RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|255764508|ref|YP_003065363.2| hypothetical protein
CLIBASIA_04245 [Candidatus Liberibacter asiaticus str. psy62]
         (242 letters)



>gnl|CDD|99750 cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of
           mainly bacterial proteins, with a few members found in
           fungi, plants, and archaea. Escherichia coli YdcF has
           been shown to bind S-adenosyl-L-methionine (AdoMet), but
           a biochemical function has not been idenitified. The
           family also includes Escherichia coli sanA and
           Salmonella typhimurium sfiX,  which are involved in
           vancomycin resistance; sfiX may also be involved in
           murein synthesis..
          Length = 150

 Score =  110 bits (278), Expect = 3e-25
 Identities = 49/167 (29%), Positives = 86/167 (51%), Gaps = 21/167 (12%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           IV+LG G             PS     R+     LY++         +I+SGG     G 
Sbjct: 3   IVVLGGGVN--------GDGPSPILAERLDAAAELYRAGP----APKLIVSGGQGPGEGY 50

Query: 129 AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS 188
           +E+      L+E GV  + I LE +S +T++NA+FS+ +++    ++++LV+SAYH+ R+
Sbjct: 51  SEAEAMARYLIELGVPAEAILLEDRSTNTYENARFSAELLRERGIRSVLLVTSAYHMPRA 110

Query: 189 QLYFQHFGINTK--ASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
            L F+  G++ +   + +D+         LS+   L  LAL+EY+G+
Sbjct: 111 LLIFRKAGLDVEVVPAPTDFY-------SLSSALRLLRLALREYLGL 150


>gnl|CDD|145708 pfam02698, DUF218, DUF218 domain.  This large family of proteins
           contains several highly conserved charged amino acids,
           suggesting this may be an enzymatic domain (Bateman A
           pers. obs). The family includes SanA, which is involved
           in Vancomycin resistance. This protein may be involved
           in murein synthesis.
          Length = 148

 Score =  110 bits (276), Expect = 5e-25
 Identities = 47/165 (28%), Positives = 82/165 (49%), Gaps = 21/165 (12%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           IV+LG G+                  +R+     LY++         II+SGG      +
Sbjct: 5   IVVLGGGSPA--------------LAARLDAAAELYRAGPA----PRIIVSGGAGGGEPV 46

Query: 129 AESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRS 188
           +E+ V    L+E GV  + I LE QS +T++NA+FS+ +++    + ++LV+SA+H++R+
Sbjct: 47  SEAEVMRRYLVELGVPAEAILLEPQSRNTYENARFSAELLRERGLRRVLLVTSAFHMRRA 106

Query: 189 QLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGI 233
            L F+  G       +DY      + P +    L   AL+EY+G+
Sbjct: 107 LLLFRRAGPEVVPVPADYP---TPLPPRALWLRLARAALREYLGL 148


>gnl|CDD|31623 COG1434, COG1434, Uncharacterized conserved protein [Function
           unknown].
          Length = 223

 Score = 82.9 bits (204), Expect = 7e-17
 Identities = 57/246 (23%), Positives = 100/246 (40%), Gaps = 31/246 (12%)

Query: 1   MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60
            LL  +  ++    L  + +  +  +   ++L       I+   LL+ L+      LL P
Sbjct: 4   TLLLLLVGLLLLSSLRFRKLIVLRILLLLIILL-LAALLILGGFLLRPLEARSAAALLLP 62

Query: 61  QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120
                 + IV+LG G                    R+ E  RL K          I+   
Sbjct: 63  G---LADAIVVLGGG------------SRLTDHLIRLLEAARLAK----------ILPIS 97

Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180
           G  +  G+ E       L   GV  + I LE +S +T +NA+FS  +++    +++ILV+
Sbjct: 98  GVLESGGVIEIQATRRYLENLGVPAERIILEDRSRNTVENARFSRRLLRTQGPESVILVT 157

Query: 181 SAYHLKRSQLYFQHFGIN-----TKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILI 235
           S YH+ R+ L F+  GI+           + L    S++ L+     +  AL+E +G+L 
Sbjct: 158 SPYHMPRALLLFRKLGISVIPYPVGFLDRNILRLPLSLLALAEALLKSLRALREALGLLG 217

Query: 236 AYYRGN 241
              +G 
Sbjct: 218 YGLKGR 223


>gnl|CDD|30395 COG0046, PurL, Phosphoribosylformylglycinamidine (FGAM) synthase,
           synthetase domain [Nucleotide transport and metabolism].
          Length = 743

 Score = 30.2 bits (68), Expect = 0.60
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 55  RPLLSPQWKKDGNIIVLLGNGTT 77
           R +L+P+ KK G ++ LLG    
Sbjct: 573 RKVLTPELKKAGLLLYLLGETKD 595


>gnl|CDD|36532 KOG1318, KOG1318, KOG1318, Helix loop helix transcription factor EB
           [Transcription].
          Length = 411

 Score = 28.5 bits (63), Expect = 1.8
 Identities = 15/65 (23%), Positives = 21/65 (32%), Gaps = 4/65 (6%)

Query: 138 LLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGI 197
              S  E DD+    ++L     AQ   S   N Q  N +  S A       +Y      
Sbjct: 141 GFSSLGEMDDVISNIETLSASFPAQSVGSPAGNGQTANTLTSSGA----SLNVYPSEGQF 196

Query: 198 NTKAS 202
           N   +
Sbjct: 197 NVPMT 201


>gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like
           transporters are involved in drug, peptide, and lipid
           export.  They belong to the subfamily C of the
           ATP-binding cassette (ABC) superfamily of transport
           proteins.  The ABCC subfamily contains transporters with
           a diverse functional spectrum that includes ion
           transport, cell surface receptor, and toxin secretion
           activities.  The MRP-like family, simlar to all ABC
           proteins, have a common four-domain core structure
           constituted by two membrane-spanning domains, each
           composed of six transmembrane (TM) helices, and two
           nucleotide-binding domains (NBD).  ABC transporters are
           a subset of nucleotide hydrolases that contain a
           signature motif, Q-loop, and H-loop/switch region, in
           addition to, the Walker A motif/P-loop and Walker B
           motif commonly found in a number of ATP- and GTP-binding
           and hydrolyzing proteins..
          Length = 171

 Score = 27.7 bits (62), Expect = 3.3
 Identities = 15/67 (22%), Positives = 32/67 (47%), Gaps = 13/67 (19%)

Query: 117 IISGGDPQKHGLAESIVYNNKLL---ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQG 173
           I+SGG  Q+  +A +++ +  +L   E+          T +LD    A    ++    +G
Sbjct: 96  ILSGGQRQRIAIARALLRDPPILILDEA----------TSALDPETEALILEALRALAKG 145

Query: 174 KNIILVS 180
           K +I+++
Sbjct: 146 KTVIVIA 152


>gnl|CDD|39429 KOG4228, KOG4228, KOG4228, Protein tyrosine phosphatase [Signal
           transduction mechanisms].
          Length = 1087

 Score = 27.3 bits (60), Expect = 3.9
 Identities = 23/75 (30%), Positives = 28/75 (37%), Gaps = 6/75 (8%)

Query: 149 KLETQSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLN 208
           K E +SL   Q     S+  +N Q KN      AY   R  L      I      SDY+N
Sbjct: 544 KQEYESLPEGQFTWEHSNKKENKQ-KNRYENILAYDHSRVILPP----IEGDP-NSDYIN 597

Query: 209 AYYSIIPLSANFYLT 223
           A Y       N Y+ 
Sbjct: 598 ANYIDGYKEPNAYIA 612


>gnl|CDD|153093 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: A sub-family of 
           Phospholipase A2, similar to bee venom PLA2. PLA2 is a
           super-family of secretory and cytosolic enzymes; the
           latter are either Ca dependent or Ca independent.
           Enzymatically active PLA2 cleaves the sn-2 position of
           the glycerol backbone of phospholipids; secreted PLA2s
           have also been found to specifically bind to a variety
           of soluble and membrane proteins in mammals, including
           receptors. As a toxin, PLA2 is a potent presynaptic
           neurotoxin which blocks nerve terminals by binding to
           the nerve membrane and hydrolyzing stable membrane
           lipids. The products of the hydrolysis cannot form
           bilayers leading to a change in membrane conformation
           and ultimately to a block in the release of
           neurotransmitters. PLA2 may form dimers or oligomers.
           Bee venom PLA2 has fewer conserved disulfide bridges
           than most canonical PLA2s.
          Length = 97

 Score = 27.3 bits (61), Expect = 4.1
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 93  SYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           +YS +       K C++H  HC  IIS G+  K+GL
Sbjct: 17  NYSDLGAFRETDKCCREHD-HCPDIISAGE-YKYGL 50


>gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain
           an N-terminal double-glycine peptidase domain [Defense
           mechanisms].
          Length = 709

 Score = 26.7 bits (59), Expect = 5.9
 Identities = 16/66 (24%), Positives = 34/66 (51%), Gaps = 13/66 (19%)

Query: 118 ISGGDPQKHGLAESIVYNNKLL---ESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGK 174
           +SGG  Q+  LA +++   K+L   E+          T +LD    A    ++++ +QG+
Sbjct: 610 LSGGQRQRLALARALLSKPKILLLDEA----------TSALDPETEAIILQNLLQILQGR 659

Query: 175 NIILVS 180
            +I+++
Sbjct: 660 TVIIIA 665


>gnl|CDD|32772 COG2949, SanA, Uncharacterized membrane protein [Function unknown].
          Length = 235

 Score = 26.0 bits (57), Expect = 9.9
 Identities = 22/119 (18%), Positives = 44/119 (36%), Gaps = 14/119 (11%)

Query: 95  SRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLET-- 152
            RI   + LYK+ K        ++  GD       E       L+ +GV   +I L+   
Sbjct: 80  YRIDAAIALYKAGK-----VNYLLLSGDNATVSYNEPRTMRKDLIAAGVPAKNIFLDYAG 134

Query: 153 -QSLDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQHFGINTKASCSDYLNAY 210
            ++LD+   A+      K     +  +++  +H +R+    +  GI+     +      
Sbjct: 135 FRTLDSVVRAR------KVFGTNDFTIITQRFHCERALFIARQMGIDAICFAAPDPEGR 187


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.326    0.140    0.427 

Gapped
Lambda     K      H
   0.267   0.0636    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 3,045,015
Number of extensions: 162147
Number of successful extensions: 712
Number of sequences better than 10.0: 1
Number of HSP's gapped: 706
Number of HSP's successfully gapped: 39
Length of query: 242
Length of database: 6,263,737
Length adjustment: 91
Effective length of query: 151
Effective length of database: 4,297,318
Effective search space: 648895018
Effective search space used: 648895018
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 56 (25.5 bits)