++    +F+ ++     PL   
Sbjct: 19  LLLILGWW---LRRSRPRLATACFAAGLGGLWLMSVPVVV----EFAARKMEQIPPLPQQ 71

Query: 61  QWK---KDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRI---FETMRLYKSCKQHSMHC 114
           QW    +  + IV+LGNG          R  P++ + +      E +RL     + S   
Sbjct: 72  QWATLAQQADAIVVLGNGRE--------RNSPTWGADTPTGLGLERLRLAARLAKES-GL 122

Query: 115 TIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKL-ETQSLDTFQNAQFSSSMIKNMQ 172
            I+ +GG       +E+ +    L +  GV    ++  E  S  T++NA+ ++++++   
Sbjct: 123 PILTAGGLHFDQPPSEASIMAQALQQDFGV---TVRWQEGLSRTTWENAKMTAAVLQPQG 179

Query: 173 GKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN-----AYYSIIPLSANFYLTELAL 227
            K ++LV+ A+H+ R++  F+  G    ++   +L       +   +P S  F  + + L
Sbjct: 180 IKRVVLVTQAWHMPRARWSFEQAGFTVVSAPVGFLGVDNARPFGGWLPESRVFTQSGVLL 239

Query: 228 KEYIGILI--AYYRGN 241
            E  G+L+    YRG 
Sbjct: 240 NEAAGLLVYPWIYRGG 255


>gi|229523809|ref|ZP_04413214.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae bv. albensis
           VL426]
 gi|229337390|gb|EEO02407.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio cholerae bv. albensis
           VL426]
          Length = 282

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 101/227 (44%), Gaps = 39/227 (17%)

Query: 27  SCFMLLFSFIG-----WGIIPTILLKHLQFSYQRPLLSPQWKKDGNI--IVLLGNGTTII 79
            C ++LFS  G     +  + T LL  L+ +Y   L       +G +  +++LGNG  I 
Sbjct: 47  GCLVVLFSLTGLFLVSFQPVATRLLMPLERTYTAFL-----PVEGTLDYVMVLGNGHVID 101

Query: 80  PTIPAIRIEPSFQSYSRIFETMR---LYKSCKQHSMHCTIIISG---GDPQKHGLAESIV 133
             IP    E +  +  R+ E +R   +Y   K       +I+SG   G    H    + V
Sbjct: 102 DDIPPTS-ELTRAALMRLTEGIRISRMYPGSK-------LILSGYAGGSEVSHARMMARV 153

Query: 134 YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193
                L  GV + DI L   + D ++ A+ +++ +   Q K ++LV+SA H+KR+   F+
Sbjct: 154 A----LALGVPKSDIILLETAKDAWEEARQAAAFV---QQKRMVLVTSASHMKRAMREFE 206

Query: 194 HFGINTKASCSDYLN------AYYSIIPLSANFYLTELALKEYIGIL 234
             G+    + ++YL        +   IP S     TE    E +G++
Sbjct: 207 SAGLTPIPAPTNYLGHLNIIQPWDKYIPRSRYLEQTEQYWHETLGLM 253


>gi|182678647|ref|YP_001832793.1| hypothetical protein Bind_1673 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634530|gb|ACB95304.1| protein of unknown function DUF218 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 284

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 70/144 (48%), Gaps = 16/144 (11%)

Query: 99  ETMRLYKSCKQHSMHCTIIISGGDPQKHG--LAESIVYNNKLLES-GVERDDIKLETQSL 155
           E  RL+   K       +I +GG     G   +ESI Y  +L ++ GV  + +  E  S 
Sbjct: 114 ELSRLFPQAK-------LIFTGGSGDLMGDQPSESI-YARELWQNLGVPAEQMVFEGNSR 165

Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN----AYY 211
           +T++NA F+  +IK       +LV+SA H+ RS   F+  G N     ++Y+       +
Sbjct: 166 NTWENAVFTRDLIKPKPEDRYLLVTSAAHMPRSVGIFRKVGFNVIPYNANYMTIGDARDW 225

Query: 212 SIIPLSAN-FYLTELALKEYIGIL 234
           S+  L+ +   +    L+E+IG+L
Sbjct: 226 SVTTLAHDRLRMLSFGLREWIGLL 249


>gi|323463635|gb|ADX75788.1| membrane protein [Staphylococcus pseudintermedius ED99]
          Length = 317

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 61/124 (49%), Gaps = 11/124 (8%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           II+SGG      ++E++     L++ G+    I +E QS +T QN  +S   +   Q  +
Sbjct: 186 IIVSGGQGPDEPISEALAMQRYLIQQGIAPKQITMEDQSTNTRQNIYYSKHYLALHQQPH 245

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I+V+S++H+ R+           + +    L+A+    P   ++   EL +++Y G+L 
Sbjct: 246 TIIVTSSFHILRA----------LRLAERQQLHAFGYGAPTPHHWVSREL-IRDYSGLLF 294

Query: 236 AYYR 239
            Y R
Sbjct: 295 QYPR 298


>gi|260768178|ref|ZP_05877112.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio furnissii CIP 102972]
 gi|260616208|gb|EEX41393.1| membrane protein functionally coupled to the MukBEF chromosome
           partitioning mechanism [Vibrio furnissii CIP 102972]
 gi|315179879|gb|ADT86793.1| hypothetical protein vfu_A01625 [Vibrio furnissii NCTC 11218]
          Length = 269

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 89/195 (45%), Gaps = 37/195 (18%)

Query: 28  CFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSPQWKK-------DGNI--IVLLGNGTTI 78
           C ++LFS  G      I L   Q    R LL P  ++       DG I  +++LGNG  +
Sbjct: 39  CLVVLFSLFG------IFLISFQPVSSR-LLMPLERQYSAFLPVDGTIDYVMVLGNGHVV 91

Query: 79  IPTIPAIRIEPSFQSYSRIFE---TMRLYKSCKQHSMHCTIIISG---GDPQKHGLAESI 132
              IP    E S  +  R+ E    MR+Y   K       +I+SG   G    H    + 
Sbjct: 92  DDQIPPTS-ELSRAALMRLAEGIRVMRMYPGSK-------LILSGYAGGSEFSHARMLAR 143

Query: 133 VYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYF 192
           V     L  GV + DI L   + DT++ A+ +++ +   Q + ++LV+SA H++R+   F
Sbjct: 144 VA----LALGVAKSDIILLETAKDTWEEARQAAAFV---QQRRLVLVTSASHMQRALNEF 196

Query: 193 QHFGINTKASCSDYL 207
              G+    + ++YL
Sbjct: 197 HSAGLQPIPAPTNYL 211


>gi|82777557|ref|YP_403906.1| hypothetical protein SDY_2338 [Shigella dysenteriae Sd197]
 gi|309787791|ref|ZP_07682401.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|331651940|ref|ZP_08352959.1| putative KicA protein [Escherichia coli M718]
 gi|81241705|gb|ABB62415.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|308924190|gb|EFP69687.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|331050218|gb|EGI22276.1| putative KicA protein [Escherichia coli M718]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 99/224 (44%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG G T  P     + 
Sbjct: 41  IFISIGWLSLLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++    E +G +  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKG 251


>gi|30062454|ref|NP_836625.1| hypothetical protein S0980 [Shigella flexneri 2a str. 2457T]
 gi|56479770|ref|NP_706838.2| hypothetical protein SF0916 [Shigella flexneri 2a str. 301]
 gi|110804928|ref|YP_688448.1| hypothetical protein SFV_0921 [Shigella flexneri 5 str. 8401]
 gi|191166971|ref|ZP_03028794.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|193064658|ref|ZP_03045737.1| conserved hypothetical protein [Escherichia coli E22]
 gi|194428374|ref|ZP_03060915.1| conserved hypothetical protein [Escherichia coli B171]
 gi|209918170|ref|YP_002292254.1| hypothetical protein ECSE_0979 [Escherichia coli SE11]
 gi|218694393|ref|YP_002402060.1| hypothetical protein EC55989_0965 [Escherichia coli 55989]
 gi|256020952|ref|ZP_05434817.1| hypothetical protein ShiD9_18687 [Shigella sp. D9]
 gi|260843169|ref|YP_003220947.1| hypothetical protein ECO103_0964 [Escherichia coli O103:H2 str.
           12009]
 gi|260867092|ref|YP_003233494.1| hypothetical protein ECO111_0988 [Escherichia coli O111:H- str.
           11128]
 gi|300816976|ref|ZP_07097195.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300902921|ref|ZP_07120866.1| hypothetical protein HMPREF9536_01066 [Escherichia coli MS 84-1]
 gi|301302471|ref|ZP_07208602.1| hypothetical protein HMPREF9347_01048 [Escherichia coli MS 124-1]
 gi|307311693|ref|ZP_07591333.1| protein of unknown function DUF218 [Escherichia coli W]
 gi|309795095|ref|ZP_07689515.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|332282175|ref|ZP_08394588.1| conserved hypothetical protein [Shigella sp. D9]
 gi|30040700|gb|AAP16431.1| hypothetical protein S0980 [Shigella flexneri 2a str. 2457T]
 gi|56383321|gb|AAN42545.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|110614476|gb|ABF03143.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|190902965|gb|EDV62691.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|192927715|gb|EDV82330.1| conserved hypothetical protein [Escherichia coli E22]
 gi|194413589|gb|EDX29870.1| conserved hypothetical protein [Escherichia coli B171]
 gi|209911429|dbj|BAG76503.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218351125|emb|CAU96829.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli 55989]
 gi|257758316|dbj|BAI29813.1| conserved predicted inner membrane protein [Escherichia coli
           O103:H2 str. 12009]
 gi|257763448|dbj|BAI34943.1| conserved predicted inner membrane protein [Escherichia coli
           O111:H- str. 11128]
 gi|281600279|gb|ADA73263.1| hypothetical protein SFxv_0991 [Shigella flexneri 2002017]
 gi|300405063|gb|EFJ88601.1| hypothetical protein HMPREF9536_01066 [Escherichia coli MS 84-1]
 gi|300530328|gb|EFK51390.1| conserved hypothetical protein [Escherichia coli MS 107-1]
 gi|300842310|gb|EFK70070.1| hypothetical protein HMPREF9347_01048 [Escherichia coli MS 124-1]
 gi|306908248|gb|EFN38747.1| protein of unknown function DUF218 [Escherichia coli W]
 gi|308121399|gb|EFO58661.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|313650839|gb|EFS15240.1| hypothetical protein SF2457T_0842 [Shigella flexneri 2a str. 2457T]
 gi|315060205|gb|ADT74532.1| conserved inner membrane protein [Escherichia coli W]
 gi|315257961|gb|EFU37929.1| probable membrane protein [Escherichia coli MS 85-1]
 gi|315296223|gb|EFU55530.1| conserved hypothetical protein [Escherichia coli MS 16-3]
 gi|320202316|gb|EFW76887.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Escherichia coli EC4100B]
 gi|323174979|gb|EFZ60594.1| hypothetical protein ECLT68_0536 [Escherichia coli LT-68]
 gi|323175457|gb|EFZ61052.1| hypothetical protein ECOK1180_5741 [Escherichia coli 1180]
 gi|323379235|gb|ADX51503.1| protein of unknown function DUF218 [Escherichia coli KO11]
 gi|324019071|gb|EGB88290.1| hypothetical protein HMPREF9542_02266 [Escherichia coli MS 117-3]
 gi|324117215|gb|EGC11123.1| hypothetical protein ERBG_02930 [Escherichia coli E1167]
 gi|332104527|gb|EGJ07873.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332759007|gb|EGJ89317.1| hypothetical protein SF434370_1174 [Shigella flexneri 4343-70]
 gi|332760112|gb|EGJ90410.1| hypothetical protein SF274771_1134 [Shigella flexneri 2747-71]
 gi|332762691|gb|EGJ92954.1| hypothetical protein SFK671_1086 [Shigella flexneri K-671]
 gi|332767869|gb|EGJ98059.1| hypothetical protein SF293071_1100 [Shigella flexneri 2930-71]
 gi|333007013|gb|EGK26508.1| hypothetical protein SFK218_1285 [Shigella flexneri K-218]
 gi|333008904|gb|EGK28364.1| hypothetical protein SFK272_1422 [Shigella flexneri K-272]
 gi|333020002|gb|EGK39273.1| hypothetical protein SFK304_1250 [Shigella flexneri K-304]
 gi|333020214|gb|EGK39484.1| hypothetical protein SFK227_1149 [Shigella flexneri K-227]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 99/224 (44%), Gaps = 28/224 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG G T  P     + 
Sbjct: 41  IFISIGWLALLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
            ++       LN +   IP       ++    E +G +  + +G
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKG 251


>gi|319893318|ref|YP_004150193.1| Integral membrane protein [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317163014|gb|ADV06557.1| Integral membrane protein [Staphylococcus pseudintermedius
           HKU10-03]
          Length = 260

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 61/124 (49%), Gaps = 11/124 (8%)

Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175
           II+SGG      ++E++     L++ G+    I +E QS +T QN  +S   +   Q  +
Sbjct: 129 IIVSGGQGPDEPISEALAMQRYLIQQGIAPKQITMEDQSTNTRQNIYYSKHYLALHQQPH 188

Query: 176 IILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
            I+V+S++H+ R+           + +    L+A+    P   ++   EL +++Y G+L 
Sbjct: 189 TIIVTSSFHILRA----------LRLAERQQLHAFGYGAPTPHHWVSREL-IRDYSGLLF 237

Query: 236 AYYR 239
            Y R
Sbjct: 238 QYPR 241


>gi|194431483|ref|ZP_03063775.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|194420308|gb|EDX36385.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|320182013|gb|EFW56918.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Shigella boydii ATCC 9905]
 gi|332091384|gb|EGI96471.1| hypothetical protein SD15574_2367 [Shigella dysenteriae 155-74]
 gi|332092552|gb|EGI97625.1| hypothetical protein SB521682_1309 [Shigella boydii 5216-82]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 99/227 (43%), Gaps = 34/227 (14%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQR---PLLS--PQWKKDGNI--IVLLGNGTTIIPTIPA 84
           +F  IGW   P +LL  LQ    R   P+ S  P W     +  IV+LG G T  P    
Sbjct: 41  IFISIGW---PALLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP---- 93

Query: 85  IRIEPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLE 140
            +  PS      S  R+ E +RL++     +    +I +GG  + + ++ + V       
Sbjct: 94  -QWAPSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGARVAQS 148

Query: 141 SGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINT 199
            GV  + I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N 
Sbjct: 149 LGVPHEQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNP 204

Query: 200 KASCSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240
             + ++       LN +   IP       ++    E +G +  + +G
Sbjct: 205 LPAPANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKG 251


>gi|218288615|ref|ZP_03492892.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218241272|gb|EED08447.1| protein of unknown function DUF218 [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 199

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 88  EPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDD 147
           EPS    +R+   + LY+     +    II+SGG  +   ++E+      L+ +G+  D 
Sbjct: 55  EPSHPLVARLRAAIALYRQGYIRA----IIVSGGQGENETVSEARSMKRFLVMNGIPADA 110

Query: 148 IKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINT 199
           +  E  S +T++N   SS+++++   +  ++++S YHL R+    +  G++ 
Sbjct: 111 VHEERMSTNTWENLYHSSAIMRDRGYRTAVIITSDYHLPRALAVARMLGMDA 162


>gi|26991472|ref|NP_746897.1| hypothetical protein PP_4792 [Pseudomonas putida KT2440]
 gi|24986550|gb|AAN70361.1|AE016678_2 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 253

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 81/179 (45%), Gaps = 23/179 (12%)

Query: 67  NIIVLLGNGTTIIPTIPAIRIEPSF----QSYSRIFETMRLYKSCKQHSMHCTIIISGGD 122
           + IV+LG G          R +P++    Q  +   E MR      + S    ++ SGG 
Sbjct: 81  DAIVVLGAGRE--------RGDPAWGGGDQPTATALERMRFAARLAKAS-GLPVLTSGGL 131

Query: 123 PQKHGLAESIVYNNKLLES-GVERDDIKL-ETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
                 +E+ +   +L E   VE   +K  E  S  T++NAQ ++ +++ +  + ++LV+
Sbjct: 132 HYGTPPSEARLMAERLHEDFAVE---VKWREEASRTTWENAQLTAKVLQPLGFRRVVLVT 188

Query: 181 SAYHLKRSQLYFQHFGINTKAS-----CSDYLNAYYSIIPLSANFYLTELALKEYIGIL 234
            A+H++RS+  F+  G     +       D+   +  ++P S   + +     E +G++
Sbjct: 189 QAWHMQRSRWSFEQAGFEVVPAPVGFLGRDHARPFGGLLPESRAMWQSGQLFNEVVGLV 247


>gi|26246946|ref|NP_752986.1| hypothetical protein c1061 [Escherichia coli CFT073]
 gi|110641117|ref|YP_668847.1| hypothetical protein ECP_0931 [Escherichia coli 536]
 gi|191172139|ref|ZP_03033683.1| conserved hypothetical protein [Escherichia coli F11]
 gi|215486045|ref|YP_002328476.1| hypothetical protein E2348C_0913 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218688763|ref|YP_002396975.1| hypothetical protein ECED1_0950 [Escherichia coli ED1a]
 gi|227884115|ref|ZP_04001920.1| inner membrane protein [Escherichia coli 83972]
 gi|300978421|ref|ZP_07174269.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|301047819|ref|ZP_07194871.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|312969014|ref|ZP_07783221.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|26107346|gb|AAN79529.1|AE016758_133 Hypothetical protein ycbC [Escherichia coli CFT073]
 gi|110342709|gb|ABG68946.1| putative membrane protein [Escherichia coli 536]
 gi|190907666|gb|EDV67261.1| conserved hypothetical protein [Escherichia coli F11]
 gi|215264117|emb|CAS08461.1| conserved predicted inner membrane protein [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218426327|emb|CAR07152.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli ED1a]
 gi|227838867|gb|EEJ49333.1| inner membrane protein [Escherichia coli 83972]
 gi|300300311|gb|EFJ56696.1| conserved hypothetical protein [Escherichia coli MS 185-1]
 gi|300409663|gb|EFJ93201.1| conserved hypothetical protein [Escherichia coli MS 45-1]
 gi|307552759|gb|ADN45534.1| conserved inner membrane protein [Escherichia coli ABU 83972]
 gi|312286416|gb|EFR14329.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|315291218|gb|EFU50578.1| conserved hypothetical protein [Escherichia coli MS 153-1]
 gi|320196586|gb|EFW71209.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Escherichia coli WV_060327]
 gi|323967167|gb|EGB62591.1| hypothetical protein ERJG_01450 [Escherichia coli M863]
 gi|323976693|gb|EGB71781.1| hypothetical protein ERFG_02482 [Escherichia coli TW10509]
 gi|324009859|gb|EGB79078.1| hypothetical protein HMPREF9532_00410 [Escherichia coli MS 57-2]
 gi|324012947|gb|EGB82166.1| hypothetical protein HMPREF9533_03015 [Escherichia coli MS 60-1]
 gi|327253710|gb|EGE65339.1| hypothetical protein ECSTEC7V_1135 [Escherichia coli STEC_7v]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 100/225 (44%), Gaps = 28/225 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG G T  P     + 
Sbjct: 41  IFISIGWLALLLLSLQPIADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
            ++       LN +   IP       ++    E +G +  + +G+
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKGS 252


>gi|15800781|ref|NP_286795.1| hypothetical protein Z1267 [Escherichia coli O157:H7 EDL933]
 gi|15830257|ref|NP_309030.1| hypothetical protein ECs1003 [Escherichia coli O157:H7 str. Sakai]
 gi|16128887|ref|NP_415440.1| conserved protein, DUF218 superfamily [Escherichia coli str. K-12
           substr. MG1655]
 gi|89107770|ref|AP_001550.1| conserved inner membrane protein [Escherichia coli str. K-12
           substr. W3110]
 gi|91210021|ref|YP_540007.1| hypothetical protein UTI89_C0991 [Escherichia coli UTI89]
 gi|117623138|ref|YP_852051.1| hypothetical protein APECO1_32 [Escherichia coli APEC O1]
 gi|157155611|ref|YP_001462138.1| hypothetical protein EcE24377A_1017 [Escherichia coli E24377A]
 gi|157160441|ref|YP_001457759.1| hypothetical protein EcHS_A1027 [Escherichia coli HS]
 gi|168751183|ref|ZP_02776205.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757012|ref|ZP_02782019.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762943|ref|ZP_02787950.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|168769915|ref|ZP_02794922.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776227|ref|ZP_02801234.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|168784117|ref|ZP_02809124.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|168787349|ref|ZP_02812356.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|168801395|ref|ZP_02826402.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|170020678|ref|YP_001725632.1| hypothetical protein EcolC_2676 [Escherichia coli ATCC 8739]
 gi|170080578|ref|YP_001729898.1| inner membrane protein [Escherichia coli str. K-12 substr. DH10B]
 gi|170681104|ref|YP_001744250.1| hypothetical protein EcSMS35_2201 [Escherichia coli SMS-3-5]
 gi|188494945|ref|ZP_03002215.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|194438715|ref|ZP_03070802.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|208808261|ref|ZP_03250598.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816346|ref|ZP_03257525.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208822106|ref|ZP_03262425.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209397397|ref|YP_002269592.1| hypothetical protein ECH74115_1080 [Escherichia coli O157:H7 str.
           EC4115]
 gi|217325067|ref|ZP_03441151.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|218704347|ref|YP_002411866.1| hypothetical protein ECUMN_1113 [Escherichia coli UMN026]
 gi|237707092|ref|ZP_04537573.1| YcbC [Escherichia sp. 3_2_53FAA]
 gi|238900178|ref|YP_002925974.1| conserved inner membrane protein [Escherichia coli BW2952]
 gi|253774051|ref|YP_003036882.1| hypothetical protein ECBD_2675 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161034|ref|YP_003044142.1| hypothetical protein ECB_00924 [Escherichia coli B str. REL606]
 gi|254792119|ref|YP_003076956.1| hypothetical protein ECSP_1024 [Escherichia coli O157:H7 str.
           TW14359]
 gi|256023379|ref|ZP_05437244.1| hypothetical protein E4_08394 [Escherichia sp. 4_1_40B]
 gi|261227423|ref|ZP_05941704.1| conserved inner membrane protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|291281921|ref|YP_003498739.1| hypothetical protein G2583_1155 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293404225|ref|ZP_06648219.1| hypothetical protein ECGG_02613 [Escherichia coli FVEC1412]
 gi|297516352|ref|ZP_06934738.1| hypothetical protein EcolOP_01862 [Escherichia coli OP50]
 gi|298380005|ref|ZP_06989610.1| hypothetical protein ECFG_02808 [Escherichia coli FVEC1302]
 gi|300901650|ref|ZP_07119710.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300929615|ref|ZP_07145077.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|300937735|ref|ZP_07152536.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|300949717|ref|ZP_07163696.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300955432|ref|ZP_07167806.1| hypothetical protein HMPREF9547_01317 [Escherichia coli MS 175-1]
 gi|301022414|ref|ZP_07186297.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|301643440|ref|ZP_07243488.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|306812627|ref|ZP_07446820.1| hypothetical protein ECNC101_11962 [Escherichia coli NC101]
 gi|307137549|ref|ZP_07496905.1| hypothetical protein EcolH7_05381 [Escherichia coli H736]
 gi|312971048|ref|ZP_07785227.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331641446|ref|ZP_08342581.1| putative KicA protein [Escherichia coli H736]
 gi|331662333|ref|ZP_08363256.1| putative KicA protein [Escherichia coli TA143]
 gi|77416806|sp|P0AB02|YCBC_ECO57 RecName: Full=Uncharacterized protein ycbC
 gi|77416807|sp|P0AB01|YCBC_ECOLI RecName: Full=Uncharacterized protein ycbC
 gi|12514089|gb|AAG55405.1|AE005281_8 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|1787150|gb|AAC74006.1| conserved protein, DUF218 superfamily [Escherichia coli str. K-12
           substr. MG1655]
 gi|4062491|dbj|BAA35666.1| conserved inner membrane protein [Escherichia coli str. K12 substr.
           W3110]
 gi|13360462|dbj|BAB34426.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|91071595|gb|ABE06476.1| probable membrane protein [Escherichia coli UTI89]
 gi|115512262|gb|ABJ00337.1| YcbC [Escherichia coli APEC O1]
 gi|157066121|gb|ABV05376.1| conserved hypothetical protein [Escherichia coli HS]
 gi|157077641|gb|ABV17349.1| conserved hypothetical protein [Escherichia coli E24377A]
 gi|169755606|gb|ACA78305.1| protein of unknown function DUF218 [Escherichia coli ATCC 8739]
 gi|169888413|gb|ACB02120.1| conserved inner membrane protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|170518822|gb|ACB17000.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
 gi|187768343|gb|EDU32187.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014720|gb|EDU52842.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|188490144|gb|EDU65247.1| conserved hypothetical protein [Escherichia coli 53638]
 gi|188998655|gb|EDU67641.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355905|gb|EDU74324.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189361104|gb|EDU79523.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189366790|gb|EDU85206.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372700|gb|EDU91116.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|189376425|gb|EDU94841.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|194422347|gb|EDX38347.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|208728062|gb|EDZ77663.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4206]
 gi|208732994|gb|EDZ81682.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4045]
 gi|208737591|gb|EDZ85274.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4042]
 gi|209158797|gb|ACI36230.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4115]
 gi|209774788|gb|ACI85706.1| hypothetical protein ECs1003 [Escherichia coli]
 gi|209774790|gb|ACI85707.1| hypothetical protein ECs1003 [Escherichia coli]
 gi|209774792|gb|ACI85708.1| hypothetical protein ECs1003 [Escherichia coli]
 gi|209774794|gb|ACI85709.1| hypothetical protein ECs1003 [Escherichia coli]
 gi|209774796|gb|ACI85710.1| hypothetical protein ECs1003 [Escherichia coli]
 gi|217321288|gb|EEC29712.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           TW14588]
 gi|218431444|emb|CAR12322.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli UMN026]
 gi|222032651|emb|CAP75390.1| Uncharacterized protein ycbC [Escherichia coli LF82]
 gi|226898302|gb|EEH84561.1| YcbC [Escherichia sp. 3_2_53FAA]
 gi|238860178|gb|ACR62176.1| conserved inner membrane protein [Escherichia coli BW2952]
 gi|242376735|emb|CAQ31448.1| conserved inner membrane protein [Escherichia coli BL21(DE3)]
 gi|253325095|gb|ACT29697.1| protein of unknown function DUF218 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972935|gb|ACT38606.1| conserved inner membrane protein [Escherichia coli B str. REL606]
 gi|253977149|gb|ACT42819.1| conserved inner membrane protein [Escherichia coli BL21(DE3)]
 gi|254591519|gb|ACT70880.1| conserved inner membrane protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|260449934|gb|ACX40356.1| protein of unknown function DUF218 [Escherichia coli DH1]
 gi|281178051|dbj|BAI54381.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|284920771|emb|CBG33834.1| putative membrane protein [Escherichia coli 042]
 gi|290761794|gb|ADD55755.1| hypothetical protein G2583_1155 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291428811|gb|EFF01836.1| hypothetical protein ECGG_02613 [Escherichia coli FVEC1412]
 gi|298279703|gb|EFI21211.1| hypothetical protein ECFG_02808 [Escherichia coli FVEC1302]
 gi|299881255|gb|EFI89466.1| conserved hypothetical protein [Escherichia coli MS 196-1]
 gi|300317655|gb|EFJ67439.1| hypothetical protein HMPREF9547_01317 [Escherichia coli MS 175-1]
 gi|300354943|gb|EFJ70813.1| conserved hypothetical protein [Escherichia coli MS 198-1]
 gi|300450898|gb|EFK14518.1| conserved hypothetical protein [Escherichia coli MS 116-1]
 gi|300457242|gb|EFK20735.1| conserved hypothetical protein [Escherichia coli MS 21-1]
 gi|300462452|gb|EFK25945.1| conserved hypothetical protein [Escherichia coli MS 187-1]
 gi|301078154|gb|EFK92960.1| conserved hypothetical protein [Escherichia coli MS 146-1]
 gi|305853390|gb|EFM53829.1| hypothetical protein ECNC101_11962 [Escherichia coli NC101]
 gi|307627653|gb|ADN71957.1| hypothetical protein UM146_12950 [Escherichia coli UM146]
 gi|309701196|emb|CBJ00496.1| putative membrane protein [Escherichia coli ETEC H10407]
 gi|310336809|gb|EFQ01976.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|312945440|gb|ADR26267.1| hypothetical protein NRG857_04195 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315135568|dbj|BAJ42727.1| hypothetical protein ECDH1ME8569_0871 [Escherichia coli DH1]
 gi|315287553|gb|EFU46959.1| conserved hypothetical protein [Escherichia coli MS 110-3]
 gi|315619114|gb|EFU99694.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|320192594|gb|EFW67235.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Escherichia coli O157:H7 str.
           EC1212]
 gi|320637788|gb|EFX07580.1| hypothetical protein ECO5101_23325 [Escherichia coli O157:H7 str.
           G5101]
 gi|320642913|gb|EFX12114.1| hypothetical protein ECO9389_03076 [Escherichia coli O157:H- str.
           493-89]
 gi|320648370|gb|EFX17025.1| hypothetical protein ECO2687_19186 [Escherichia coli O157:H- str. H
           2687]
 gi|320653686|gb|EFX21760.1| hypothetical protein ECO7815_15513 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659831|gb|EFX27387.1| hypothetical protein ECO5905_25023 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664300|gb|EFX31451.1| hypothetical protein ECOSU61_01678 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323190740|gb|EFZ76009.1| hypothetical protein ECRN5871_0979 [Escherichia coli RN587/1]
 gi|323938026|gb|EGB34288.1| hypothetical protein ERCG_00752 [Escherichia coli E1520]
 gi|323942836|gb|EGB39001.1| hypothetical protein ERDG_00704 [Escherichia coli E482]
 gi|323953372|gb|EGB49238.1| hypothetical protein ERKG_00257 [Escherichia coli H252]
 gi|323958225|gb|EGB53934.1| hypothetical protein ERLG_00664 [Escherichia coli H263]
 gi|323962912|gb|EGB58486.1| hypothetical protein ERGG_00660 [Escherichia coli H489]
 gi|323973205|gb|EGB68397.1| hypothetical protein ERHG_00864 [Escherichia coli TA007]
 gi|326338185|gb|EGD62014.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Escherichia coli O157:H7 str.
           1125]
 gi|326346162|gb|EGD69900.1| Membrane Protein Functionally coupled to the MukBEF Chromosome
           Partitioning Mechanism [Escherichia coli O157:H7 str.
           1044]
 gi|331038244|gb|EGI10464.1| putative KicA protein [Escherichia coli H736]
 gi|331060755|gb|EGI32719.1| putative KicA protein [Escherichia coli TA143]
          Length = 259

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 100/225 (44%), Gaps = 28/225 (12%)

Query: 32  LFSFIGWGIIPTILLKHLQFSYQRPLLS--PQWKKDGNI--IVLLGNGTTIIPTIPAIRI 87
           +F  IGW  +  + L+ +     RP+ S  P W     +  IV+LG G T  P     + 
Sbjct: 41  IFISIGWLALLLLSLQPVADRLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNP-----QW 95

Query: 88  EPSFQ----SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGV 143
            PS      S  R+ E +RL++     +    +I +GG  + + ++ + V        GV
Sbjct: 96  APSSNLINNSLPRLNEGIRLWR----ENPGSKLIFTGGVAKTNTVSTAEVGARVAQSLGV 151

Query: 144 ERDDIKLETQSLDTFQNAQFSSSMIKNMQGK-NIILVSSAYHLKRSQLYFQHFGINTKAS 202
            R+ I     +LD  ++ +  ++ +K   G    +LV+SA HL R+ ++FQ  G+N   +
Sbjct: 152 PREQII----TLDLPKDTEEEAAAVKQAIGDAPFLLVTSASHLPRAMIFFQQEGLNPLPA 207

Query: 203 CSDY------LNAYYSIIPLSANFYLTELALKEYIGILIAYYRGN 241
            ++       LN +   IP       ++    E +G +  + +G+
Sbjct: 208 PANQLAIDSPLNPWERAIPSPVWLMHSDRVGYETLGRIWQWLKGS 252


>gi|196039056|ref|ZP_03106363.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|196030201|gb|EDX68801.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
          Length = 192

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 66/128 (51%), Gaps = 19/128 (14%)

Query: 65  DGNIIVLLG---NGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGG 121
           D + I++LG   NGT           +PS+    RI +     KS ++       I+SGG
Sbjct: 39  DADYIIVLGSKVNGT-----------KPSYSLQYRIDKAAEYLKSHEK----AIAIVSGG 83

Query: 122 DPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSS 181
             +   ++E++   N+L++  +  D I +E +S+ T +N +FS  +I +   K +I V++
Sbjct: 84  KGKGEDISEALAMKNELMKLNIAEDRIIMEDKSMSTDENIKFSKPLIPDNMKKGMI-VTN 142

Query: 182 AYHLKRSQ 189
            +H+ R++
Sbjct: 143 DFHMFRAK 150


>gi|153010699|ref|YP_001371913.1| hypothetical protein Oant_3378 [Ochrobactrum anthropi ATCC 49188]
 gi|151562587|gb|ABS16084.1| protein of unknown function DUF218 [Ochrobactrum anth