HHSEARCH alignment of GI: 255764509 and SCOP domain: d1r31a2

Alignment
>d1r31a2 d.179.1.1 (A:3-110,A:221-378) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
Probab=90.67  E-value=0.0014  Score=38.84  Aligned_cols=86  Identities=13%  Similarity=0.004  Sum_probs=50.3

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCCCEEEEEEEECHHH--HHHHHCCCHHHHHH
Q ss_conf             0067215889999999999986798148973477431233355431037720799998756999--97573899999998
Q gi|255764509|r  131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAI--CQKYLRTSPEKIIL  208 (351)
Q Consensus       131 DAMGaNmvnt~~E~v~~~i~~~~~~~~~~~ilsN~~tdkk~s~~n~~~~rG~~V~Ae~~i~~~~--~~~~l~~~~e~~~~  208 (351)
                      .++..++...+.|+.++....              +++++.+..+|..+++..+.++..+|..+  +...+++.|+..+.
T Consensus       164 v~~atgnd~raiea~aha~a~--------------~~g~y~~l~~w~~~~~~~l~~~~~ipl~vgtVgg~~~~~p~a~~~  229 (266)
T d1r31a2         164 LIVATGNDWRAVEAGAHAYAC--------------RSGHYGSLTTWEKDNNGHLVGTLEMPMPVGLVGGATKTHPLAQLS  229 (266)
T ss_dssp             HHHHTTCCHHHHHHHHHHHHT--------------TTSSCCCSEEEEECTTSCEEEEEEEECCCCSBSTHHHHCHHHHHH
T ss_pred             HHHHHCCCCHHHHHHHHHHHC--------------CCCCCCCCCEEEECCCCCEEEEEECCEEEHHHCCCEECCHHHHHH
T ss_conf             999856983536777633201--------------489972458589879985899996344301114520228889999


Q ss_pred             HHHHHHHHHHHCCCHHHCCCCCHHHHHHHHHHH
Q ss_conf             878665655422002202162166778888876
Q gi|255764509|r  209 LNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA  241 (351)
Q Consensus       209 ~~~~~~~~a~~~~~~a~t~NkgimNgI~Av~lA  241 (351)
                      +....+.-+..           -++.|.|+.||
T Consensus       230 l~il~~~~a~~-----------La~iiaavgLA  251 (266)
T d1r31a2         230 LRILGVKTAQA-----------LAEIAVAVGLA  251 (266)
T ss_dssp             HHHHTCSSHHH-----------HHHHHHHHHHH
T ss_pred             HHHHCCCCHHH-----------HHHHHHHHHHH
T ss_conf             98867817999-----------98899999999


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Substrate-binding domain of HMG-CoA reductase
superfamily: Substrate-binding domain of HMG-CoA reductase
family: Substrate-binding domain of HMG-CoA reductase
domain: Substrate-binding domain of HMG-CoA reductase
species: Pseudomonas mevalonii [TaxId: 32044]