BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764508|ref|YP_003065363.2| hypothetical protein CLIBASIA_04245 [Candidatus Liberibacter asiaticus str. psy62] (242 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764508|ref|YP_003065363.2| hypothetical protein CLIBASIA_04245 [Candidatus Liberibacter asiaticus str. psy62] Length = 242 Score = 498 bits (1281), Expect = e-143, Method: Compositional matrix adjust. Identities = 242/242 (100%), Positives = 242/242 (100%) Query: 1 MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60 MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP Sbjct: 1 MLLSWIFLIVSYWHLLCQSIRKIFFMSCFMLLFSFIGWGIIPTILLKHLQFSYQRPLLSP 60 Query: 61 QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120 QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG Sbjct: 61 QWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISG 120 Query: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS Sbjct: 121 GDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNIILVS 180 Query: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG Sbjct: 181 SAYHLKRSQLYFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYIGILIAYYRG 240 Query: 241 NR 242 NR Sbjct: 241 NR 242 >gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 26.9 bits (58), Expect = 0.29, Method: Compositional matrix adjust. Identities = 19/78 (24%), Positives = 39/78 (50%), Gaps = 3/78 (3%) Query: 116 IIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKN 175 I ISG H +++ I+ + + I + ++L+T NAQ +S+ + + Sbjct: 65 IFISGV---HHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFHH 121 Query: 176 IILVSSAYHLKRSQLYFQ 193 +++V+ YH+ R+ L Q Sbjct: 122 VLIVTHDYHMPRTFLELQ 139 >gi|254780607|ref|YP_003065020.1| hypothetical protein CLIBASIA_02470 [Candidatus Liberibacter asiaticus str. psy62] Length = 131 Score = 25.8 bits (55), Expect = 0.76, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Query: 113 HCTIIISGGDPQKHGLAESIVYNNKLLESGVERDDIKLET 152 C SG + G A+S++Y N L +ER++ KLE+ Sbjct: 80 ECAFAASGAE---EGTAQSMIYANCLQGHAIERNE-KLES 115 >gi|254780363|ref|YP_003064776.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 25.4 bits (54), Expect = 0.85, Method: Compositional matrix adjust. Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 66 GNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQ 109 GN + L GT I P + IR +++ + + T ++C+Q Sbjct: 115 GNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVT----QTCRQ 154 >gi|254780789|ref|YP_003065202.1| hypothetical protein CLIBASIA_03400 [Candidatus Liberibacter asiaticus str. psy62] Length = 192 Score = 23.5 bits (49), Expect = 3.2, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 110 HSMHCTIIISGGDPQK 125 H + C I++S GD QK Sbjct: 115 HVVACEIVLSSGDKQK 130 >gi|254780465|ref|YP_003064878.1| threonine synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 469 Score = 23.1 bits (48), Expect = 4.1, Method: Compositional matrix adjust. Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Query: 137 KLLESGVERDDIKLETQS--LDTFQNAQFSSSMIKNMQGKNIILVSSAYHLKRSQLYFQ 193 ++ + G+ R +I +ET S +D + F ++ + G+N +LV A++ ++ YF+ Sbjct: 288 RMFDMGMYRPEIVMETTSPAMDIQIPSNFER-LLFEISGRNSLLVKEAFYSLENKKYFR 345 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.140 0.427 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 160,446 Number of Sequences: 1233 Number of extensions: 6788 Number of successful extensions: 32 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 22 Number of HSP's gapped (non-prelim): 13 length of query: 242 length of database: 328,796 effective HSP length: 71 effective length of query: 171 effective length of database: 241,253 effective search space: 41254263 effective search space used: 41254263 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 37 (18.9 bits)