HHSEARCH alignment of GI: 255764509 and SCOP domain: d1dqaa4

Alignment
>d1dqaa4 d.179.1.1 (A:462-586,A:704-870) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
Probab=100.00  E-value=0  Score=524.88  Aligned_cols=223  Identities=35%  Similarity=0.538  Sum_probs=206.1

Q ss_pred             CCCCCEEEEEEEEEEECCEEECCCCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCEEEEEEEEECCHH
Q ss_conf             97641037861127603756765136774788653034538999989999999559988999967922412599858977
Q gi|255764509|r    1 MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAE   80 (351)
Q Consensus         1 m~en~IG~~~lPlGia~~l~InG~~a~~~y~VPMATeE~SvVAAas~gak~~~~~sGG~~t~~~~~~m~r~~~f~~~~~~   80 (351)
                      ++||+||+++||+|||+||+|||+    +|+|||||||||||||+|||||+ ++.+|||++.+.++              
T Consensus        65 ~~EN~IG~~~lPlGvAgpl~InG~----~y~VPMATeEgslVAS~nrGaK~-i~~~GG~~~~v~~d--------------  125 (292)
T d1dqaa4          65 CCENVIGYMPIPVGVAGPLCLDEK----EFQVPMATTEGCLVASTNRGCRA-IGLGGGASSRVLAD--------------  125 (292)
T ss_dssp             TCSSEEEEEEEEEEEEEEEEETTE----EEEEEEECSCTTHHHHHHHHHHH-HHHTTCBEEEEEEE--------------
T ss_pred             CCCCEEEEEECCCEEECCEEECCE----EEEEEEEECHHHHHHHHHHHHHH-HHHCCCCEEEEEHH--------------
T ss_conf             852014667445046506798890----78986542140799876579899-98539988998021--------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             89999976175099999997301578047888878738869999999732006721588999999999998679814897
Q gi|255764509|r   81 MALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS  160 (351)
Q Consensus        81 ~a~~~~~~i~~~~~~i~~~a~~~sr~ggl~~i~~~~~g~~v~l~~~~dt~DAMGaNmvnt~~E~v~~~i~~~~~~~~~~~  160 (351)
                                                                                                      
T Consensus       126 --------------------------------------------------------------------------------  125 (292)
T d1dqaa4         126 --------------------------------------------------------------------------------  125 (292)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
T ss_conf             --------------------------------------------------------------------------------


Q ss_pred             ECCCCCHHHHHHHHHHCCCCCCEEEEEEEECHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCHHHCCCCCHHHHHHHHHH
Q ss_conf             34774312333554310377207999987569999757389999999887866565542200220216216677888887
Q gi|255764509|r  161 VSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL  240 (351)
Q Consensus       161 ilsN~~tdkk~s~~n~~~~rG~~V~Ae~~i~~~~~~~~l~~~~e~~~~~~~~~~~~a~~~~~~a~t~NkgimNgI~Av~l  240 (351)
                                           +.+.++..+|.++++++++++++++.+.+..++.++++.++.+.+||||+||||+||||
T Consensus       126 ---------------------~~~~a~~~~~~~vv~~~Lk~~~e~l~~~~~~~nl~gsa~ag~~~g~N~~i~NgI~Av~l  184 (292)
T d1dqaa4         126 ---------------------KSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYI  184 (292)
T ss_dssp             ---------------------EEEEEEEEECHHHHHHTTSSCHHHHHHHHHHHHTHHHHHTTCSSEESSSHHHHHHHHHH
T ss_pred             ---------------------HHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             ---------------------11122115708999999807999999998778899999974111210567657788776


Q ss_pred             HCCCCHHHHHHHCCCEEEEE---EECCEEEEEEEECCEEEEEECCCCCCHHHHHHHHHHCCCCCCC--CCCCHHHHHHHH
Q ss_conf             62763788886403202568---7289089999805646773066446888999998608687788--776988999999
Q gi|255764509|r  241 ATGQDAANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAAIC  315 (351)
Q Consensus       241 ATGnD~a~v~a~~~a~t~~~---~~~~~L~g~i~lPsl~vGtVGG~t~lp~~~~~l~ilg~~~~~~--~~~~A~~La~ii  315 (351)
                      |||||||++++++|+|+..+   .++++|++++|||||+||||||+|+||+||+||+||||+++++  +.+||++||+||
T Consensus       185 ATGqD~a~v~~ss~a~t~~~~~~~~~~~L~~s~tlPsl~VGtVGGgT~l~~q~~~L~iLgv~g~~~~~p~~nA~~LA~Ii  264 (292)
T d1dqaa4         185 ACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIV  264 (292)
T ss_dssp             HTTCCGGGHHHHTCEEEEEEEETTTTCEEEEEEEEEEECCCSBSGGGGSHHHHHHHHHHTCCSCCSSSTTHHHHHHHHHH
T ss_pred             HCCCHHHHHHHHHCCEEEEEEEECCCCCEEEEEEECCEEEEECCCCCCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH
T ss_conf             63542999987404137888997189977999982240566415766580599999984877767888760799999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHC
Q ss_conf             99998889999998807886899998726
Q gi|255764509|r  316 AATVLCGELSLLAAQTNPGELMEAHLRLE  344 (351)
Q Consensus       316 AavgLAqnlaal~Al~t~G~iq~gHmkl~  344 (351)
                      ||+|||||||+|+||++.| ||+|||||+
T Consensus       265 aa~~LA~els~l~ALat~~-i~~~HMk~n  292 (292)
T d1dqaa4         265 CGTVMAGELSLMAALAAGH-LVKSHMIHN  292 (292)
T ss_dssp             HHHHHHHHHHHHHHHHHTC-HHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCC-HHHHHHCCC
T ss_conf             9999999999999987471-788761129


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Substrate-binding domain of HMG-CoA reductase
superfamily: Substrate-binding domain of HMG-CoA reductase
family: Substrate-binding domain of HMG-CoA reductase
domain: Substrate-binding domain of HMG-CoA reductase
species: Human (Homo sapiens) [TaxId: 9606]