HHsearch alignment for GI: 255764509 and conserved domain: COG1257

>COG1257 HMG1 Hydroxymethylglutaryl-CoA reductase [Lipid metabolism].
Probab=100.00  E-value=0  Score=674.22  Aligned_cols=320  Identities=30%  Similarity=0.421  Sum_probs=298.6

Q ss_pred             CCCCCEEEEEEEEEEECCEEECCCCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEEEEEEEEECCHH
Q ss_conf             97641037861127603756765136774788653034538999989999999559988999967922412599858977
Q gi|255764509|r    1 MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAE   80 (351)
Q Consensus         1 m~en~IG~~~lPlGia~~l~InG~~a~~~y~VPMATeE~SvVAAas~gak~~~~~sGG~~t~~~~~~m~r~~~f~~~~~~   80 (351)
T Consensus        61 ~iENvIG~~~lPlGia~~l~InG~----~Y~iPmATtEgalVAs~~rgaK~-i~~~GG~~~~~~~~~Mtr~~v~~~~~~~  135 (436)
T COG1257          61 NIENVIGTVQLPLGIAGPLLINGK----EYYIPMATTEGALVASASRGAKL-ITASGGATARVTEDGMTRQPVFRFVSLP  135 (436)
T ss_pred             HHHHHHCEEEEECCCCCCEEECCC----EEEEEEECCCHHHHHHHHHHHHH-HHHCCCCEEEEECCCCCCCCEEECCCHH
T ss_conf             655532236620133355488583----46876621513799998747899-9856992799834653355279437616


Q ss_pred             HHHHHHHHHH--HHHHHHHHHHHHCCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHC-CCCE
Q ss_conf             8999997617--509999999730157804788887873886999999973200672158899999999999867-9814
Q gi|255764509|r   81 MALTALQEIT--LKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQW-SYLH  157 (351)
Q Consensus        81 ~a~~~~~~i~--~~~~~i~~~a~~~sr~ggl~~i~~~~~g~~v~l~~~~dt~DAMGaNmvnt~~E~v~~~i~~~~-~~~~  157 (351)
T Consensus       136 ~a~~~~~w~~~~e~~e~~k~~~~s~~~~~kl~~i~~~~~g~~l~l~~~~dT~DAMGmNMvn~~~E~v~~~i~~~~~~~~~  215 (436)
T COG1257         136 EAAKFAIWVKKKEIIELAKEAAPSTGRGGKLIHIEPFVEGNLLYLRFYVDTGDAMGMNMVNIATEAVAPFIEEETFGGAV  215 (436)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             77888998502889999997522268764563456302475799999996340133478999999999999875267836


Q ss_pred             EEEECCCCCHHHHHHHHHHCCCCCCEEEEEEEECHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCHHHCCCCCHHHHHHH
Q ss_conf             89734774312333554310377207999987569999757389999999887866565542200220216216677888
Q gi|255764509|r  158 YGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA  237 (351)
Q Consensus       158 ~~~ilsN~~tdkk~s~~n~~~~rG~~V~Ae~~i~~~~~~~~l~~~~e~~~~~~~~~~~~a~~~~~~a~t~NkgimNgI~A  237 (351)
T Consensus       216 ~~~issN~ctdkk~~a~~~~~grgk~v~ae~~~~~evv~~il~at~~a~~d~------------~rakt~~ggamnG~~g  283 (436)
T COG1257         216 LLAISSNLCTDKKPAAINSIEGRGKTVVAEATIPEEVVKKILKATPEAIVDV------------NRAKTLNGGAMNGIDG  283 (436)
T ss_pred             EEEEECCCCCCCCHHHEEEEEECCCEEECCCCCHHHHHHHHHHCCHHHHHHH------------HHHHHHHHHHHHHHHH
T ss_conf             9998245302445103478980363663344561999999984199877527------------8887633566510788


Q ss_pred             HHHHCCCCHHHHHHHCCCE-----------EEEEE-ECCEEEEEEEECCEEEEEECCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             8876276378888640320-----------25687-28908999980564677306644688899999860868778877
Q gi|255764509|r  238 YYLATGQDAANIVEGSQGL-----------TYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG  305 (351)
Q Consensus       238 v~lATGnD~a~v~a~~~a~-----------t~~~~-~~~~L~g~i~lPsl~vGtVGG~t~lp~~~~~l~ilg~~~~~~~~  305 (351)
T Consensus       284 fna~~aN~~~Ai~~a~gqdaA~~~e~s~~~t~~~~~~~~~L~~svtlP~~~vgt~Gggt~lp~q~~~l~ilGV~------  357 (436)
T COG1257         284 FNAHTANDVRAIEAATGQDAAQVGEYSPLITWMEDQRDGDLYGSVTLPSLVVGTGGGGTVLPTQREALKILGVA------  357 (436)
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHCCCCCCEEEEEECCCCCEEEEEEECCCEEEEECCCCCCHHHHHHHHHHCCC------
T ss_conf             99887559999998707437751556774489996379807999980562367514887274389999982999------


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH-CC
Q ss_conf             69889999999999888999999880788689999872-60
Q gi|255764509|r  306 DNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRL-ER  345 (351)
Q Consensus       306 ~~A~~La~iiAavgLAqnlaal~Al~t~G~iq~gHmkl-~R  345 (351)
T Consensus       358 -ga~e~~~v~~~vgla~N~~alaalva~g-i~aGemsL~aa  396 (436)
T COG1257         358 -GAGELAGVLAAVGLAQNAAALAALVAEG-ILAGEMSLLAA  396 (436)
T ss_pred             -CCCCCHHHHCCCCHHHHHHHHHHHHHHH-HHHHHHHHHHH
T ss_conf             -8643011220467223299999999989-87537899999