BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764509|ref|YP_003065434.2| hydroxymethylglutaryl-coenzyme
A (HMG-CoA) reductase [Candidatus Liberibacter asiaticus str. psy62]
         (351 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764509|ref|YP_003065434.2| hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254547860|gb|ACT57494.2| hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 351

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/351 (100%), Positives = 351/351 (100%)

Query: 1   MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIR 60
           MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIR
Sbjct: 1   MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIR 60

Query: 61  ATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           ATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL
Sbjct: 61  ATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR
Sbjct: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL
Sbjct: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE
Sbjct: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE 351
           ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE
Sbjct: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE 351


>gi|315122508|ref|YP_004062997.1| hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495910|gb|ADR52509.1| hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 349

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/349 (87%), Positives = 328/349 (93%)

Query: 3   MKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRAT 62
           MKK+S+IS+PMRWIGP+KITGNV+QD+V VPLATYE PLW+SVKRGA+ISMLC DGIRAT
Sbjct: 1   MKKISTISVPMRWIGPIKITGNVVQDQVNVPLATYESPLWNSVKRGAYISMLCQDGIRAT 60

Query: 63  LIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           LIDERMTRSIFFETE+AEMAL ALQEIT++K EI +++EQTSQFTRF+QLHSQIA NLLF
Sbjct: 61  LIDERMTRSIFFETEHAEMALKALQEITIRKKEIEQIVEQTSQFTRFIQLHSQIAANLLF 120

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           LRLEF+TGDASGHNMVTKAADAVM WILSQW+YL YGS+SGNICSDKKATAINGIMGRGK
Sbjct: 121 LRLEFSTGDASGHNMVTKAADAVMTWILSQWTYLRYGSISGNICSDKKATAINGIMGRGK 180

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           NFVAEITINR ICQKYLRTSPE I+ LNT KNLIGTFLAGGIRSANAHFANMLLAYYLAT
Sbjct: 181 NFVAEITINRQICQKYLRTSPENIVRLNTHKNLIGTFLAGGIRSANAHFANMLLAYYLAT 240

Query: 243 GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           GQDAANIVEGSQGLTYA+L DDSLYFSCTIPNLILGCVGNGKNIPA K NL  LGC E+R
Sbjct: 241 GQDAANIVEGSQGLTYAQLQDDSLYFSCTIPNLILGCVGNGKNIPATKKNLAELGCTEKR 300

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE 351
           K G+NARRLAAICAATVLCGELSL+AAQTNPGELM+AHL LERMHLNGE
Sbjct: 301 KNGENARRLAAICAATVLCGELSLIAAQTNPGELMKAHLLLERMHLNGE 349


>gi|89094690|ref|ZP_01167626.1| Hydroxymethylglutaryl-CoA reductase (NADPH) [Oceanospirillum sp.
           MED92]
 gi|89081036|gb|EAR60272.1| Hydroxymethylglutaryl-CoA reductase (NADPH) [Oceanospirillum sp.
           MED92]
          Length = 344

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/345 (63%), Positives = 278/345 (80%), Gaps = 1/345 (0%)

Query: 1   MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIR 60
           M   K+S   +PMR +GP+KITG V+++K+ VPLATYE PLW SV RGA +S L  DGI+
Sbjct: 1   MKAHKISQAPIPMRSVGPIKITGPVLEEKISVPLATYETPLWPSVGRGARVSALT-DGIK 59

Query: 61  ATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           AT++DERM+RSI  E ++AE A+ AL  I  + ++I  V+ ++S+F + + +HSQI  NL
Sbjct: 60  ATVVDERMSRSILLEADDAEAAMLALSSIKSRMSDINAVVAESSRFAKLIDMHSQIVANL 119

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           ++LRLEF TGDASGHNMVT AAD ++ W+LS++  L Y S+SGN CSDKKATA+NGI+GR
Sbjct: 120 IYLRLEFTTGDASGHNMVTNAADKIIPWVLSEYPQLRYSSISGNYCSDKKATAVNGILGR 179

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK  V EI I R +C++ L+T+PEK++ LN +KNLIGT +AGG+RSANAH+ANMLLA+YL
Sbjct: 180 GKYVVTEILIPRDVCERRLKTTPEKVVDLNIKKNLIGTMVAGGLRSANAHYANMLLAFYL 239

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQDAANI+EGSQG+ +A++ D  LYFSCTIPNLI+G VGNGK I  ++ NL  LGC E
Sbjct: 240 ATGQDAANIIEGSQGIVHAEVRDGDLYFSCTIPNLIMGSVGNGKGIDFVEENLAQLGCKE 299

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +R+ G NARRLAAICAATVLCGELSLLAAQTNPGELMEAHL+LER
Sbjct: 300 DREPGANARRLAAICAATVLCGELSLLAAQTNPGELMEAHLKLER 344


>gi|258544191|ref|ZP_05704425.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Cardiobacterium
           hominis ATCC 15826]
 gi|258520567|gb|EEV89426.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Cardiobacterium
           hominis ATCC 15826]
          Length = 348

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/347 (61%), Positives = 269/347 (77%), Gaps = 3/347 (0%)

Query: 1   MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIR 60
           M   +  +  +P +WIGP+ I GN I D V+VPLATYE PLW S  RGA ++     G+R
Sbjct: 1   MARTETHTTPIPTQWIGPLTIHGNAINDTVRVPLATYESPLWPSTARGAKVAEHS-GGVR 59

Query: 61  ATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
            T+IDERM RS+     +A  A  ALQ I  ++AE+A VI QTS+F R L LH++I GNL
Sbjct: 60  CTIIDERMARSVLLVASDAATAFAALQAIRTREAELAAVIAQTSRFARLLALHAEIVGNL 119

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           L+LRLE +TGDASGHNMVTKAADA + W+L+++  L YGS+S N C+DKKA+A+NGI+GR
Sbjct: 120 LYLRLECSTGDASGHNMVTKAADAALTWLLAEYPQLAYGSISANYCTDKKASAVNGILGR 179

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GKN +AEITI R IC+++LRT+PE+I+ LN++KN +G  LAG +RSANAHFAN+LLA+YL
Sbjct: 180 GKNVIAEITIPRRICERFLRTTPEQIVALNSRKNHLGGILAGSVRSANAHFANILLAFYL 239

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGK--NIPAIKNNLTALGC 298
           ATGQDAANI+EGSQG+ +A+  D  LYFSCT+PNLI+G VGNGK   +  ++ +L ALGC
Sbjct: 240 ATGQDAANIIEGSQGIVHAETRDGDLYFSCTLPNLIVGTVGNGKGATLATVEAHLQALGC 299

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            E R  G+NARRLAAICAATVLCGELSLLAAQTNPGELM AHL LER
Sbjct: 300 REARPAGENARRLAAICAATVLCGELSLLAAQTNPGELMRAHLALER 346


>gi|237784668|ref|YP_002905373.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Corynebacterium
           kroppenstedtii DSM 44385]
 gi|237757580|gb|ACR16830.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Corynebacterium
           kroppenstedtii DSM 44385]
          Length = 369

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 207/358 (57%), Positives = 262/358 (73%), Gaps = 23/358 (6%)

Query: 11  MPMRWIGPMKITGNVIQ---------------------DKVKVPLATYEYPLWHSVKRGA 49
           +PM WIGP+ I+GNV+                      + V +P+ATYE PLW SV RGA
Sbjct: 9   IPMSWIGPVHISGNVVSGETAGWNAEDGTQNQESGASYEAVSIPMATYETPLWPSVGRGA 68

Query: 50  HISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRF 109
            +S     GIRATL+DERMTRS++FE  NA +AL    E+  ++ E+  V+   S+F + 
Sbjct: 69  KVSRYVEGGIRATLVDERMTRSVYFEAPNAGVALRVATELDRRRDELQAVVAHASRFAKL 128

Query: 110 LQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDK 169
           + LH Q AGNLLF+R EF TGDASGHNMVT A+D +M WIL Q+  L YGS+SGN CSDK
Sbjct: 129 IDLHVQYAGNLLFVRFEFTTGDASGHNMVTLASDNLMPWILQQYPELRYGSISGNYCSDK 188

Query: 170 KATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANA 229
           KATA+NGI+GRGKN V E+ I R + ++ L+T+PE+I  LN +KNL+GT LAGG+R+ANA
Sbjct: 189 KATAVNGILGRGKNVVTEMLIPRNVVEERLKTTPEQIADLNVRKNLVGTTLAGGLRTANA 248

Query: 230 HFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGK--NIP 287
           H+ANMLL +YLATGQDAANIVEGSQG+T+A++ D  LYFSC +PNLI+G VGNGK   + 
Sbjct: 249 HYANMLLGFYLATGQDAANIVEGSQGITHAEVRDGDLYFSCNLPNLIVGTVGNGKGQGLE 308

Query: 288 AIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            ++ NL  LGC E+R  GDNARRLA +CAA+V CGELSLLAAQTNPGELM AH+++ER
Sbjct: 309 VVEENLRRLGCREDRPAGDNARRLAVLCAASVFCGELSLLAAQTNPGELMAAHVKIER 366


>gi|254513255|ref|ZP_05125320.1| Hydroxymethylglutaryl-coenzyme A reductase [Rhodobacteraceae
           bacterium KLH11]
 gi|221532259|gb|EEE35255.1| Hydroxymethylglutaryl-coenzyme A reductase [Rhodobacteraceae
           bacterium KLH11]
          Length = 361

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 200/335 (59%), Positives = 257/335 (76%), Gaps = 1/335 (0%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P +W+GP++I G  + +K+ VPLAT+E PLW S  RGA +S     GIR TL+DERM+R
Sbjct: 27  IPTQWVGPIEINGEHVDEKISVPLATFETPLWPSTARGARVSQH-SGGIRCTLVDERMSR 85

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           SI    +N  +A +A + +  +K EIA VI  T +F R L ++SQI GNL+++R+E +TG
Sbjct: 86  SIMLRAQNGTVARSAWKALAARKDEIAEVIATTGRFVRLLSMNSQIIGNLIYIRMECSTG 145

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DASGHNMVTK+AD V++WIL Q   L Y S+SGN C DKK +A+NGI+GRGK  +AEI I
Sbjct: 146 DASGHNMVTKSADTVIEWILRQHPELDYASISGNYCCDKKTSAVNGILGRGKYVIAEIEI 205

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R +  + LRT+PE++  LN +KNLIG  +AG +RSANAHFANMLLA+YLATGQDAANIV
Sbjct: 206 PREVATRMLRTTPERMAQLNLEKNLIGGTVAGSLRSANAHFANMLLAFYLATGQDAANIV 265

Query: 251 EGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARR 310
           EGSQG+ + +  D++LYFSCT+PNLI+G VGNGKN P +  +L  LGC EER  G+NARR
Sbjct: 266 EGSQGIVHCEARDEALYFSCTLPNLIVGTVGNGKNNPQVNAHLERLGCREERTHGENARR 325

Query: 311 LAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           LA ICAATVLCGELSL+AAQTNPGELM AH+++ER
Sbjct: 326 LACICAATVLCGELSLMAAQTNPGELMRAHIKMER 360


>gi|312190952|gb|ADQ43377.1| HMG-CoA reductase [Streptomyces cinnamonensis]
          Length = 353

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/335 (59%), Positives = 252/335 (75%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +PMRW+GP++I+GNV   + +VPLATYE PLW SV RGA +SML  +GI ATL+DERMTR
Sbjct: 10  VPMRWVGPLRISGNVATTETQVPLATYETPLWPSVGRGAKVSMLAENGIVATLVDERMTR 69

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S+  E  +A+ A  A + I  +  E+  V+   S+F + + +  +I  NLLF+R EF TG
Sbjct: 70  SVLVEATDAQTAYVAARAIDARIDELREVVRGCSRFAQLINIRHEINANLLFIRFEFTTG 129

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DASGHNM T A+DA++  +L     + YGS+SGN C+DKKATAINGI+GRGKN V E+ I
Sbjct: 130 DASGHNMATLASDALLKHLLDTIPGIAYGSISGNYCTDKKATAINGILGRGKNVVTELLI 189

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R +    L T+  K++ LN +KN++GT LAGGIRSANAH+ANMLL +YLATGQDAANIV
Sbjct: 190 PRDVVTDVLHTTAAKVVQLNIRKNMLGTLLAGGIRSANAHYANMLLGFYLATGQDAANIV 249

Query: 251 EGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARR 310
           EGSQG+T A+  D  LYF+CT+PNLI+G VGNGK I  ++ NL  LGC  ER+ G+NARR
Sbjct: 250 EGSQGVTMAEDRDGDLYFACTLPNLIVGTVGNGKGIEFVETNLARLGCRVEREPGENARR 309

Query: 311 LAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           LA I AATVLCGELSLLAAQTNPGELM AH++LER
Sbjct: 310 LAVIAAATVLCGELSLLAAQTNPGELMRAHVQLER 344


>gi|86475804|dbj|BAE78981.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Streptomyces sp. KO-3988]
          Length = 352

 Score =  421 bits (1082), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/345 (60%), Positives = 260/345 (75%)

Query: 3   MKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRAT 62
           M   +S  +PMRW+GP++I+GNV   + +VPLATYE PLW SV RGA +SML   GI AT
Sbjct: 1   MTDDTSAGVPMRWVGPLRISGNVAVTETQVPLATYESPLWPSVGRGAKVSMLSERGIAAT 60

Query: 63  LIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           L+DERMTRS+  E  +A+ A TA + I  +  E+  V+   S+F   LQ+  +IAGNLLF
Sbjct: 61  LVDERMTRSVLVEATDAQTAYTAARAIEARIEELRAVVRTCSRFAELLQVRHEIAGNLLF 120

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R EF+TGDASGHNM T A+DA++  +L     + YGS+SGN C+DKKATAINGI+GRGK
Sbjct: 121 VRFEFSTGDASGHNMATLASDALLAHLLQTIPGISYGSISGNYCTDKKATAINGILGRGK 180

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           N V E+ + R + ++ L T+  KI+ LN +KNL+GT LAGGIRSANAH+ANMLL +YLAT
Sbjct: 181 NVVTELVVEREVVERVLHTTAAKIVELNIRKNLLGTLLAGGIRSANAHYANMLLGFYLAT 240

Query: 243 GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           GQDAANIVEGSQG+T A+  D  LYFSC +PNLI+G VGNGK +  ++ NL  LGC E+R
Sbjct: 241 GQDAANIVEGSQGVTLAEDRDGDLYFSCNLPNLIVGTVGNGKGLEFVETNLNRLGCREDR 300

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMH 347
             G+NARRLA I AATVLCGELSLLAAQTNPGELM AH++LER H
Sbjct: 301 APGENARRLAVIAAATVLCGELSLLAAQTNPGELMRAHVQLERDH 345


>gi|153799373|gb|ABS50444.1| NapT2 [Streptomyces aculeolatus]
          Length = 353

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/335 (60%), Positives = 248/335 (74%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +PM+W+GP++I+GN+   +  VPLATYE PLW SV RGA +SML   GI ATL+DERMTR
Sbjct: 10  VPMKWVGPLRISGNIADTETHVPLATYESPLWPSVGRGAKVSMLTEAGIVATLVDERMTR 69

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S+  E  +A  A  A Q +     E+  ++   S+F R + +  +I  NLLF+R EFATG
Sbjct: 70  SVLVEATDAATAHRAAQSLETNIDELRDIVRGCSRFARLIGIRHEITANLLFIRFEFATG 129

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DASGHNM T A+DA++  +L     + YGS+SGN C+DKKATAINGI+GRGKN V E+ I
Sbjct: 130 DASGHNMATLASDALLKHLLHTIPGISYGSISGNYCTDKKATAINGILGRGKNVVTELLI 189

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R I    L T+  K++ LN +KNL+GT LAGGIRSANAHFANMLL +YLATGQDAANIV
Sbjct: 190 PRQIVTDVLHTTAAKVVELNIRKNLLGTLLAGGIRSANAHFANMLLGFYLATGQDAANIV 249

Query: 251 EGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARR 310
           EGSQG+T A+  D  LYFSCT+PNLI+G VGNGK +  ++ NLT LGC  E + G NARR
Sbjct: 250 EGSQGVTMAEDRDGDLYFSCTLPNLIVGTVGNGKGLGFVETNLTRLGCRTEAEPGHNARR 309

Query: 311 LAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           LA I AATVLCGELSLLAAQTNPGELM AH++LER
Sbjct: 310 LAVIAAATVLCGELSLLAAQTNPGELMRAHIQLER 344


>gi|238623521|emb|CAX48660.1| putative 3-hydroxy-3-methylglutaryl-CoA reductase [Streptomyces
           anulatus]
          Length = 353

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/335 (58%), Positives = 249/335 (74%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +PM+W+GP++++GN    +  VPLATYE PLW SV RGA ISML   GI ATL+DERMTR
Sbjct: 10  VPMKWVGPLRLSGNTATTETHVPLATYESPLWPSVGRGAKISMLVEQGIVATLVDERMTR 69

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S+  E  +A+ A  A +++  +  E+  V+   S++   + +  +I  NLLF+R EF TG
Sbjct: 70  SVLVEATDAQTAYLAARDVDARFDELREVVRTGSRYAELIGVRHEITANLLFIRFEFTTG 129

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DASGHNM T A+DA++  +L     + YGS+SGN C+DKKATAINGI+GRGKN V E+ +
Sbjct: 130 DASGHNMATLASDALLKHLLQTVPGITYGSISGNYCTDKKATAINGILGRGKNVVTELLV 189

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R +    L TS  +I+ LN +KN++GT LAGGIRSANAHFANMLL +YLATGQDAANIV
Sbjct: 190 PRDVVADVLHTSAARIVQLNIRKNMLGTLLAGGIRSANAHFANMLLGFYLATGQDAANIV 249

Query: 251 EGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARR 310
           EGSQG+T A+  D  LYFSCT+PNLI+G VGNGK +  ++ NLT LGC  +R  G+NARR
Sbjct: 250 EGSQGVTMAEDRDGDLYFSCTLPNLIVGTVGNGKGLEFVETNLTRLGCTVDRAPGENARR 309

Query: 311 LAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           LA I AATVLCGELSLLAAQTNPGELM AH++LER
Sbjct: 310 LAVIAAATVLCGELSLLAAQTNPGELMRAHVQLER 344


>gi|3721848|dbj|BAA70975.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Streptomyces sp.]
 gi|9695274|dbj|BAB07794.1| 3-hydroxy-3-methylglutaryl CoA reductase [Streptomyces sp. CL190]
          Length = 353

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/335 (58%), Positives = 250/335 (74%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +PMRW+GP++I+GNV + + +VPLATYE PLW SV RGA +S L   GI ATL+DERMTR
Sbjct: 10  VPMRWVGPLRISGNVAETETQVPLATYESPLWPSVGRGAKVSRLTEKGIVATLVDERMTR 69

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S+  E  +A+ A  A Q I  +  E+  V+   S+F + + +  +I  NLLF+R EF TG
Sbjct: 70  SVIVEATDAQTAYMAAQTIHARIDELREVVRGCSRFAQLINIKHEINANLLFIRFEFTTG 129

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DASGHNM T A+D ++  +L     + YGS+SGN C+DKKATAINGI+GRGKN + E+ +
Sbjct: 130 DASGHNMATLASDVLLGHLLETIPGISYGSISGNYCTDKKATAINGILGRGKNVITELLV 189

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R + +  L T+  KI+ LN +KNL+GT LAGGIRSANAHFANMLL +YLATGQDAANIV
Sbjct: 190 PRDVVENNLHTTAAKIVELNIRKNLLGTLLAGGIRSANAHFANMLLGFYLATGQDAANIV 249

Query: 251 EGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARR 310
           EGSQG+  A+  D  LYF+CT+PNLI+G VGNGK +  ++ NL  LGC  +R+ G+NARR
Sbjct: 250 EGSQGVVMAEDRDGDLYFACTLPNLIVGTVGNGKGLGFVETNLARLGCRADREPGENARR 309

Query: 311 LAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           LA I AATVLCGELSLLAAQTNPGELM AH++LER
Sbjct: 310 LAVIAAATVLCGELSLLAAQTNPGELMRAHVQLER 344


>gi|183983204|ref|YP_001851495.1| hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [Mycobacterium
           marinum M]
 gi|183176530|gb|ACC41640.1| hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [Mycobacterium
           marinum M]
          Length = 351

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 251/338 (74%)

Query: 8   SISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           S+ +P+RW+GP+KI+G+  Q     PLATYE P+W SV RGA +S L  +GI  TLIDE+
Sbjct: 9   SVHVPLRWVGPIKISGSEGQFSAHAPLATYESPVWPSVGRGAKLSRLTENGIVTTLIDEK 68

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRSI     +A +A    +++  + AE+A V+ QTS+F   + +H QI  NLLF+R EF
Sbjct: 69  MTRSILLIAPDAAVANNTARQLQTEFAELAAVVGQTSRFAELIGMHPQITANLLFIRFEF 128

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
            TGDASGHNM T AAD ++  IL+++  + YGS+SGN+C DKK TAINGI+GRGKN V E
Sbjct: 129 RTGDASGHNMATLAADHLIAHILTRYPQMEYGSISGNMCCDKKPTAINGILGRGKNVVTE 188

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           I I R + +++L TS   I  LN +KNLIGT  AG IRSANAH+ANMLLA+YLATGQDAA
Sbjct: 189 IVIPRDLVEQHLHTSAAAITALNIRKNLIGTLQAGTIRSANAHYANMLLAFYLATGQDAA 248

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307
           NI+ GSQG+T+A+  D  LYFSCTIPNLI+G VGNGK++  + +NL  LGC E+R  G N
Sbjct: 249 NIIAGSQGVTHAEDRDGDLYFSCTIPNLIVGTVGNGKDLDFVTDNLAQLGCREQRPPGAN 308

Query: 308 ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           ARRLA ICAATVLCGELSL+AAQTNPGELM AH   ER
Sbjct: 309 ARRLAVICAATVLCGELSLMAAQTNPGELMRAHTTYER 346


>gi|118618815|ref|YP_907147.1| hydroxymethylglutaryl-coenzyme a (HMG-CoA) reductase [Mycobacterium
           ulcerans Agy99]
 gi|118570925|gb|ABL05676.1| hydroxymethylglutaryl-coenzyme a (HMG-CoA) reductase [Mycobacterium
           ulcerans Agy99]
          Length = 351

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 249/338 (73%)

Query: 8   SISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           S+ +P+RW+GP+KI+GN  Q     PLATYE P+W SV RGA +S L  +GI  TLIDE+
Sbjct: 9   SVHVPLRWVGPIKISGNEGQFSAHAPLATYESPVWPSVGRGAKLSRLTENGIVTTLIDEK 68

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRSI     +A +A    +++  + AE+A V+ QTS+F   + +H QI  NLLF+R EF
Sbjct: 69  MTRSILLIAPDAAVANNTARQLQTEFAELAAVVGQTSRFAELIGMHPQITANLLFIRFEF 128

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
            TGDASGHNM T AAD ++  IL+ +  + YGS+SGN+C DKK  AINGI+GRGKN V E
Sbjct: 129 RTGDASGHNMATLAADHLIAHILTHYPQMEYGSISGNMCCDKKPIAINGILGRGKNVVTE 188

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           I I R + +++L TS   I  LN +KNLIGT  AG IRSANAH+ANMLLA+YLATGQDAA
Sbjct: 189 IVIPRDLVEQHLHTSAAAITALNIRKNLIGTLQAGTIRSANAHYANMLLAFYLATGQDAA 248

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307
           NI+ GSQG+T+A+  D  LYFSCTIPNLI+G VGNGK++  + +NL  LGC E+R  G N
Sbjct: 249 NIIAGSQGVTHAEDRDGDLYFSCTIPNLIVGTVGNGKDLDFVTDNLAQLGCREQRPPGAN 308

Query: 308 ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           ARRLA ICAATVLCGELSL+AAQTNPGELM AH   ER
Sbjct: 309 ARRLAVICAATVLCGELSLMAAQTNPGELMRAHTTYER 346


>gi|4218038|dbj|BAA74565.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Kitasatospora
           griseola]
 gi|9711350|dbj|BAB07821.1| HMG-CoA reductase [Kitasatospora griseola]
          Length = 353

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/341 (58%), Positives = 253/341 (74%)

Query: 7   SSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDE 66
           ++  +PMRW+GP++I+GNV   + +VPLATYE PLW SV RGA +S L   GI ATL+DE
Sbjct: 6   ATAGVPMRWVGPVRISGNVATIETQVPLATYESPLWPSVGRGAKVSRLTEKGIVATLVDE 65

Query: 67  RMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           RMTRS+  E  +A  AL+A + I  +  E+  ++   S+F + + +  +I GNLLF+R E
Sbjct: 66  RMTRSVLVEATDALTALSAARTIEARIDELRELVRGCSRFAQLIGIRHEITGNLLFVRFE 125

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
           F+TGDASGHNM T A+D ++  +L     + YGS+SGN C+DKKATAINGI+GRGKN V 
Sbjct: 126 FSTGDASGHNMATLASDVLLQHLLETVPGISYGSISGNYCTDKKATAINGILGRGKNVVT 185

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E+ + R +    L T+  KI  LN +KNL+GT LAGGIRSANAH+ANMLLA+YLATGQDA
Sbjct: 186 ELLVPRDVVADVLNTTAAKIAELNLRKNLLGTLLAGGIRSANAHYANMLLAFYLATGQDA 245

Query: 247 ANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGD 306
           ANIVEGSQG+  A+  D  LY +CT+PNLI+G VGNGK +  ++ NL  LGC  +R+ G+
Sbjct: 246 ANIVEGSQGVVTAEDRDGDLYLACTLPNLIVGTVGNGKGLGFVETNLNRLGCRADREPGE 305

Query: 307 NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMH 347
           NARRLA I AATVLCGELSLLAAQTNPGELM AH++LER H
Sbjct: 306 NARRLAVIAAATVLCGELSLLAAQTNPGELMRAHVQLERGH 346


>gi|57753874|dbj|BAD86804.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Streptomyces sp. KO-3988]
          Length = 353

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/341 (60%), Positives = 256/341 (75%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +PM+W+GP++I+GNV   +  VPLATYE PLW SV RGA +SML   GI ATL+DERMTR
Sbjct: 10  VPMKWVGPLRISGNVATTETHVPLATYETPLWPSVGRGAKVSMLSERGIAATLVDERMTR 69

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S+  E  +A+ A TA + I  +  E+  V+   S+F   LQ+  +IAGNLLF+R EF+TG
Sbjct: 70  SVLVEATDAQTAYTAARAIEARIEELRAVVRTCSRFAELLQVRHEIAGNLLFVRFEFSTG 129

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DASGHNM T A+DA++  +L     + YGS+SGN C+DKKATAINGI+GRGKN V E+ +
Sbjct: 130 DASGHNMATLASDALLAHLLQTIPGISYGSISGNYCTDKKATAINGILGRGKNVVTELVV 189

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R + ++ L T+  KI+ LN +KNL+GT LAGGIRSANAH+ANMLL +YLATGQDAANIV
Sbjct: 190 EREVVERVLHTTAAKIVELNIRKNLLGTLLAGGIRSANAHYANMLLGFYLATGQDAANIV 249

Query: 251 EGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARR 310
           EGSQG+T A+  D  LYFSC +PNLI+G VGNGK +  ++ NL  LGC E+R  G+NARR
Sbjct: 250 EGSQGVTLAEDRDGDLYFSCNLPNLIVGTVGNGKGLEFVETNLNRLGCREDRAPGENARR 309

Query: 311 LAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE 351
           LA I AATVLCGELSLLAAQTNPGELM AH+ LER +   E
Sbjct: 310 LAVIAAATVLCGELSLLAAQTNPGELMRAHVELERDNTTAE 350


>gi|54024180|ref|YP_118422.1| putative 3-hydroxy-3-methylglutaryl-CoA reductase [Nocardia
           farcinica IFM 10152]
 gi|54015688|dbj|BAD57058.1| putative 3-hydroxy-3-methylglutaryl-CoA reductase [Nocardia
           farcinica IFM 10152]
          Length = 352

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/343 (60%), Positives = 262/343 (76%)

Query: 3   MKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRAT 62
           M  +S  ++P+RW+GP++ITG V+ D V+VPLATYE PLW SV RGA ++ L   G++AT
Sbjct: 1   MNDLSYAAVPLRWVGPVRITGAVVDDAVEVPLATYESPLWPSVGRGARVTTLTERGVQAT 60

Query: 63  LIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           +ID+RMTRS+ FE ++A  AL A++ +T + AE+ RV E +S++ R L LH QIAGNLLF
Sbjct: 61  VIDDRMTRSVLFEADDAYTALVAVRGLTGRFAELQRVTEASSRYARLLDLHHQIAGNLLF 120

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           LR  F+TGDA+GHNM T AAD +MD I++    L + SVSGN C+DKKATA+NGI+GRGK
Sbjct: 121 LRFAFSTGDAAGHNMATLAADRLMDHIVATVPGLRHVSVSGNYCTDKKATAVNGILGRGK 180

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           N V EI I   +  + L T+  +++ LN +KNLIGT LAGGIRSANAH+ANMLLA+YLAT
Sbjct: 181 NVVTEILIPAEVVGQRLHTTARQVVELNIRKNLIGTLLAGGIRSANAHYANMLLAFYLAT 240

Query: 243 GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           GQDAANIVEGSQG+T+A+     LYFSCT+PNL++G VGNGK+   ++  L  LGC +ER
Sbjct: 241 GQDAANIVEGSQGVTHAEDRGGDLYFSCTLPNLVVGTVGNGKHHGFVEEVLARLGCRDER 300

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G+NARRLA I AA VLCGELSLLAAQTN GELM +H R ER
Sbjct: 301 PDGENARRLAVIAAAAVLCGELSLLAAQTNRGELMRSHTRFER 343


>gi|40882375|dbj|BAD07379.1| HMG-CoA reductase [Actinoplanes sp. A40644]
          Length = 353

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 203/336 (60%), Positives = 248/336 (73%)

Query: 10  SMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMT 69
           S+P+RW+GP++ITGNV   + +VPLATYE PLW SV RGA IS L   GI  TL+DERMT
Sbjct: 9   SVPLRWVGPLRITGNVGDIETEVPLATYESPLWPSVGRGAKISRLVGPGIVTTLVDERMT 68

Query: 70  RSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFAT 129
           RS+    E+A+ A  A  E+  +  E+  ++    +F   +  H +I  +LL+LR +F T
Sbjct: 69  RSVLVRAEDAQTAYMAALEVDARLDELREIVRTCGRFVELIGFHHEITAHLLYLRFDFTT 128

Query: 130 GDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEIT 189
           GDASGHNM T AADA++  IL     + YGS+SGN C+DKKATA+NGI+GRGKN + E+T
Sbjct: 129 GDASGHNMATLAADALLAHILKTIPGISYGSISGNYCTDKKATAVNGILGRGKNVITELT 188

Query: 190 INRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANI 249
           I R I +  L T+   I  LN QKNLIGT LAGGIRSANAH+ANMLL  YLATGQDAANI
Sbjct: 189 IPRDIVRDNLHTTAAAIAELNVQKNLIGTLLAGGIRSANAHYANMLLGIYLATGQDAANI 248

Query: 250 VEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNAR 309
           +EGSQG+T A+  D  LYFSCT+PNLILG VGNGK +  ++ NL  LGC E R+ G+NAR
Sbjct: 249 IEGSQGVTVAEDRDGDLYFSCTLPNLILGTVGNGKGLDFVEENLARLGCREAREPGENAR 308

Query: 310 RLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           RLA I AATVLCGELSLLAAQTNPGELM+AH+RLER
Sbjct: 309 RLAVITAATVLCGELSLLAAQTNPGELMQAHVRLER 344


>gi|4218040|dbj|BAA74566.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Streptomyces sp.
           KO-3988]
          Length = 353

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/350 (58%), Positives = 257/350 (73%), Gaps = 1/350 (0%)

Query: 3   MKKVSSISM-PMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRA 61
           M    +I+M PM+W+GP++I+GNV   +  VPLATYE PLW SV RGA +SML   GI A
Sbjct: 1   MTDTHAIAMVPMKWVGPLRISGNVATTETHVPLATYETPLWPSVGRGAKVSMLSERGIAA 60

Query: 62  TLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
           TL+DERMTRS+  E  +A+ A TA + I  +  E+  V+   S+F   LQ+  +IAGNLL
Sbjct: 61  TLVDERMTRSVLVEATDAQTAYTAARAIEARIEELRAVVRTCSRFAELLQVRHEIAGNLL 120

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           F+R EF+T   SGHNM T A+DA++  +L     + YGS+SGN C+DKKATAINGI+GRG
Sbjct: 121 FVRFEFSTRRPSGHNMATLASDALLAHLLQTIPGISYGSISGNYCTDKKATAINGILGRG 180

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           KN V E+ + R + ++ L T+  KI+ LN +KNL+GT LAGGIRSANAH+ANMLL +YLA
Sbjct: 181 KNVVTELVVEREVVERVLHTTAAKIVELNIRKNLLGTLLAGGIRSANAHYANMLLGFYLA 240

Query: 242 TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           TGQDAANIVEGSQG+T A+  D  LYFSC +PNLI+G VGNGK +  ++ NL  LGC E+
Sbjct: 241 TGQDAANIVEGSQGVTLAEDRDGDLYFSCNLPNLIVGTVGNGKGLEFVETNLNRLGCRED 300

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE 351
           R  G+NARRLA I AATVLCGELSLLAAQTNPGELM AH+ LER +   E
Sbjct: 301 RAPGENARRLAVIAAATVLCGELSLLAAQTNPGELMRAHVELERDNTTAE 350


>gi|78486058|ref|YP_391983.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Thiomicrospira
           crunogena XCL-2]
 gi|78364344|gb|ABB42309.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Thiomicrospira
           crunogena XCL-2]
          Length = 352

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 192/339 (56%), Positives = 254/339 (74%), Gaps = 3/339 (0%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +PM+ +GP K+ G V  D + VP+ATYE PLW SV RGA ++     GIR T+IDERMTR
Sbjct: 12  IPMQSVGPFKLIGEVETDDLMVPMATYETPLWPSVARGARVTHHA-GGIRVTVIDERMTR 70

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S+  E  NA +AL   Q +   +A +  ++ Q+SQ+ + L L+ QI GNL++LRLEF+TG
Sbjct: 71  SVLLEAPNASIALQRFQALKADQAALQAIVSQSSQYAKLLDLNVQIIGNLIYLRLEFSTG 130

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DASGHNMVT AAD ++ WIL  +  L Y S+SGN C+DKK +A+NGI+GRGKN V E TI
Sbjct: 131 DASGHNMVTNAADKLIPWILESYPDLSYVSISGNYCTDKKVSAVNGILGRGKNVVCETTI 190

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R +CQ++L+T+PE I+ L+ +K+LIG+ ++GG+R+ANAH ANMLL +YLATGQDAANI+
Sbjct: 191 PRKLCQRFLKTTPEAIVDLHIKKDLIGSIVSGGLRTANAHVANMLLGFYLATGQDAANII 250

Query: 251 EGSQGLTYAKLH-DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER-KTGDNA 308
           EGSQ + + +++ D  LYFS T+PNLI+G VGNGK +  + +NL  LGC+++  K G NA
Sbjct: 251 EGSQAINHIEVNADGDLYFSTTLPNLIVGTVGNGKGLDFVLDNLEQLGCVDQTAKPGQNA 310

Query: 309 RRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMH 347
           RRLA I  AT LCGELSLLAAQTNPGELM AHL+LER +
Sbjct: 311 RRLACIAGATALCGELSLLAAQTNPGELMSAHLKLERQN 349


>gi|20429107|emb|CAD24418.1| HMG-CoA reductase [Paracoccus zeaxanthinifaciens]
          Length = 340

 Score =  404 bits (1039), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 249/340 (73%), Gaps = 1/340 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +S   +P +W+GP+   G V++  +  PLATYE PLW S  RGA +S     GI+ +L+D
Sbjct: 2   ISHTPVPTQWVGPILFRGPVVEGPISAPLATYETPLWPSTARGAGVSRHS-GGIQVSLVD 60

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           ERM+RSI     +   A  A Q I  ++ E+A V+  TS+F R ++L+ QI GNLL++R+
Sbjct: 61  ERMSRSIALRAHDGAAATAAWQSIKARQEEVAAVVATTSRFARLVELNRQIVGNLLYIRI 120

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           E  TGDASGHNMVTKAA+AV  WILS++  L Y ++SGN+C+DKKA+A+NGI+GRGK  V
Sbjct: 121 ECVTGDASGHNMVTKAAEAVQGWILSEYPMLAYSTISGNLCTDKKASAVNGILGRGKYAV 180

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE+ I R I  + LRTS EK++ LN +KN +G  LAG +RSANAHFANMLL +YLATGQD
Sbjct: 181 AEVEIPRKILTRVLRTSAEKMVRLNYEKNYVGGTLAGSLRSANAHFANMLLGFYLATGQD 240

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           AANI+E SQG  + +   + LYFSCT+PNLI+G VG GK IP+I+ NL+ +GC +  + G
Sbjct: 241 AANIIEASQGFVHCEARGEDLYFSCTLPNLIMGSVGAGKGIPSIEENLSRMGCRQPGEPG 300

Query: 306 DNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           DNARRLAAICA  VLCGELSLLAAQTNPGEL+  H+ +ER
Sbjct: 301 DNARRLAAICAGVVLCGELSLLAAQTNPGELVRTHMEMER 340


>gi|302557473|ref|ZP_07309815.1| hydroxymethylglutaryl-coenzyme A reductase [Streptomyces
           griseoflavus Tu4000]
 gi|302475091|gb|EFL38184.1| hydroxymethylglutaryl-coenzyme A reductase [Streptomyces
           griseoflavus Tu4000]
          Length = 354

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/335 (60%), Positives = 247/335 (73%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +PM+W+GP++I+GNV + + +VPLATYE PLW SV RGA +S +   GI  TL+DERMTR
Sbjct: 10  VPMKWVGPLRISGNVGEFETQVPLATYESPLWPSVGRGARLSTMVDQGIVTTLVDERMTR 69

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S+F   E A+ A  A  E+  +  E+  V+    +F   +  H +IA NLLFLR EF TG
Sbjct: 70  SVFVRAEGAQAAHMAALEVDARLDELRDVVRTCGRFVELIGFHHEIAANLLFLRFEFTTG 129

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DASGHNM T AADA++  IL     + YGS+SGN C+DKKATA+NGI+GRGK  V E+ +
Sbjct: 130 DASGHNMATLAADALLSHILQAIPGITYGSISGNYCTDKKATAVNGILGRGKRVVTELLL 189

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R I +K LRTS   I  LN  KN+IGT LAGGIRSANAH+ANMLL +YLATGQDAANIV
Sbjct: 190 PRDIVRKSLRTSAAAIADLNIGKNMIGTLLAGGIRSANAHYANMLLGFYLATGQDAANIV 249

Query: 251 EGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARR 310
           EGSQG+T A+  D  LYFSCT+PNLI+G VGNGK +  ++ NL  LGC   R+ GDNARR
Sbjct: 250 EGSQGVTVAEDRDGDLYFSCTLPNLIVGTVGNGKGLDFVEENLERLGCRAVREPGDNARR 309

Query: 311 LAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           LA + AATVLCGELSL+AAQTNPGELM AH+RLER
Sbjct: 310 LAVVAAATVLCGELSLMAAQTNPGELMRAHVRLER 344


>gi|146329189|ref|YP_001209697.1| hydroxymethylglutaryl-coenzyme A reductase [Dichelobacter nodosus
           VCS1703A]
 gi|146232659|gb|ABQ13637.1| hydroxymethylglutaryl-coenzyme A reductase [Dichelobacter nodosus
           VCS1703A]
          Length = 350

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/338 (60%), Positives = 254/338 (75%), Gaps = 3/338 (0%)

Query: 11  MPMRWIGPMKITGNVIQDK-VKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMT 69
           +P  WIGP+ I+GNVI+++   +PLATYE PLW S  RGA IS L  +GIR T+  E MT
Sbjct: 11  IPTHWIGPVSISGNVIEEESCSIPLATYESPLWASCNRGAKISRLAENGIRVTITHEMMT 70

Query: 70  RSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFAT 129
           RSI   T+NA      L+ I  +K  +  V+  TS+F + + +H +I GNLLFLR  F T
Sbjct: 71  RSILVYTDNAASTFAVLRSIYAQKEILKNVVRDTSRFAQLIDIHDEIVGNLLFLRFSFQT 130

Query: 130 GDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEIT 189
           GDA+GHNMVTKAADA++ ++L  +  LHYGSVSGN C+DKKA+A+NGI+GRGK+ +AEI 
Sbjct: 131 GDAAGHNMVTKAADALLHYLLEHYPQLHYGSVSGNYCTDKKASAVNGILGRGKHAIAEIL 190

Query: 190 INRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANI 249
           I  AIC ++LR+S EKI  LN QKNLIG+ LAG IRSANAHFANMLLA+YLATGQDAANI
Sbjct: 191 IPDAICARHLRSSAEKISTLNLQKNLIGSTLAGSIRSANAHFANMLLAFYLATGQDAANI 250

Query: 250 VEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKN--IPAIKNNLTALGCIEERKTGDN 307
           +EGSQG+ + +     LYFSCT+PNLI+G VGNGKN     + ++L  +GC  ER TG+N
Sbjct: 251 IEGSQGMVHCENRAGDLYFSCTLPNLIIGSVGNGKNADFAVVNDHLEKMGCRAERSTGEN 310

Query: 308 ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           ARRLAA+CAA VLCGELSLLAAQTN GELM AHL LER
Sbjct: 311 ARRLAALCAAVVLCGELSLLAAQTNLGELMRAHLVLER 348


>gi|212218969|ref|YP_002305756.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Coxiella burnetii
           CbuK_Q154]
 gi|212013231|gb|ACJ20611.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Coxiella burnetii
           CbuK_Q154]
          Length = 357

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/345 (53%), Positives = 256/345 (74%), Gaps = 2/345 (0%)

Query: 1   MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIR 60
           ++   + +I +P++ IGP+KI G+ +  +V+VPLAT+E P+W S  RGA ++  C  G+ 
Sbjct: 8   VYHPSMQTIPIPLQLIGPIKIIGSEVNTEVEVPLATFETPMWPSTNRGASVTRRC-GGLH 66

Query: 61  ATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
             ++D+RMTRS+  E  +A    T L ++  +   +  V+  TS+F R +  H+QI GNL
Sbjct: 67  CLVLDDRMTRSVLLEGVDAYSVKTVLDDLN-RHGALTEVVSSTSRFCRNVSWHAQIVGNL 125

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           LFLRLE  TGDASGHNM+TKAADAV+DW+L ++  L Y S+SGN+C DKK +AINGI+GR
Sbjct: 126 LFLRLEATTGDASGHNMLTKAADAVIDWMLKKYPGLRYVSISGNMCVDKKVSAINGILGR 185

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK  +A++ I RA+CQ+ L+T+PE I+ L+ +KNL+G+ ++GG+R+ANAHFAN+L A YL
Sbjct: 186 GKYVIADMLIPRAVCQERLKTTPEAIVNLHVKKNLMGSIVSGGLRTANAHFANLLYAIYL 245

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD ANIVEGSQG T+A+L +  LYFS T+PN+I+G VGNGK+   +K +L  LGC++
Sbjct: 246 ATGQDVANIVEGSQGFTHAELRNGDLYFSVTLPNIIVGTVGNGKHYDFVKKHLQLLGCLD 305

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +  G +ARRLA I AATV CGELSLLAAQTNPGELM AH + ER
Sbjct: 306 NQNPGQSARRLAIIVAATVWCGELSLLAAQTNPGELMRAHEKFER 350


>gi|29653948|ref|NP_819640.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Coxiella burnetii RSA
           493]
 gi|209363847|ref|YP_001424029.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Coxiella burnetii
           Dugway 5J108-111]
 gi|212212907|ref|YP_002303843.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Coxiella burnetii
           CbuG_Q212]
 gi|29541211|gb|AAO90154.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Coxiella burnetii
           RSA 493]
 gi|207081780|gb|ABS77271.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Coxiella burnetii
           Dugway 5J108-111]
 gi|212011317|gb|ACJ18698.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Coxiella burnetii
           CbuG_Q212]
          Length = 357

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/345 (53%), Positives = 256/345 (74%), Gaps = 2/345 (0%)

Query: 1   MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIR 60
           ++   + +I +P++ IGP+KI G+ +  +V+VPLAT+E P+W S  RGA ++  C  G+ 
Sbjct: 8   VYHPSMQTIPIPLQLIGPIKIIGSEVNTEVEVPLATFETPMWPSTNRGASVTRRC-GGLH 66

Query: 61  ATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
             ++D+RMTRS+  E  +A    T L ++  +   +  V+  TS+F R +  H+QI GNL
Sbjct: 67  CLVLDDRMTRSVLLEGVDAYSVKTVLDDLN-RHGALTEVVSSTSRFCRNVSWHAQIVGNL 125

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           LFLRLE  TGDASGHNM+TKAADAV+DW+L ++  L Y S+SGN+C DKK +AINGI+GR
Sbjct: 126 LFLRLEATTGDASGHNMLTKAADAVIDWMLKKYPGLRYVSISGNMCVDKKVSAINGILGR 185

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK  +A++ I RA+CQ+ L+T+PE I+ L+ +KNL+G+ ++GG+R+ANAHFAN+L A YL
Sbjct: 186 GKYVIADMLIPRAVCQERLKTTPEAIVNLHVKKNLMGSIVSGGLRTANAHFANLLYAIYL 245

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD ANIVEGSQG T+A+L +  LYFS T+PN+I+G VGNGK+   +K +L  LGC++
Sbjct: 246 ATGQDVANIVEGSQGFTHAELRNGDLYFSVTLPNIIVGTVGNGKHYDFVKKHLQLLGCLD 305

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +  G +ARRLA I AATV CGELSLLAAQTNPGELM AH + ER
Sbjct: 306 NQNPGQSARRLAIIVAATVWCGELSLLAAQTNPGELMRAHEKFER 350


>gi|161830039|ref|YP_001596535.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Coxiella burnetii RSA
           331]
 gi|164686048|ref|ZP_01947592.2| hydroxymethylglutaryl-CoA reductase (NADPH) [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165919003|ref|ZP_02219089.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Coxiella burnetii RSA
           334]
 gi|161761906|gb|ABX77548.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Coxiella burnetii RSA
           331]
 gi|164601604|gb|EAX31784.2| hydroxymethylglutaryl-CoA reductase (NADPH) [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165917328|gb|EDR35932.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Coxiella burnetii RSA
           334]
          Length = 355

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/345 (53%), Positives = 256/345 (74%), Gaps = 2/345 (0%)

Query: 1   MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIR 60
           ++   + +I +P++ IGP+KI G+ +  +V+VPLAT+E P+W S  RGA ++  C  G+ 
Sbjct: 6   VYHPSMQTIPIPLQLIGPIKIIGSEVNTEVEVPLATFETPMWPSTNRGASVTRRC-GGLH 64

Query: 61  ATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
             ++D+RMTRS+  E  +A    T L ++  +   +  V+  TS+F R +  H+QI GNL
Sbjct: 65  CLVLDDRMTRSVLLEGVDAYSVKTVLDDLN-RHGALTEVVSSTSRFCRNVSWHAQIVGNL 123

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           LFLRLE  TGDASGHNM+TKAADAV+DW+L ++  L Y S+SGN+C DKK +AINGI+GR
Sbjct: 124 LFLRLEATTGDASGHNMLTKAADAVIDWMLKKYPGLRYVSISGNMCVDKKVSAINGILGR 183

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK  +A++ I RA+CQ+ L+T+PE I+ L+ +KNL+G+ ++GG+R+ANAHFAN+L A YL
Sbjct: 184 GKYVIADMLIPRAVCQERLKTTPEAIVNLHVKKNLMGSIVSGGLRTANAHFANLLYAIYL 243

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD ANIVEGSQG T+A+L +  LYFS T+PN+I+G VGNGK+   +K +L  LGC++
Sbjct: 244 ATGQDVANIVEGSQGFTHAELRNGDLYFSVTLPNIIVGTVGNGKHYDFVKKHLQLLGCLD 303

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +  G +ARRLA I AATV CGELSLLAAQTNPGELM AH + ER
Sbjct: 304 NQNPGQSARRLAIIVAATVWCGELSLLAAQTNPGELMRAHEKFER 348


>gi|213964954|ref|ZP_03393153.1| hydroxymethylglutaryl-coenzyme A reductase [Corynebacterium
           amycolatum SK46]
 gi|213952490|gb|EEB63873.1| hydroxymethylglutaryl-coenzyme A reductase [Corynebacterium
           amycolatum SK46]
          Length = 351

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 253/336 (75%), Gaps = 1/336 (0%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+ WIGP++I+GNV+ D+VK+PLATYE PLW S  RGA +S +   GI  T + E+MTR
Sbjct: 14  VPLSWIGPVRISGNVMNDEVKIPLATYETPLWPSCGRGAKVSRMIEGGITCTFVGEKMTR 73

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S+ F  ++A  A+ A   I  +  E+ +V+E +S+F + + +H QIA  LLF+R +F +G
Sbjct: 74  SVIFTLDSAADAVVARDNILSRSDELKKVVESSSRFAKLVDIHFQIASRLLFVRFDFFSG 133

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DASGHNM T A++ +M +++ Q   L YGS+SGN C+DKK +A+NGI+GRGK  +AE  I
Sbjct: 134 DASGHNMATLASERLMSYLMEQMPELGYGSISGNYCTDKKTSAVNGILGRGKYVIAEAVI 193

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
              + ++ LRT+ +++  LN +KNL+G+ +AG +RS NAH+ANMLL +YLATGQDAANIV
Sbjct: 194 PEPVVRERLRTTAKRLAELNERKNLVGSIMAGSLRSGNAHYANMLLGFYLATGQDAANIV 253

Query: 251 EGSQGLTYAK-LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNAR 309
           EGSQGLT  + L D S+ FSCT+P+LI+G VGNGK +  ++ NLTALGC E+R+ G+NAR
Sbjct: 254 EGSQGLTQVEALDDGSVRFSCTLPHLIVGSVGNGKGLDFVEKNLTALGCKEDREPGENAR 313

Query: 310 RLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           RLAA CAA V CGELSLLAAQTNPGELMEAH+ +ER
Sbjct: 314 RLAACCAAIVWCGELSLLAAQTNPGELMEAHVSIER 349


>gi|319441698|ref|ZP_07990854.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Corynebacterium
           variabile DSM 44702]
          Length = 335

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/335 (54%), Positives = 244/335 (72%), Gaps = 5/335 (1%)

Query: 16  IGPMKITGNVIQ-----DKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +GP++I+GN        ++V+VPLAT+E PLW SV RGA IS     GI  T++ E MTR
Sbjct: 1   MGPLRISGNAFTSGDAYEEVEVPLATFETPLWPSVGRGASISREVSTGITTTVVSECMTR 60

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S+ F  +N  +A  A + I  +  ++   +  T+   R + LH++I GNLL++R E   G
Sbjct: 61  SVLFVADNGAVAFAASRVIVDRIGDLRDAVASTTSHGRLVDLHTEIVGNLLYVRFELNPG 120

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DASGHNMVTKAADA+M+ ILS    L YGSVSGN CSDKKATA+NGI+GRGKN +AEI +
Sbjct: 121 DASGHNMVTKAADALMERILSWNLGLDYGSVSGNFCSDKKATAVNGILGRGKNVIAEIFL 180

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
              + ++ LRT+   +  L  +KNL+G+ +AG +RS+NAH+ANMLL ++LATGQDAANIV
Sbjct: 181 PHEVVERRLRTTASALEDLVVRKNLVGSTIAGALRSSNAHYANMLLGFFLATGQDAANIV 240

Query: 251 EGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARR 310
           EGSQG+TYA+  +D LYFSCT+PN+I+G VG+GK++P +   L  +GC E+R+ G N+RR
Sbjct: 241 EGSQGITYAEAREDGLYFSCTLPNIIVGTVGSGKHLPDVTAALERVGCREDREIGANSRR 300

Query: 311 LAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           LA++ AA VLCGELSLLAAQTNPGELM  HL +ER
Sbjct: 301 LASLIAAAVLCGELSLLAAQTNPGELMSTHLSMER 335


>gi|28628719|gb|AAO49324.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Streptomyces sp.
           SMA185]
          Length = 258

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 152/258 (58%), Positives = 189/258 (73%)

Query: 58  GIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIA 117
           GI ATL+DERMTRS+  E  +AE A  A  +I  +  E+  +  Q+S+F   L +  +I 
Sbjct: 1   GIVATLVDERMTRSVLLEASDAETAYAAALDIHTRTDELRALTRQSSRFAELLAIRHEIT 60

Query: 118 GNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGI 177
           G LLF+R EFATGDASGHNMVT AAD ++  +L++   + YGS+S N C+DKKATAINGI
Sbjct: 61  GPLLFVRFEFATGDASGHNMVTLAADHLLGHLLTRIPGVTYGSISANYCTDKKATAINGI 120

Query: 178 MGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA 237
           +GRGKN  AEI I + +  +YL T+ EK+  LN  KNL+GT LAGGIRSANAH+ANMLLA
Sbjct: 121 LGRGKNTTAEILIPQTLLAQYLHTTAEKVTRLNVHKNLVGTLLAGGIRSANAHYANMLLA 180

Query: 238 YYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
           +YLATGQDAANIVEGSQG+TYA   +  LYFSCT+PNLI+G VGNGK   +    LT LG
Sbjct: 181 FYLATGQDAANIVEGSQGITYAANREGDLYFSCTLPNLIVGTVGNGKAHTSAGQALTRLG 240

Query: 298 CIEERKTGDNARRLAAIC 315
           C ++R TG+NARRLA I 
Sbjct: 241 CRDDRPTGENARRLAVIA 258


>gi|28628713|gb|AAO49321.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Streptomyces sp.
           SMA5]
          Length = 258

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 188/257 (73%)

Query: 58  GIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIA 117
           GI ATL+DERMTRS+  E  +A  AL A + I  +  E+  ++   S+F R + +  +I 
Sbjct: 1   GIVATLVDERMTRSVLVEAVDARTALMAARTIETRTEELRELVRGCSRFARLIGVRHEIN 60

Query: 118 GNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGI 177
            NLLF+R EFATGDASGHNM T A+D ++  +L     + YGS+SGN C+DKKATA+NGI
Sbjct: 61  ANLLFIRFEFATGDASGHNMATLASDVLLKHLLETVPGISYGSISGNYCTDKKATAVNGI 120

Query: 178 MGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA 237
           +GRGKN V E+ + RA+    L T+   I+ LN +KNL+GT LAGGIRSANAH+ANMLL 
Sbjct: 121 LGRGKNVVTELLVPRAVVADVLHTTAVGIVELNIRKNLLGTLLAGGIRSANAHYANMLLG 180

Query: 238 YYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
           +YLATGQDAANI+EGSQG+T A+  D  LYF+CT+PNLI+G VGNGK +  ++ NLT LG
Sbjct: 181 FYLATGQDAANIIEGSQGVTMAEDRDGDLYFACTLPNLIVGTVGNGKGLGFVETNLTRLG 240

Query: 298 CIEERKTGDNARRLAAI 314
           C E+R+ G+NARRLA I
Sbjct: 241 CREDREPGENARRLAVI 257


>gi|324120482|dbj|BAJ78975.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Nocardia
           asteroides]
 gi|324120486|dbj|BAJ78977.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Nocardia soli]
          Length = 238

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 180/238 (75%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRSI  E ++A  A T +Q++  + AE+  V+  +S+F R + LH QI GNLLFLR EF
Sbjct: 1   MTRSILLEADDAYTAYTTVQQLEGRMAELQEVVSGSSRFARLIDLHHQITGNLLFLRFEF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
            TGDASGHNM T A+D +MD ILS    + YGS+SGN C+DKKATA+NGI+GRGKN + E
Sbjct: 61  TTGDASGHNMATLASDHLMDHILSTMPGVRYGSISGNYCTDKKATAVNGILGRGKNVITE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + I R + ++ L T+  +++ LN +KNLIGT LAGGIRSANAH+ANMLLA+YLATGQDAA
Sbjct: 121 LLIPREVVEQRLHTTAAQVVQLNIRKNLIGTLLAGGIRSANAHYANMLLAFYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           NIVEGSQG+T+A+  D  LYFSCT+PNLI+G VGNGK+   +  NL  LGC E+R+ G
Sbjct: 181 NIVEGSQGITHAEDRDGDLYFSCTLPNLIVGTVGNGKHASFVDENLERLGCREDRQPG 238


>gi|324120488|dbj|BAJ78978.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Nocardia
           cummidelens]
          Length = 238

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 140/238 (58%), Positives = 180/238 (75%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRSI  E ++A  A T +Q++  + AE+  V+  +S+F R + LH QI GNLLFLR EF
Sbjct: 1   MTRSILLEADDAYTAYTTVQQLEGRMAELQEVVSGSSRFARLIDLHHQITGNLLFLRFEF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
            TGDASGHNM T A+D +MD ILS    + YGS+SGN C+DKKATA+NGI+GRGKN + E
Sbjct: 61  TTGDASGHNMATLASDHLMDHILSTMPGVRYGSISGNYCTDKKATAVNGILGRGKNVITE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + + R + ++ L T+  +++ LN +KNLIGT LAGGIRSANAH+ANMLLA+YLATGQDAA
Sbjct: 121 LLVPREVVEQRLHTTAAQVVQLNIRKNLIGTLLAGGIRSANAHYANMLLAFYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           NIVEGSQG+T+A+  D  LYFSCT+PNLI+G VGNGK+   +  NL  LGC E+R+ G
Sbjct: 181 NIVEGSQGITHAEDRDGDLYFSCTLPNLIVGAVGNGKHASFVDENLERLGCREDRQPG 238


>gi|324120492|dbj|BAJ78980.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Nocardia fluminea]
          Length = 238

 Score =  298 bits (763), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 179/238 (75%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRSI  E ++A  A T +Q++  + AE+  V+  +S+F R + LH QI GNLLFLR EF
Sbjct: 1   MTRSILLEADDAYTAYTTVQQLEGRMAELQEVVAGSSRFARLIDLHHQITGNLLFLRFEF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
            TGDA+GHNM T A+D +MD ILS    + YGS+SGN C+DKKATA+NGI+GRGKN + E
Sbjct: 61  TTGDAAGHNMATLASDHLMDHILSTMPGVRYGSISGNYCTDKKATAVNGILGRGKNVITE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + I R + ++ L T+  ++  LN +KNLIGT LAGGIRSANAH+ANMLLAYYLATGQDAA
Sbjct: 121 LLIPREVVEQRLHTTAAQVTQLNIRKNLIGTLLAGGIRSANAHYANMLLAYYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           NIVEGSQG+T+A+  D  LYFSCT+PNLI+G VGNGK+   +  NL  LGC E+R+ G
Sbjct: 181 NIVEGSQGITHAEDRDGDLYFSCTLPNLIVGTVGNGKHASFVDENLERLGCREDRQPG 238


>gi|255519496|dbj|BAH90724.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Nocardia sp.
           Sp080513SC-18]
          Length = 238

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 177/238 (74%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRSI  E ++A  A T +Q++  + AE+  V+  +S F R + LH QI GNLLFLR EF
Sbjct: 1   MTRSILLEADDAYTAYTTVQQLEGRMAELQEVVAGSSHFARLIDLHHQITGNLLFLRFEF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
            TGDASGHNM T A+D +MD ILS    + YGS+SGN C+DKKATA+NGI+GRGKN + E
Sbjct: 61  TTGDASGHNMATLASDHLMDHILSTMPGVRYGSISGNYCTDKKATAVNGILGRGKNVITE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + I R +  + L T+  ++  LN +KNLIGT LAGGIRSANA++ANMLLAYYLATGQDAA
Sbjct: 121 LLIPREVVAQRLHTTAAQVTQLNIRKNLIGTLLAGGIRSANAYYANMLLAYYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           NIVEGSQG+T+A+  D  LYFSCT+PNLI+G VGNGK+   +  NL  LGC E+R+ G
Sbjct: 181 NIVEGSQGITHAEDRDGDLYFSCTLPNLIVGTVGNGKHASFVDENLERLGCREDRQPG 238


>gi|324120490|dbj|BAJ78979.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Nocardia
           xishanensis]
          Length = 238

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 175/238 (73%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRSI  E ++A  A T + ++     E+  V   +S+F + + LH QI GNLLFLR EF
Sbjct: 1   MTRSILLEADDAYTAHTTVTQLKASFTELQEVAASSSRFAKLIDLHHQITGNLLFLRFEF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
            TGDASGHNMVT A D +M+ IL+    L Y S+SGN C+DKKATA+NGI+GRGKN V E
Sbjct: 61  TTGDASGHNMVTLACDHLMNHILATRPGLRYVSISGNYCTDKKATAVNGILGRGKNVVTE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + I R + QK L T+  +++ LN +KNLIGT LAGGIRSANAH+ANMLLA+YLATGQDAA
Sbjct: 121 LLIPREVVQKRLHTTARQVVELNIRKNLIGTLLAGGIRSANAHYANMLLAFYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           NIVEGSQG+T+A+  D  LYFSCT+PNLILG VGNGK+   + +NLT LGC  +R  G
Sbjct: 181 NIVEGSQGITHAEDRDGDLYFSCTLPNLILGTVGNGKHQSFVDDNLTRLGCRADRDPG 238


>gi|324120484|dbj|BAJ78976.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Nocardia
           salmonicida]
          Length = 237

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 174/236 (73%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRSI  E ++A   L  +  +  + AE+  V+  TS+F R + LH QI GNLLFLR EF
Sbjct: 1   MTRSILLEADDAYTTLATVNTLKDRFAELQDVVAGTSRFARLIDLHHQINGNLLFLRFEF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
           +TGDASGHNM T A+D +MD IL+    + YGS+SGN C+DKKATA+NGI+GRGKN V E
Sbjct: 61  STGDASGHNMATLASDHLMDHILATLPGVRYGSISGNFCTDKKATAVNGILGRGKNVVTE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + I RA+ +  L T+  +++ LN +KNLIGT LAGGIRSANAH+ANMLLA+YLATGQDAA
Sbjct: 121 LLIPRAVVEARLHTTARQVVELNIRKNLIGTLLAGGIRSANAHYANMLLAFYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           NIVEGSQG+T+A+  D  LY SCT+PNLI+G VGNGK+   +  N   LGC  +R+
Sbjct: 181 NIVEGSQGVTHAEDRDGDLYLSCTLPNLIVGTVGNGKHASFVDENPERLGCRADRE 236


>gi|28628715|gb|AAO49322.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Streptomyces
           griseus]
          Length = 239

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 175/237 (73%)

Query: 78  NAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNM 137
           +A+ A TA + I  +  E+  V+   S+F   LQ+  +IAGNLLF+R EF+TGDASGHNM
Sbjct: 2   DAQTAYTAARTIEARIEELRDVVRTCSRFAELLQVRHEIAGNLLFVRFEFSTGDASGHNM 61

Query: 138 VTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQK 197
            T A+D ++  +L     + YGS+SGN C+DKKATAINGI+GRGKN V E+ + RA+ ++
Sbjct: 62  ATLASDTLLTHLLRTVPGIAYGSISGNYCTDKKATAINGILGRGKNVVTELLVPRAVVER 121

Query: 198 YLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLT 257
            L T+  +I+ LN +KNL+GT LAGGIRSANAH+ANMLL  YLATGQDAANIVEGSQG+T
Sbjct: 122 VLHTTAARIVELNIRKNLLGTLLAGGIRSANAHYANMLLGIYLATGQDAANIVEGSQGVT 181

Query: 258 YAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAI 314
            A+  D   YFSC +PNLI+G VGNGK +  ++ NLT LGC E+R  G+NARRLA I
Sbjct: 182 LAEDRDGDFYFSCNLPNLIVGTVGNGKGLEFVETNLTRLGCREDRAPGENARRLAVI 238


>gi|255519500|dbj|BAH90726.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Streptomyces sp.
           SpA080624GE-02]
          Length = 238

 Score =  281 bits (720), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 142/238 (59%), Positives = 178/238 (74%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRS+  E E+A+ A  A Q++ L+  ++ +V+   S+F   + +  +IA NLLF+R EF
Sbjct: 1   MTRSVLVEAEDAQAAYAATQQLDLRFQDLCKVVRTCSRFAELVAVRHEIAANLLFIRFEF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
           +TGDASGHNM T AADA++  IL     + Y S+SGN C+DKKATAINGI+GRGKN V+E
Sbjct: 61  STGDASGHNMATLAADALLTHILQTIPGISYSSISGNYCTDKKATAINGILGRGKNVVSE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + I RA+ +  L T+ EK+  LN +KNLIGT LAGGIRSANAHFANMLL +YLATGQDAA
Sbjct: 121 LLIPRALVESRLHTTAEKVAKLNVRKNLIGTLLAGGIRSANAHFANMLLGFYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           NIVEGSQGLT A+  D  LYFSCT+PNLI+G VGNGK IP ++ NL  LGC EER+ G
Sbjct: 181 NIVEGSQGLTVAEDRDGGLYFSCTLPNLIVGTVGNGKGIPFVEENLVRLGCREEREPG 238


>gi|255519494|dbj|BAH90723.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Streptomyces sp.
           SpC080624SC-11]
          Length = 238

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 178/238 (74%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRS+  E E+A+ A  A Q++ L+  ++ +V+   S++   + +  +IA NLLF+R EF
Sbjct: 1   MTRSVLVEAEDAQAAYAATQQLDLRFQDLCKVVRTCSRYAELVAVRHEIAANLLFIRFEF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
           +TGDASGHNM T AADA++  IL     + Y S+SGN C+DKKATAINGI+GRGKN V+E
Sbjct: 61  STGDASGHNMATLAADALLTHILQTIPGISYSSISGNYCTDKKATAINGILGRGKNVVSE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + I RA+ +  L T+ EK+  LN +KNLIGT LAGGIRSANAHFANMLL +YLATGQDAA
Sbjct: 121 LLIPRALVESRLHTTAEKVAKLNVRKNLIGTLLAGGIRSANAHFANMLLGFYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           NIVEGSQGLT A+  D  LYFSCT+PNLI+G VGNGK IP ++ NL  LGC EER+ G
Sbjct: 181 NIVEGSQGLTVAEDRDGDLYFSCTLPNLIVGTVGNGKGIPFVEENLVRLGCREEREPG 238


>gi|28628711|gb|AAO49320.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Streptomyces sp.
           SMA64]
          Length = 219

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/216 (57%), Positives = 163/216 (75%)

Query: 99  VIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHY 158
           ++   S+F R + +  +I  NLLF+R EF TGDASGHNM T A+D ++  +L     + Y
Sbjct: 3   LVRGCSRFARLIGVRHEINANLLFIRFEFPTGDASGHNMATLASDVLLKHLLETVPGISY 62

Query: 159 GSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGT 218
           GS+SGN C+DKKATA+NGI+GRGKN V E+ + RA+    L T+  +I+ LN +KNL+GT
Sbjct: 63  GSISGNYCTDKKATAVNGILGRGKNVVTELLVPRAVVADVLHTTAARIVELNIRKNLLGT 122

Query: 219 FLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILG 278
            LAGGIRSANAH+ANMLL +YLATGQDAANI+EGSQG+T A+  D  LYF+CT+PNLI+G
Sbjct: 123 LLAGGIRSANAHYANMLLGFYLATGQDAANIIEGSQGVTMAEDRDGDLYFACTLPNLIVG 182

Query: 279 CVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAI 314
            VGNGK +  ++ NLT LGC E+R+ G+NARRLA I
Sbjct: 183 TVGNGKGLGFVETNLTRLGCREDREPGENARRLAVI 218


>gi|255519504|dbj|BAH90728.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Streptomyces sp.
           Sp080513GE-23]
          Length = 238

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 168/238 (70%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRS+  E  +A  A TA + I  +  E+  V+   S+F + + +  +I  NLLF+R EF
Sbjct: 1   MTRSVLVEAVDAHTAYTAARIIEARIDELRDVVRGCSRFAQLIGIRHEINANLLFIRFEF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
           +TGDASGHNM T A+D ++  +L     + YGS+SGN C+DKKATA+NGI+GRGKN V E
Sbjct: 61  STGDASGHNMATLASDRLLAHLLRTIPGISYGSISGNYCTDKKATAVNGILGRGKNVVTE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + + R +    L ++  KI+ LN +KN++GT LAGGIRSANAHFANMLL +YLATGQDAA
Sbjct: 121 LLVPREVVTDVLHSTAAKIVELNIRKNMLGTLLAGGIRSANAHFANMLLGFYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           NIVEGSQG+ YA+  D  LYFSCT+PNLI+G VGNGK +  ++ NL  LGC  +R  G
Sbjct: 181 NIVEGSQGVVYAEDRDGDLYFSCTLPNLIVGTVGNGKGLGFVETNLNRLGCRADRAPG 238


>gi|255519498|dbj|BAH90725.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Micromonospora sp.
           Se080624GE-07]
          Length = 238

 Score =  265 bits (678), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 160/238 (67%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRS+F   ++A+ A  A  E+  +  E+  ++    +F   +  H +I  NLLFLR  F
Sbjct: 1   MTRSVFVRAKDAQTAYLASLEVDARFDELRDIVRTCGRFVELIGFHHEITANLLFLRFSF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
            TGDASGHNM T AADA++  IL     + YG +SGN C+DKKATAINGI+GRGKN V E
Sbjct: 61  TTGDASGHNMATLAADALLKHILDTIPGISYGPISGNYCTDKKATAINGILGRGKNVVTE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + + R I    L T+   I  LN  KN+IGT LAGG+RSANAH+ANMLL +YLATGQDAA
Sbjct: 121 LVVPREIVHDRLHTTAAAIAQLNVHKNMIGTLLAGGVRSANAHYANMLLGFYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           NIVEGSQG+T A+  D  LYFSCT+PNLI+G VGNGK +  +  NL  LGC   R  G
Sbjct: 181 NIVEGSQGVTVAEDRDGDLYFSCTLPNLIVGTVGNGKGLGFVAENLERLGCRAARDPG 238


>gi|255519502|dbj|BAH90727.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Micromonospora sp.
           SpC080624GE-05]
          Length = 235

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 159/235 (67%)

Query: 68  MTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
           MTRS+F   ++A+ A  A  E+  +  E+  ++    +F   +  H +I  NLLFLR  F
Sbjct: 1   MTRSVFVRAKDAQTAYLASLEVDARFDELRDIVRTCGRFVELIGFHHEITANLLFLRFSF 60

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
            TGDASGHNM T AADA++  IL     + YGS+SGN C+DKKATAINGI+GRGKN V E
Sbjct: 61  TTGDASGHNMATLAADALLKHILDTIPGISYGSISGNYCTDKKATAINGILGRGKNVVTE 120

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
           + + R I    L T+   I  LN  KN+IGT LAGG+RSANAH+ANMLL +YLATGQDAA
Sbjct: 121 LVVPREIVHDRLHTAAAAIAQLNVHKNMIGTLLAGGVRSANAHYANMLLGFYLATGQDAA 180

Query: 248 NIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           NIVEGSQG+T  +  D  LYFSCT+PNLI+G VGNGK +  +  NL  LGC   R
Sbjct: 181 NIVEGSQGVTVTEDRDGDLYFSCTLPNLIVGTVGNGKGLGFVAENLERLGCRAAR 235


>gi|238620024|ref|YP_002914850.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus M.16.4]
 gi|238381094|gb|ACR42182.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus M.16.4]
          Length = 410

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 132/341 (38%), Positives = 197/341 (57%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+  +GP+++ G+  +    VPLAT E  L  SV RG+  + L   G+RA ++ 
Sbjct: 68  IGAVQIPLGIVGPIRVNGDYAKGDFYVPLATTEGALIASVNRGSKAATLS-GGVRAKVLK 126

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F  ++ E     L+ I     +I  V + TS   R   +   + GN ++LR 
Sbjct: 127 DEMTRAPVFRFDSIEEIPNFLKFIEENVEKIKNVTDSTSSHGRLKSITPFVLGNNVWLRF 186

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NMVT A + V ++I   +      +VSGN+CSDKK T +N + GRGK  V
Sbjct: 187 SFETGDAMGMNMVTIAVEKVCEFIEENFPSADCLAVSGNMCSDKKQTNVNSLFGRGKTVV 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I + + +  LR++ + I  +N +KN +GT  AG +   NAHFAN++ A ++ATGQD
Sbjct: 247 AEALIKKDVIKNVLRSNAQLIHDINLRKNWLGTARAGSLSQFNAHFANIVTAIFIATGQD 306

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G T+ ++  + LY S T+P+L +G VG G  +P  K  L+ +G        
Sbjct: 307 VAQVVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQKEALSIMGVYGSGNPP 366

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             NA++ A I A+TVL GEL+LLAA  N  EL +AH RL R
Sbjct: 367 SSNAKKFAEIIASTVLSGELNLLAALANR-ELGKAHARLGR 406


>gi|229579374|ref|YP_002837772.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus Y.G.57.14]
 gi|229581866|ref|YP_002840265.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus Y.N.15.51]
 gi|228010088|gb|ACP45850.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus Y.G.57.14]
 gi|228012582|gb|ACP48343.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus Y.N.15.51]
 gi|323474919|gb|ADX85525.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus REY15A]
 gi|323477661|gb|ADX82899.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus HVE10/4]
          Length = 410

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 132/341 (38%), Positives = 197/341 (57%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+  +GP+++ G+  +    VPLAT E  L  SV RG+  + L   G+RA ++ 
Sbjct: 68  IGAVQIPLGIVGPIRVNGDYAKGDFYVPLATTEGALIASVNRGSKAATLS-GGVRAKVLK 126

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F  ++ E     L+ I     +I  V + TS   R   +   + GN ++LR 
Sbjct: 127 DEMTRAPVFRFDSIEEIPNFLKFIEENVEKIKNVADSTSSHGRLKSITPFVLGNNVWLRF 186

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NMVT A + V ++I   +      +VSGN+CSDKK T +N + GRGK  V
Sbjct: 187 SFETGDAMGMNMVTIAVEKVCEFIEENFPSADCLAVSGNMCSDKKQTNVNSLFGRGKTVV 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I + + +  LR++ + I  +N +KN +GT  AG +   NAHFAN++ A ++ATGQD
Sbjct: 247 AEALIKKDVIKNVLRSNAQLIHDINLRKNWLGTARAGSLSQFNAHFANIVTAIFIATGQD 306

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G T+ ++  + LY S T+P+L +G VG G  +P  K  L+ +G        
Sbjct: 307 VAQVVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQKEALSIMGVYGSGNPP 366

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             NA++ A I A+TVL GEL+LLAA  N  EL +AH RL R
Sbjct: 367 SSNAKKFAEIIASTVLSGELNLLAALANR-ELGKAHARLGR 406


>gi|229585121|ref|YP_002843623.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus M.16.27]
 gi|228020171|gb|ACP55578.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus M.16.27]
          Length = 410

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 132/341 (38%), Positives = 197/341 (57%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+  +GP+++ G+  +    VPLAT E  L  SV RG+  + L   G+RA ++ 
Sbjct: 68  IGAVQIPLGIVGPIRVNGDYAKGDFYVPLATTEGALIASVNRGSKAATLS-GGVRAKVLK 126

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F  ++ E     L+ I     +I  V + TS   R   +   + GN ++LR 
Sbjct: 127 DEMTRAPVFRLDSIEEIPNFLKFIEENVEKIKNVADSTSSHGRLKSITPFVLGNNVWLRF 186

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NMVT A + V ++I   +      +VSGN+CSDKK T +N + GRGK  V
Sbjct: 187 SFETGDAMGMNMVTIAVEKVCEFIEENFPSADCLAVSGNMCSDKKQTNVNSLFGRGKTVV 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I + + +  LR++ + I  +N +KN +GT  AG +   NAHFAN++ A ++ATGQD
Sbjct: 247 AEALIKKDVIKNVLRSNAQLIHDINLRKNWLGTARAGSLSQFNAHFANIVTAIFIATGQD 306

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G T+ ++  + LY S T+P+L +G VG G  +P  K  L+ +G        
Sbjct: 307 VAQVVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQKEALSIMGVYGSGNPP 366

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             NA++ A I A+TVL GEL+LLAA  N  EL +AH RL R
Sbjct: 367 SSNAKKFAEIIASTVLSGELNLLAALANR-ELGKAHARLGR 406


>gi|227830561|ref|YP_002832341.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus L.S.2.15]
 gi|284998056|ref|YP_003419823.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus L.D.8.5]
 gi|227457009|gb|ACP35696.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus L.S.2.15]
 gi|284445951|gb|ADB87453.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus L.D.8.5]
          Length = 410

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 132/341 (38%), Positives = 196/341 (57%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+  +GP+++ G+  +    VPLAT E  L  SV RG+  + L   G+RA ++ 
Sbjct: 68  IGAVQIPLGIVGPIRVNGDYAKGDFYVPLATTEGALIASVNRGSKAATLS-GGVRAKVLK 126

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F  ++ E     L+ I     +I  V + TS   R   +   + GN ++LR 
Sbjct: 127 NEMTRAPVFRFDSIEEIPNFLKFIEENVEKIKNVADSTSSHGRLKSITPFVLGNNVWLRF 186

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NMVT A + V ++I   +      +VSGN+CSDKK T +N + GRGK  V
Sbjct: 187 SFETGDAMGMNMVTIAVEKVCEFIEENFPSADCLAVSGNMCSDKKQTNVNSLFGRGKTVV 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I + + +  LR++ + I  +N +KN +GT  AG +   NAHFAN++ A ++ATGQD
Sbjct: 247 AEALIKKDVIKNVLRSNAQLIHDINLRKNWLGTARAGSLSQFNAHFANIVTAIFIATGQD 306

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G T+ ++  + LY S T+P+L +G VG G  +P  K  L+ +G        
Sbjct: 307 VAQVVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQKEALSIMGVYGSGNPP 366

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             NA++ A I A+TVL GEL+LLAA  N  EL +AH RL R
Sbjct: 367 SSNAKKFAEIIASTVLSGELNLLAALANR-ELGKAHARLGR 406


>gi|227827851|ref|YP_002829631.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus M.14.25]
 gi|227459647|gb|ACP38333.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           islandicus M.14.25]
          Length = 410

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 196/341 (57%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+  +GP+++ G+  +    VPLAT E  L  SV RG+  + L   G+RA ++ 
Sbjct: 68  IGAVQIPLGIVGPIRVNGDYAKGDFYVPLATTEGALIASVNRGSKAATLS-GGVRAKVLK 126

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F  ++ E     L+ I     +I  V + TS   R   +   + GN ++LR 
Sbjct: 127 DEMTRAPVFRFDSIEEIPNFLKFIEENVEKIKNVADSTSSHGRLKSITPFVLGNNVWLRF 186

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F T DA G NMVT A + V ++I   +      +VSGN+CSDKK T +N + GRGK  V
Sbjct: 187 SFETSDAMGMNMVTIAVEKVCEFIEENFPSADCLAVSGNMCSDKKQTNVNSLFGRGKTVV 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I + + +  LR++ + I  +N +KN +GT  AG +   NAHFAN++ A ++ATGQD
Sbjct: 247 AEALIKKDVIKNVLRSNAQLIHDINLRKNWLGTARAGSLSQFNAHFANIVTAIFIATGQD 306

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G T+ ++  + LY S T+P+L +G VG G  +P  K  L+ +G        
Sbjct: 307 VAQVVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQKEALSIMGVYGSGNPP 366

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             NA++ A I A+TVL GEL+LLAA  N  EL +AH RL R
Sbjct: 367 SSNAKKFAEIIASTVLSGELNLLAALANR-ELGKAHARLGR 406


>gi|242398602|ref|YP_002994026.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Thermococcus
           sibiricus MM 739]
 gi|242264995|gb|ACS89677.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Thermococcus
           sibiricus MM 739]
          Length = 407

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 134/344 (38%), Positives = 201/344 (58%), Gaps = 8/344 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G++ T+ID
Sbjct: 68  IGAVQIPMGVAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-TLTAAGGVKTTVID 126

Query: 66  ERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           ++MTR+   +  +A  A    Q  E  L+  +  + + + ++  +  ++   I GN L+L
Sbjct: 127 DKMTRAPLLKCPDARRAREVAQWVEENLEYLQ-EKAVSKVTRHGKLRRVKPHIIGNNLYL 185

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R EF TGDA G NMVT A++ +M  I   ++ + Y ++SGN+C DKK  A+N I GRGK 
Sbjct: 186 RFEFETGDAMGMNMVTIASEEIMKVIEEHFADVKYLALSGNLCVDKKPNAMNFINGRGKT 245

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            +AE  + R I ++ L+T+PE I  +N +KNL+G+  AG     NAHF N++ A +LATG
Sbjct: 246 VIAEAVVPREIVERKLKTTPELIAEVNYRKNLVGSAQAGSY-GFNAHFGNIVGAIFLATG 304

Query: 244 QDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EE 301
           QD A I EGS G+T A++  +  LY S T+P+L +G VG G  +P  +  L+ +G     
Sbjct: 305 QDEAQITEGSHGITLAEVTPEGDLYISITMPSLEIGTVGGGTRVPTQREALSIMGVAGGG 364

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NA++ A I A+ VL GELSLLAA      L +AH  L R
Sbjct: 365 NPPGTNAKKFAEIVASAVLAGELSLLAA-IAAKHLAKAHKELGR 407


>gi|284174780|ref|ZP_06388749.1| 3 hydroxy 3 methylglutaryl coenzyme a reductase [Sulfolobus
           solfataricus 98/2]
          Length = 409

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 197/341 (57%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+  +GP+++ G+  +    VP+AT E  L  SV RG     L   G+RA ++ 
Sbjct: 67  IGAIQIPLGIVGPIRVNGDYAKGDFYVPMATTEGALIASVNRGIKAVTLS-GGVRAKVLK 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F+ ++ E     L+ I     +I  +   TS   +   +   + GN ++LR 
Sbjct: 126 DEMTRAPVFKFDSIEQIPNFLKFIEENLEKIRNIANSTSHHGKLKSITPFVLGNNVWLRF 185

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NMVT A + V ++I   +      +VSGN+CSDKK T +N + GRGK  V
Sbjct: 186 SFETGDAMGMNMVTIAVEKVCEFIEENFPSADCLAVSGNMCSDKKQTNVNSLFGRGKTVV 245

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I + + +  L ++ + I  +N +KN +GT  AG +   NAHFAN++ A ++ATGQD
Sbjct: 246 AEALIKKDVIRNILHSNAQLIHDINLRKNWLGTARAGSLSQFNAHFANIVTAIFIATGQD 305

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A IVE S G T+ ++  + LY S T+P+L +G VG G  +P  K  L+ +G        
Sbjct: 306 VAQIVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQKEALSIMGVYGSGNPP 365

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA++LA I A+TVL GEL+LLAA +N  EL +AH +L R
Sbjct: 366 GSNAKKLAEIIASTVLSGELNLLAALSNK-ELGKAHAKLGR 405


>gi|15897456|ref|NP_342061.1| 3 hydroxy 3 methylglutaryl coenzyme a reductase [Sulfolobus
           solfataricus P2]
 gi|14424455|sp|O08424|HMDH_SULSO RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|6015941|emb|CAB57768.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Sulfolobus
           solfataricus P2]
 gi|13813693|gb|AAK40851.1| 3 hydroxy 3 methylglutaryl coenzyme a reductase [Sulfolobus
           solfataricus P2]
 gi|261602226|gb|ACX91829.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Sulfolobus
           solfataricus 98/2]
          Length = 409

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 197/341 (57%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+  +GP+++ G+  +    VP+AT E  L  SV RG     L   G+RA ++ 
Sbjct: 67  IGAIQIPLGIVGPIRVNGDYAKGDFYVPMATTEGALIASVNRGIKAVTLS-GGVRAKVLK 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F+ ++ E     L+ I     +I  +   TS   +   +   + GN ++LR 
Sbjct: 126 DEMTRAPVFKFDSIEQIPNFLKFIEENLEKIRNIANSTSHHGKLKSITPFVLGNNVWLRF 185

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NMVT A + V ++I   +      +VSGN+CSDKK T +N + GRGK  V
Sbjct: 186 SFETGDAMGMNMVTIAVEKVCEFIEENFPSADCLAVSGNMCSDKKQTNVNSLFGRGKTVV 245

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I + + +  L ++ + I  +N +KN +GT  AG +   NAHFAN++ A ++ATGQD
Sbjct: 246 AEALIKKDVIRNILHSNAQLIHDINLRKNWLGTARAGSLSQFNAHFANIVTAIFIATGQD 305

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A IVE S G T+ ++  + LY S T+P+L +G VG G  +P  K  L+ +G        
Sbjct: 306 VAQIVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQKEALSIMGVYGSGNPP 365

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA++LA I A+TVL GEL+LLAA +N  EL +AH +L R
Sbjct: 366 GSNAKKLAEIIASTVLSGELNLLAALSNK-ELGKAHAKLGR 405


>gi|332796986|ref|YP_004458486.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Acidianus
           hospitalis W1]
 gi|332694721|gb|AEE94188.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Acidianus
           hospitalis W1]
          Length = 409

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 197/341 (57%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  I +P+  +GP+K+ G+  +    VPLAT E  L  SV RG   ++    G +  +I 
Sbjct: 67  IGGIQIPVGIVGPLKVNGDYAKGNFYVPLATTEGALIASVNRGCK-AITKAGGAKVKIIF 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + M R+  F+  N +  +  LQ I     +I  V E T+   +  ++   + GN ++LR 
Sbjct: 126 DGMARAPIFKLPNIDSVVNFLQWINKNLDKIKEVAESTTSHGKLKEIQPFVLGNNVWLRF 185

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NM T A++A+ ++I S+++     +VSGN+CSDKK + +N I GRGK  +
Sbjct: 186 VFETGDAMGMNMATIASEAICNFIESEFTEAKCIAVSGNMCSDKKQSMVNSIFGRGKTVI 245

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I   I ++ L T+ E I  +N +KNL+G+  AG +   NAHFAN++ A +LATGQD
Sbjct: 246 AETLIPSTILKEVLHTTAEAIHEVNLRKNLLGSARAGNVYQFNAHFANIIAAIFLATGQD 305

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G T+ ++  + LY S T+P+L +G VG G  +P  +  L+ +G        
Sbjct: 306 MAQVVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQREALSIMGVAGGGNPP 365

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G N ++ A I A+TVL GEL+LL+A +N  EL  AH  L R
Sbjct: 366 GSNVKKFAEIIASTVLAGELNLLSALSNK-ELGRAHKMLGR 405


>gi|2130564|gb|AAC45370.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Sulfolobus
           solfataricus P2]
          Length = 409

 Score =  226 bits (575), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 197/341 (57%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+  +GP+++ G+  +    VP+AT E  L  SV RG     L   G+RA ++ 
Sbjct: 67  IGAIQIPLGIVGPIRVNGDYAKGDFYVPMATTEGALIASVNRGIKAVTLS-GGVRAKVLK 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F+ ++ E     L+ I     +I  +   TS   +   +   + GN ++LR 
Sbjct: 126 DEMTRAPVFKFDSIEQIPNFLKFIEENLEKIRNIANSTSHHGKLKSITPFVLGNNVWLRF 185

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NMVT A + V ++I   +      +VSGN+CSDKK T +N + GRGK  +
Sbjct: 186 SFETGDAMGMNMVTIAVEKVCEFIEENFPSADCLAVSGNMCSDKKQTNVNSLFGRGKTVL 245

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I + + +  L ++ + I  +N +KN +GT  AG +   NAHFAN++ A ++ATGQD
Sbjct: 246 AEALIKKDVIRNILHSNAQLIHDINLRKNWLGTARAGSLSQFNAHFANIVTAIFIATGQD 305

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A IVE S G T+ ++  + LY S T+P+L +G VG G  +P  K  L+ +G        
Sbjct: 306 VAQIVESSSGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQKEALSIMGVYGSGNPP 365

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA++LA I A+TVL GEL+LLAA +N  EL +AH +L R
Sbjct: 366 GSNAKKLAEIIASTVLSGELNLLAALSNK-ELGKAHAKLGR 405


>gi|212223545|ref|YP_002306781.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Thermococcus onnurineus
           NA1]
 gi|212008502|gb|ACJ15884.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Thermococcus onnurineus
           NA1]
          Length = 408

 Score =  225 bits (574), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 201/346 (58%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G++ T+I 
Sbjct: 69  IGVVQIPMGVAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTAAGGVKTTIIS 127

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQ-TSQFTRFLQLHSQ---IAGNLL 121
           ++MTR+   +  +A  A    + +   KA I  + E+  S+ TR  +L      I GN L
Sbjct: 128 DKMTRAPLLKCPDARKAREVAEWV---KANIGYLQEKAVSKVTRHGKLRDVKPFIVGNNL 184

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           +LR EF TGDA G NMVT +++ +M  I  ++S + Y ++SGN+C DKK  A+N I GRG
Sbjct: 185 YLRFEFETGDAMGMNMVTISSEEIMKVIEEEFSDVKYLALSGNLCVDKKPNAMNFINGRG 244

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K  +AE  I R I +K L+T+PE I  +N +KNL+G+  AG     NAHFAN++ A +LA
Sbjct: 245 KTVIAEAIIPREIVEKKLKTTPELIAEVNYRKNLVGSAQAGSY-GFNAHFANIVGAIFLA 303

Query: 242 TGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
           TGQD A I EG+ G+T A++  +  LY S T+P+L +G VG G  +P  +  L+ +G   
Sbjct: 304 TGQDEAQITEGAHGITLAEVTPEGDLYISITMPSLEIGTVGGGTRVPTQREALSIMGVAG 363

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NA++ A I A  VL GELSLLAA      L +AH  L R
Sbjct: 364 GGDPPGTNAKKFAEIIAGAVLAGELSLLAAIAAK-HLAKAHKELGR 408


>gi|57640849|ref|YP_183327.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Thermococcus kodakarensis
           KOD1]
 gi|57159173|dbj|BAD85103.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Thermococcus kodakarensis
           KOD1]
          Length = 408

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 137/352 (38%), Positives = 197/352 (55%), Gaps = 24/352 (6%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G++ TLID
Sbjct: 69  IGVVQIPMGVAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTAAGGVKTTLID 127

Query: 66  ERMTRSIFFETENAEMA----------LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQ 115
           ++MTR+   +  +A  A          L  LQE         + + + ++  +   +   
Sbjct: 128 DKMTRAPLLKCPDARRAREVAEWVKNNLDYLQE---------KAVSKVTRHGKLRGVRPF 178

Query: 116 IAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAIN 175
           I GN L+LR EF TGDA G NMVT A++ +M  I  ++  + Y ++SGN+C DKK  A+N
Sbjct: 179 IVGNNLYLRFEFETGDAMGMNMVTIASEEIMKVIEEEFPDVKYLALSGNLCVDKKPNAMN 238

Query: 176 GIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANML 235
            I GRGK  +AE  I R I ++ L+T+PE I  +N +KNL+G+  AG     NAHF N++
Sbjct: 239 FINGRGKTVIAEAVIPRKIVEEKLKTTPELIAEVNYRKNLVGSAQAGSY-GFNAHFGNIV 297

Query: 236 LAYYLATGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLT 294
            A +LATGQD A I EGS G+T A++  +  LY S T+P+L +G VG G  +P  +  L+
Sbjct: 298 GAIFLATGQDEAQITEGSHGITLAEVTPEGDLYISITMPSLEIGTVGGGTRVPTQREALS 357

Query: 295 ALGCI-EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +G        G NA++ A I A  VL GELSLLAA      L +AH  L R
Sbjct: 358 IMGVAGGGDPPGTNAKKFAEIVAGAVLAGELSLLAA-IAAKHLAKAHKELGR 408


>gi|228917965|ref|NP_143640.2| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Pyrococcus
           horikoshii OT3]
          Length = 408

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 134/336 (39%), Positives = 190/336 (56%), Gaps = 23/336 (6%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G+  TLID
Sbjct: 69  IGVVQIPMGVAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTEAGGVVTTLID 127

Query: 66  ERMTRSIFFETENAEMA----------LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQ 115
           ++MTR+      NA  A          L  LQE         + + + ++  +   +   
Sbjct: 128 DKMTRAPLIRCPNARRAREVAKWVEENLDYLQE---------KAVSKVTRHGKLRGVKPF 178

Query: 116 IAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAIN 175
           I GN L+LR EF TGDA G NMVT A++ +M  I  ++  + Y ++SGN+C DKK  A+N
Sbjct: 179 IVGNNLYLRFEFETGDAMGMNMVTIASEEIMKVIEEEFPDVRYLALSGNLCVDKKPNAVN 238

Query: 176 GIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANML 235
            I+GRGK  +AE  + R I +K L+T+PE I  +N  KNL+G+  AG     NAHFAN++
Sbjct: 239 FILGRGKTVIAEAVVPRKIVEKKLKTTPELIAEVNYFKNLVGSAQAGSY-GFNAHFANIV 297

Query: 236 LAYYLATGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLT 294
            A +LATGQD A I EG+ G+T A++  D  LY S T+P+L +G VG G  +P+ +  L 
Sbjct: 298 GAIFLATGQDEAQITEGAHGITIAEVTPDGDLYISITMPSLEIGTVGGGTRVPSQREALE 357

Query: 295 ALGCI-EERKTGDNARRLAAICAATVLCGELSLLAA 329
            +G        G NA++ A I A  VL GELSLLAA
Sbjct: 358 IMGVAGGGDPPGINAKKFAEIVAGAVLAGELSLLAA 393


>gi|3258241|dbj|BAA30924.1| 341aa long hypothetical 3-hydroxy-3-methylglutaryl coenzyme A
           reductase [Pyrococcus horikoshii OT3]
          Length = 341

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 134/336 (39%), Positives = 190/336 (56%), Gaps = 23/336 (6%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G+  TLID
Sbjct: 2   IGVVQIPMGVAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTEAGGVVTTLID 60

Query: 66  ERMTRSIFFETENAEMA----------LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQ 115
           ++MTR+      NA  A          L  LQE         + + + ++  +   +   
Sbjct: 61  DKMTRAPLIRCPNARRAREVAKWVEENLDYLQE---------KAVSKVTRHGKLRGVKPF 111

Query: 116 IAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAIN 175
           I GN L+LR EF TGDA G NMVT A++ +M  I  ++  + Y ++SGN+C DKK  A+N
Sbjct: 112 IVGNNLYLRFEFETGDAMGMNMVTIASEEIMKVIEEEFPDVRYLALSGNLCVDKKPNAVN 171

Query: 176 GIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANML 235
            I+GRGK  +AE  + R I +K L+T+PE I  +N  KNL+G+  AG     NAHFAN++
Sbjct: 172 FILGRGKTVIAEAVVPRKIVEKKLKTTPELIAEVNYFKNLVGSAQAGSY-GFNAHFANIV 230

Query: 236 LAYYLATGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLT 294
            A +LATGQD A I EG+ G+T A++  D  LY S T+P+L +G VG G  +P+ +  L 
Sbjct: 231 GAIFLATGQDEAQITEGAHGITIAEVTPDGDLYISITMPSLEIGTVGGGTRVPSQREALE 290

Query: 295 ALGCI-EERKTGDNARRLAAICAATVLCGELSLLAA 329
            +G        G NA++ A I A  VL GELSLLAA
Sbjct: 291 IMGVAGGGDPPGINAKKFAEIVAGAVLAGELSLLAA 326


>gi|315230165|ref|YP_004070601.1| hydroxymethylglutaryl-CoA reductase [Thermococcus barophilus MP]
 gi|315183193|gb|ADT83378.1| hydroxymethylglutaryl-CoA reductase [Thermococcus barophilus MP]
          Length = 408

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 135/352 (38%), Positives = 198/352 (56%), Gaps = 24/352 (6%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP++I G   + +  +PLAT E  L  SV RG   ++    G++ T+I 
Sbjct: 69  IGVVQIPMGVAGPLRINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTAAGGVKTTIIG 127

Query: 66  ERMTRSIFFETENAEMA----------LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQ 115
           ++MTR+   +  +A  A          +  LQE+ + K          ++  +   +   
Sbjct: 128 DKMTRAPLLKCPDARRAREVAEWVKENIDYLQEVAVSK---------VTRHGKLKDVKPF 178

Query: 116 IAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAIN 175
           I GN L+LR EF TGDA G NMVT A++ +M  I  ++  + Y ++SGN+C DKK  A+N
Sbjct: 179 IVGNNLYLRFEFETGDAMGMNMVTIASEEIMKVIEEKFPDVKYLALSGNLCVDKKPNALN 238

Query: 176 GIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANML 235
            I+GRGK  +AE  I R I +K L+T+PE I  +N +KNL+G+  AG     NAHFAN++
Sbjct: 239 FILGRGKTVIAEAVIPREIVEKKLKTTPELIAEVNYRKNLVGSAQAGSY-GFNAHFANIV 297

Query: 236 LAYYLATGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLT 294
            A +LATGQD A I EG+ G+T A++  +  LY S T+P+L +G VG G  +P  +  L+
Sbjct: 298 GAIFLATGQDEAQITEGAHGITLAEVTPEGDLYISITMPSLEIGTVGGGTRVPPQREALS 357

Query: 295 ALGCI-EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +G        G NA++ A I A  VL GELSLLAA      L +AH  L R
Sbjct: 358 IMGVAGGGEPAGTNAKKFAEIIAGAVLAGELSLLAA-IAAKHLAKAHKELGR 408


>gi|11132820|sp|O59469|HMDH_PYRHO RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
          Length = 413

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 137/338 (40%), Positives = 192/338 (56%), Gaps = 27/338 (7%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G+  TLID
Sbjct: 74  IGVVQIPMGVAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTEAGGVVTTLID 132

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQ---------TSQFTRFLQLHSQ- 115
           ++MTR+      NA  A            E+A+ +E+          S+ TR  +L    
Sbjct: 133 DKMTRAPLIRCPNARRA-----------REVAKWVEENLDYLQEKAVSKVTRHGKLRGVK 181

Query: 116 --IAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATA 173
             I GN L+LR EF TGDA G NMVT A++ +M  I  ++  + Y ++SGN+C DKK  A
Sbjct: 182 PFIVGNNLYLRFEFETGDAMGMNMVTIASEEIMKVIEEEFPDVRYLALSGNLCVDKKPNA 241

Query: 174 INGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFAN 233
           +N I+GRGK  +AE  + R I +K L+T+PE I  +N  KNL+G+  AG     NAHFAN
Sbjct: 242 VNFILGRGKTVIAEAVVPRKIVEKKLKTTPELIAEVNYFKNLVGSAQAGSY-GFNAHFAN 300

Query: 234 MLLAYYLATGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNN 292
           ++ A +LATGQD A I EG+ G+T A++  D  LY S T+P+L +G VG G  +P+ +  
Sbjct: 301 IVGAIFLATGQDEAQITEGAHGITIAEVTPDGDLYISITMPSLEIGTVGGGTRVPSQREA 360

Query: 293 LTALGCI-EERKTGDNARRLAAICAATVLCGELSLLAA 329
           L  +G        G NA++ A I A  VL GELSLLAA
Sbjct: 361 LEIMGVAGGGDPPGINAKKFAEIVAGAVLAGELSLLAA 398


>gi|240103203|ref|YP_002959512.1| 3-hydroxy-3-methylglutaryl CoA reductase (hmgA) [Thermococcus
           gammatolerans EJ3]
 gi|239910757|gb|ACS33648.1| 3-hydroxy-3-methylglutaryl CoA reductase (hmgA) [Thermococcus
           gammatolerans EJ3]
          Length = 406

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 199/346 (57%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G++ TLID
Sbjct: 67  IGVVQIPMGVAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTEAGGVKTTLID 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQ-TSQFTRFLQLHSQ---IAGNLL 121
           ++MTR+   +  +A  A    + +   K  I  + E+  S+ TR  +L      I GN L
Sbjct: 126 DKMTRAPLLKCPDARRAREVAEWV---KENIDYLQEKAVSKVTRHGKLRDVKPFIVGNNL 182

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           +LR EF TGDA G NMVT A++ +M  I  ++  + Y ++SGN+C DKK  A+N I GRG
Sbjct: 183 YLRFEFETGDAMGMNMVTIASEEIMKVIEEEFPDVKYLALSGNLCVDKKPNAMNFINGRG 242

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K  +AE  + R I ++ L+T+PE I  +N +KNL+G+  AG     NAHF N++ A +LA
Sbjct: 243 KTVIAEAIVPREIVERKLKTTPELIAEVNYRKNLVGSAQAGSY-GFNAHFGNIVGAIFLA 301

Query: 242 TGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
           TGQD A I EGS G+T A++  +  LY S T+P+L +G VG G  +P  +  L+ +G   
Sbjct: 302 TGQDEAQITEGSHGITLAEVTPEGDLYISITMPSLEIGTVGGGTRVPTQREALSIMGVAG 361

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NA++ A I A  VL GELSLLAA      L +AH  L R
Sbjct: 362 GGDPPGTNAKKFAEIVAGAVLAGELSLLAA-IAAKHLAKAHKELGR 406


>gi|18978220|ref|NP_579577.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pyrococcus
           furiosus DSM 3638]
 gi|18894033|gb|AAL81972.1| 3-hydroxy-3-methylglutaryl-coenzyme a reductase (hmg-CoAreductase)
           [Pyrococcus furiosus DSM 3638]
          Length = 408

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 133/336 (39%), Positives = 190/336 (56%), Gaps = 23/336 (6%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G+  TLID
Sbjct: 69  IGVVQIPMGIAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTEAGGVYTTLID 127

Query: 66  ERMTRSIFFETENAEMA----------LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQ 115
           ++MTR+   +  NA  A          L  LQE         + + + ++  +   +   
Sbjct: 128 DKMTRAPLLKCPNARRAREVAEWVKNNLDYLQE---------KAVSKVTRHGKLRGVKPF 178

Query: 116 IAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAIN 175
           I G  L+LR EF TGDA G NMVT A++ +M  I  ++  + Y ++SGN+C DKK  A+N
Sbjct: 179 IVGRNLYLRFEFETGDAMGMNMVTIASEEIMKVIEEEFPDVKYLALSGNLCVDKKPNALN 238

Query: 176 GIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANML 235
            I+GRGK  +AE  + R I +K L+T+PE I  +N  KNL+G+  AG     NAHFAN++
Sbjct: 239 FILGRGKTIIAEAVVPREIVKKKLKTTPELIAEVNYLKNLVGSAQAGSY-GFNAHFANIV 297

Query: 236 LAYYLATGQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLT 294
            A +LATGQD A I EG+ G+T A++ +D  LY S T+P+L +G VG G  +P  +  L 
Sbjct: 298 GAIFLATGQDEAQITEGAHGITLAEVTEDGDLYISITMPSLEIGTVGGGTRVPPQREALE 357

Query: 295 ALGCI-EERKTGDNARRLAAICAATVLCGELSLLAA 329
            +G        G NA++ A I A  VL GELSLLAA
Sbjct: 358 IMGVAGGGDPPGMNAKKFAEIVAGAVLAGELSLLAA 393


>gi|254173758|ref|ZP_04880430.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Thermococcus sp. AM4]
 gi|214032450|gb|EEB73280.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Thermococcus sp. AM4]
          Length = 406

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 138/346 (39%), Positives = 199/346 (57%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G++ TLID
Sbjct: 67  IGVVQIPMGVAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTEAGGVKTTLID 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQ-TSQFTRFLQLHSQ---IAGNLL 121
           ++MTR+   +  +A  A    + +   K  I  + E+  S+ TR  +L      I GN L
Sbjct: 126 DKMTRAPLLKCPDARRAREVAEWV---KENIDYLQEKAVSKVTRHGKLRDVKPFIVGNNL 182

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           +LR EF TGDA G NMVT +++ +M  I  ++  + Y ++SGN+C DKK  A+N I GRG
Sbjct: 183 YLRFEFETGDAMGMNMVTISSEEIMKVIGEEFPDVRYLALSGNLCVDKKPNAMNFINGRG 242

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K  +AE  + R I ++ L+T+PE I  +N +KNL+G+  AG     NAHF N++ A +LA
Sbjct: 243 KTVIAEAIVPREIVERKLKTTPELIAEVNYRKNLVGSAQAGSY-GFNAHFGNIVGAIFLA 301

Query: 242 TGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
           TGQD A I EGS G+T A++  +  LY S T+P+L +G VG G  +P  +  L+ +G   
Sbjct: 302 TGQDEAQITEGSHGITLAEVTPEGDLYISITMPSLEIGTVGGGTRVPTQREALSIMGVAG 361

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NA++ A I A  VL GELSLLAA      L +AH  L R
Sbjct: 362 GGDPPGTNAKKFAEIVAGAVLAGELSLLAA-IAAKHLAKAHKELGR 406


>gi|14520580|ref|NP_126055.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pyrococcus abyssi
           GE5]
 gi|11133148|sp|Q9V1R3|HMDH_PYRAB RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|5457796|emb|CAB49286.1| mvaA-3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pyrococcus
           abyssi GE5]
          Length = 411

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 131/331 (39%), Positives = 191/331 (57%), Gaps = 13/331 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G+  T++D
Sbjct: 72  IGVVQIPMGVAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTEAGGVVTTILD 130

Query: 66  ERMTRSIFFETENAEMALTALQEIT-----LKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           ++MTR+      NA  A    + +      L++  +A+V    ++  +   +   I GN 
Sbjct: 131 DKMTRAPLIRCPNARRAREVAEWVKENLNYLQEKAVAKV----TRHGKLRDVKPFIVGNN 186

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           L+LR EF TGDA G NMVT A++ +M  I  ++  + Y ++SGN+C DKK  A+N I+GR
Sbjct: 187 LYLRFEFETGDAMGMNMVTIASEEIMKVIEEEFPDVRYLALSGNLCVDKKPNAVNFILGR 246

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK  VAE  + R I +K L+T+PE I  +N  KNL+G+  AG     NAHF N++ A +L
Sbjct: 247 GKTVVAEAIVPREIVEKKLKTTPELIAEVNYFKNLVGSAQAGSY-GFNAHFGNIVGAIFL 305

Query: 241 ATGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
           ATGQD A I EGS G+T A++  +  LY S T+P+L +G VG G  +P  +  L+ +G  
Sbjct: 306 ATGQDEAQITEGSHGITIAEVTPEGDLYISITMPSLEIGTVGGGTRVPTQREALSIMGVA 365

Query: 300 -EERKTGDNARRLAAICAATVLCGELSLLAA 329
                 G NA++ A I A  VL GELSLLAA
Sbjct: 366 GGGDPPGVNAKKFAEIVAGAVLAGELSLLAA 396


>gi|332158046|ref|YP_004423325.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Pyrococcus sp.
           NA2]
 gi|331033509|gb|AEC51321.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Pyrococcus sp.
           NA2]
          Length = 408

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 187/329 (56%), Gaps = 9/329 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +PM   GP+KI G   + +  +PLAT E  L  SV RG   ++    G+  TL+D
Sbjct: 69  IGVVQIPMGVAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCS-ALTEAGGVVTTLLD 127

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQ---IAGNLLF 122
           ++MTR+      NA  A      +      + R  E  S+ TR  +L      I GN L+
Sbjct: 128 DKMTRAPLIRCPNARRAREVAHWVEENIDYLQR--EAVSKVTRHGKLRGVRPFIVGNNLY 185

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           LR EF TGDA G NMVT A++ +M  I   +  + Y ++SGN+C DKK  A+N I+GRGK
Sbjct: 186 LRFEFETGDAMGMNMVTIASEEIMKVIEKHFPDVKYLALSGNLCVDKKPNAVNFILGRGK 245

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
             +AE  + R I ++ L+T+PE I  +N  KNL+G+  AG     NAHFAN++ A +LAT
Sbjct: 246 TVIAEAIVPREIVERKLKTTPELIAEVNYLKNLVGSAQAGSY-GFNAHFANIVGAIFLAT 304

Query: 243 GQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-E 300
           GQD A I EG+ G+T A++  +  LY S T+P+L +G VG G  +P  +  L  +G    
Sbjct: 305 GQDEAQITEGAHGITLAEVTPEGDLYISITMPSLEIGTVGGGTRVPTQREALEIMGVAGG 364

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAA 329
               G NA++ A I A  VL GELSLLAA
Sbjct: 365 GDPPGVNAKKFAEIVAGAVLAGELSLLAA 393


>gi|148642287|ref|YP_001272800.1| hydroxymethylglutaryl-CoA (HMG-CoA) reductase, HmgA
           [Methanobrevibacter smithii ATCC 35061]
 gi|148551304|gb|ABQ86432.1| hydroxymethylglutaryl-CoA (HMG-CoA) reductase, HmgA
           [Methanobrevibacter smithii ATCC 35061]
          Length = 400

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 135/341 (39%), Positives = 195/341 (57%), Gaps = 9/341 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+   GP+KI G+  + +V VPLAT E  L  S+ RGA  ++    G+ A +I 
Sbjct: 67  IGTIQLPVGVAGPLKINGDYCKREVYVPLATSEGALVASINRGAS-TITSSGGVNAHVIS 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS-QIAGNLLFLR 124
           + MTR+   +T +A  AL   Q       E+  + E T+   + L++    I G  ++ R
Sbjct: 126 DIMTRAPVIKTSSASDALKIKQWFIDNFQELKEIAESTTSHGKLLKIDPILIVGTYVYPR 185

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             ++TGD+ G NMVT A++ ++D +  + +  H  ++SGN+C DKK  AIN I GRGK+ 
Sbjct: 186 FVYSTGDSMGMNMVTIASEKILDKLADETTGRHI-ALSGNVCVDKKPAAINMIEGRGKSI 244

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VA+I I   I  K L+T+ E I  +N  KNLIG+  AG + + NAH+ANM+ A +LATGQ
Sbjct: 245 VADILIPEEIVNKKLKTTAEAIEEVNIAKNLIGSAAAGSM-AYNAHYANMVAAIFLATGQ 303

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           DAA+ VEGS G+T A+  +  LYFS  +P++ +  VG G ++      L  LG     K 
Sbjct: 304 DAAHAVEGSLGITTAENRNGDLYFSVNLPDVPIATVGGGTSLETAHEGLDILGVAGSNK- 362

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              AR    I AATVL GELSL+ A    G L  AH  L R
Sbjct: 363 ---AREFGEIVAATVLAGELSLVGALA-AGHLARAHQELGR 399


>gi|261403579|ref|YP_003247803.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanocaldococcus
           vulcanius M7]
 gi|261370572|gb|ACX73321.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanocaldococcus
           vulcanius M7]
          Length = 405

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 139/355 (39%), Positives = 197/355 (55%), Gaps = 17/355 (4%)

Query: 1   MHMKK-----VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLC 55
           M MKK     + +I +P+ + GP+KI G   +    +PLAT E  L  SV RG  I   C
Sbjct: 58  MAMKKNIENMIGAIQIPLGFAGPLKINGEYAKGDFYIPLATTEGALVASVNRGCSIITKC 117

Query: 56  PDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS- 114
             G+   +ID++MTR+   +T++   A+     I      I  V E T++  + +++   
Sbjct: 118 -GGVDVRVIDDKMTRAPCLKTKSVVDAMKVKDWILENFERIKEVAESTTRHGKLVRIDPI 176

Query: 115 QIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWS----YLHYGSVSGNICSDKK 170
            I G  ++ R  F TGDA G NMVT A +   ++I  +      ++   +VSGN+C DKK
Sbjct: 177 LIVGRNIYPRFVFKTGDAMGMNMVTIATEKACEFIEGELRNEGVFVKTVAVSGNVCVDKK 236

Query: 171 ATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAH 230
            + +N I GRGK  VAEI ++     KYL+T+PE I  +N  KN IG+  A      NAH
Sbjct: 237 PSGMNLINGRGKTVVAEIYLSEKEVNKYLKTTPEAIAEVNRLKNYIGS-AASNSMGFNAH 295

Query: 231 FANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIK 290
           +AN++ A +LATGQD A+IVEGS G+T A++ D+ LYFS T+P+L LG VG G  +   +
Sbjct: 296 YANIVGAIFLATGQDEAHIVEGSLGITMAEVEDEGLYFSITLPDLPLGTVGGGTRVETQR 355

Query: 291 NNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             L  LGC  + K    A + A I    VL GELSLL A  + G L +AH  L R
Sbjct: 356 ECLEMLGCYGDGK----ALKFAEIVGGAVLAGELSLLGALAS-GHLGKAHQELGR 405


>gi|222444541|ref|ZP_03607056.1| hypothetical protein METSMIALI_00153 [Methanobrevibacter smithii
           DSM 2375]
 gi|261350920|ref|ZP_05976337.1| hydroxymethylglutaryl-CoA reductase [Methanobrevibacter smithii DSM
           2374]
 gi|222434106|gb|EEE41271.1| hypothetical protein METSMIALI_00153 [Methanobrevibacter smithii
           DSM 2375]
 gi|288860258|gb|EFC92556.1| hydroxymethylglutaryl-CoA reductase [Methanobrevibacter smithii DSM
           2374]
          Length = 400

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 135/341 (39%), Positives = 195/341 (57%), Gaps = 9/341 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+   GP+KI G+  + +V VPLAT E  L  S+ RGA  ++    G+ A +I 
Sbjct: 67  IGTIQLPVGVAGPLKINGDYCKREVYVPLATSEGALVASINRGAS-TITSSGGVNAHVIS 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS-QIAGNLLFLR 124
           + MTR+   +T +A  AL   Q       E+  + E T+   + L++    I G  ++ R
Sbjct: 126 DIMTRAPVIKTSSATDALKIKQWFIDNFRELKEIAESTTSHGKLLKIDPILIVGTYVYPR 185

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             ++TGD+ G NMVT A++ ++D +  + +  H  ++SGN+C DKK  AIN I GRGK+ 
Sbjct: 186 FVYSTGDSMGMNMVTIASEKILDKLADETTGRHI-ALSGNVCVDKKPAAINMIEGRGKSI 244

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VA+I I   I  K L+T+ E I  +N  KNLIG+  AG + + NAH+ANM+ A +LATGQ
Sbjct: 245 VADILIPEEIVNKKLKTTAEAIEEVNIAKNLIGSAAAGSM-AYNAHYANMVAAIFLATGQ 303

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           DAA+ VEGS G+T A+  +  LYFS  +P++ +  VG G ++      L  LG     K 
Sbjct: 304 DAAHAVEGSLGITTAENRNGDLYFSVNLPDVPIATVGGGTSLETAHEGLDILGVAGSNK- 362

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              AR    I AATVL GELSL+ A    G L  AH  L R
Sbjct: 363 ---AREFGEIVAATVLAGELSLVGALA-AGHLARAHQELGR 399


>gi|256811026|ref|YP_003128395.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanocaldococcus
           fervens AG86]
 gi|256794226|gb|ACV24895.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanocaldococcus
           fervens AG86]
          Length = 404

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 141/356 (39%), Positives = 196/356 (55%), Gaps = 19/356 (5%)

Query: 1   MHMKK-----VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLC 55
           M MKK     + +I +P+ + GP+KI G   + +  +PLAT E  L  SV RG  I   C
Sbjct: 57  MAMKKNIENMIGAIQIPLGFAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCSIITKC 116

Query: 56  PDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS- 114
             G    +ID++MTR+   +T+    AL     I      I  V E T++  + + +   
Sbjct: 117 -GGATVRVIDDKMTRAPCLKTKTVVDALKVRDWIKENFERIKEVAESTTRHGKLIGIEPI 175

Query: 115 QIAGNLLFLRLEFATGDASGHNMVT----KAADAVMDWILSQWSYLHYGSVSGNICSDKK 170
            I G  L+ R  F TGDA G NMVT    KA + + D +  +  Y+   +VSGN C DKK
Sbjct: 176 LIVGRNLYPRFVFKTGDAMGMNMVTIATEKACNFIEDELKKEGIYVKTVAVSGNACVDKK 235

Query: 171 ATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAH 230
            + +N I GRGK+ VAE+ +      KYL+T+ + I  +N  KN IG+ ++  +   NAH
Sbjct: 236 PSGMNLINGRGKSIVAEVFLTEKEVNKYLKTTSQAIAEVNRLKNYIGSAISNSM-GFNAH 294

Query: 231 FANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIK 290
           +AN++ A +LATGQD A+IVEGS G+T A++ DD LYFS T+P++ +G VG G  +   K
Sbjct: 295 YANIIGAIFLATGQDEAHIVEGSLGITMAEVEDDGLYFSVTLPDVPIGTVGGGTRVETQK 354

Query: 291 NNLTALGCIEERKTGDN-ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             L  LGC      GDN A + A I    VL GELSLL A    G L +AH  L R
Sbjct: 355 ECLEMLGCY-----GDNKALKFAEIVGGAVLAGELSLLGALA-AGHLGKAHQELGR 404


>gi|15668887|ref|NP_247690.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Methanocaldococcus
           jannaschii DSM 2661]
 gi|2495267|sp|Q58116|HMDH_METJA RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|1591421|gb|AAB98699.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Methanocaldococcus
           jannaschii DSM 2661]
          Length = 405

 Score =  215 bits (548), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 198/356 (55%), Gaps = 19/356 (5%)

Query: 1   MHMKK-----VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLC 55
           M MKK     + +I +P+ + GP+KI G   + +  +PLAT E  L  SV RG  I   C
Sbjct: 58  MAMKKNIENMIGAIQIPLGFAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCSIITKC 117

Query: 56  PDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS- 114
             G    +ID++MTR+   +T++   A+     I      I  V E T++  + +++   
Sbjct: 118 -GGATVRVIDDKMTRAPCLKTKSVVDAIKVRDWIRENFERIKEVAESTTRHGKLIKIEPI 176

Query: 115 QIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWS----YLHYGSVSGNICSDKK 170
            I G  L+ R  F TGDA G NMVT A +   ++I  +      ++   +VSGN C DKK
Sbjct: 177 LIVGRNLYPRFVFKTGDAMGMNMVTIATEKACNFIEGELKKEGIFVKTVAVSGNACVDKK 236

Query: 171 ATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAH 230
            + +N I GRGK+ VAE+ +      KYL+T+ + I  +N  KN IG+ ++  +   NAH
Sbjct: 237 PSGMNLINGRGKSIVAEVFLTEKEVNKYLKTTSQAIAEVNRLKNYIGSAISNSM-GFNAH 295

Query: 231 FANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIK 290
           +AN++ A +LATGQD A+IVEGS G+T A++ DD LYFS T+P++ +G VG G  +   K
Sbjct: 296 YANIIGAIFLATGQDEAHIVEGSLGITMAEVEDDGLYFSVTLPDVPIGTVGGGTRVETQK 355

Query: 291 NNLTALGCIEERKTGDN-ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             L  LGC      GDN A + A I  A VL GELSLL A    G L +AH  L R
Sbjct: 356 ECLEMLGCY-----GDNKALKFAEIVGAAVLAGELSLLGALA-AGHLGKAHQELGR 405


>gi|70607117|ref|YP_255987.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Sulfolobus
           acidocaldarius DSM 639]
 gi|68567765|gb|AAY80694.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Sulfolobus
           acidocaldarius DSM 639]
          Length = 411

 Score =  215 bits (548), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 128/341 (37%), Positives = 194/341 (56%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+  IGP+KI G   +    VPLAT E  L  SV RGA    L   G R  +  
Sbjct: 69  IGAVQVPLGIIGPLKIDGEYAKGDFYVPLATTEGALIASVNRGAKAVTLS-GGTRVKIFY 127

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F+ ++       L+ +   K ++ +V   T+   +  ++   I GN ++LR 
Sbjct: 128 DGMTRAPIFKLDSIRDVAEFLEWVDKNKEKLEQVANSTTSHGKLSKIEPLILGNNVWLRF 187

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F+TGDA G NM T A++ + ++I  ++      +VSGN+CSDKK + IN + GRGK  V
Sbjct: 188 VFSTGDAMGMNMATIASEKLCEFIEKEFGKATCLAVSGNVCSDKKQSMINALHGRGKTVV 247

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I  +I +  L++    I  +N +KN +G   AG I   NAHFAN++ A +LATGQD
Sbjct: 248 AEALIPDSIVKSALKSDKHLIHEVNLRKNWLGGARAGNIFQYNAHFANIIAAIFLATGQD 307

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G T+ ++ ++ LY S T+ +L +G VG G  +P  +  L+ +G +      
Sbjct: 308 IAQVVESSMGYTWTEVRENGLYISITLNSLEVGTVGGGTRLPTQREALSIMGVLGSGNPP 367

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NAR+ A I A+ VL GEL+LL+A  N  EL +AH +L R
Sbjct: 368 GSNARKFAEIVASAVLAGELNLLSALANK-ELGKAHAKLGR 407


>gi|171185812|ref|YP_001794731.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Thermoproteus
           neutrophilus V24Sta]
 gi|170935024|gb|ACB40285.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Thermoproteus
           neutrophilus V24Sta]
          Length = 395

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 192/341 (56%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ I G+  + +  +PLAT E  L  SV RGA + +    G RA ++ 
Sbjct: 56  IGAVQVPVGVAGPLLIHGDYARGQFYIPLATTEGALVASVNRGAKL-ITESGGARAKVLR 114

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + M R+  F   +   A+  +Q I     EI +  E T+   R  ++   + GN ++LR+
Sbjct: 115 DGMARAPLFRLPSLIDAVEFVQWINQNVEEIKKAAESTTSIGRLREIQPYVVGNYVWLRM 174

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NMVT A+DA   +I  ++      ++SGN+C DKKA A+N ++GRGK  V
Sbjct: 175 VFFTGDAMGMNMVTIASDAAARYIQERFPKAKLVALSGNLCVDKKANAVNFLLGRGKTVV 234

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I R I Q+ +  +PE++  +N +KNL+G+ LA      NAHFAN++ A ++ATGQD
Sbjct: 235 AEAVIKREILQR-MGVTPEEVHEVNIRKNLLGSALAHSY-GFNAHFANIVAAVFIATGQD 292

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G+T  +  ++ LY S  +P+L +G VG G  +P  +  L  LG        
Sbjct: 293 VAQVVESSMGITSTEAREEGLYISVFLPSLEVGTVGGGTRLPTQREALELLGVAGSGNPP 352

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA + A I AA VL GE +LL A     EL  AH RL R
Sbjct: 353 GTNALKFAEIIAAAVLAGEANLLIALAR-NELASAHERLGR 392


>gi|312136242|ref|YP_004003579.1| 3-hydroxy-3-methylglutaryl-coenzyme a reductase [Methanothermus
           fervidus DSM 2088]
 gi|311223961|gb|ADP76817.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanothermus
           fervidus DSM 2088]
          Length = 403

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 130/342 (38%), Positives = 197/342 (57%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+KI G   + +  VPLAT E  L  S+ RG   ++    G +  +I 
Sbjct: 69  IGAVQIPLGVAGPLKINGEYAKGEFYVPLATSEGALVASINRGCS-AITESGGAKTRIIG 127

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS-QIAGNLLFLR 124
           ++MTR+   +T++   A+   + I      +    E T++  + +++    I GN +F R
Sbjct: 128 DKMTRAPVIKTKSVVEAVKLKKWIEDNFDRLKAAAESTTRHGKLIKIDPILIVGNYVFPR 187

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             F TGD+ G NMVT A +  +  IL   +  H  S+SGN+C+DKK  AIN I GRGK+ 
Sbjct: 188 FVFTTGDSMGMNMVTIATEEALK-ILENETNAHVVSLSGNVCTDKKPAAINLIEGRGKSV 246

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VAE+T+ R I +  L+T+P+ I+ +N  KN +G+ +AG +   NAH+ANM+ A +LATGQ
Sbjct: 247 VAEVTVPRDIVKNKLKTTPKSIVEVNMAKNFVGSAIAGSM-GFNAHYANMIGALFLATGQ 305

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           D A IVEGS G+T A+ ++D  LYFS T+P++ L  VG G  +   +  L+ +G     K
Sbjct: 306 DEAQIVEGSLGITVAEENEDGDLYFSVTLPDVPLATVGGGTGLETAQECLSIMGV----K 361

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +  ++ A I A  VL GELSL+AA    G L  AH  L R
Sbjct: 362 GSNKVQKFAEIMAGVVLAGELSLMAA-LGAGHLARAHKELGR 402


>gi|15921637|ref|NP_377306.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Sulfolobus tokodaii str.
           7]
 gi|15622424|dbj|BAB66415.1| 411aa long hypothetical 3-hydroxy-3-methylglutaryl-CoA reductase
           [Sulfolobus tokodaii str. 7]
          Length = 411

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 128/341 (37%), Positives = 193/341 (56%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  I +P+  IGP+++ G+  +    VPLAT E  L  SV RGA  ++    G R  +I 
Sbjct: 69  IGGIQIPVGVIGPLRVNGDYAKGDFYVPLATTEGALIASVNRGAK-AITKSGGARVKIIF 127

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F+  + E     L+ I    ++I  + E T+   + + +   + GN ++LR 
Sbjct: 128 DGMTRAPVFKLNSIEDVADFLKWIKDNFSKIKEIAESTTSHGKLMNIEPYVLGNNVWLRF 187

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NMVT A +   ++I  ++      +VSGN+CSDKK + +N + GRGK  V
Sbjct: 188 VFETGDAMGMNMVTVATEKACEFIEREFGRAVCLAVSGNMCSDKKQSQVNSLHGRGKTVV 247

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I   + +  L++    I  +N +KN +G   AG +   NAHFAN++ A ++ATGQD
Sbjct: 248 AEALIPNDVIKTVLKSDSVLIHEVNLRKNWLGGARAGTMFQFNAHFANIVTAIFIATGQD 307

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G T+ ++ D+ LY S T+ +L +G +G G  +P  +  L+ +         
Sbjct: 308 VAQVVESSSGYTWTEIRDNGLYISVTLTSLEVGTIGGGTRLPTQREALSIMRVDGPGNPP 367

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NAR+ A I A+TVL GEL+LLAA  N  EL +AHLRL R
Sbjct: 368 GSNARKFAEIVASTVLAGELNLLAALANK-ELGKAHLRLGR 407


>gi|289192939|ref|YP_003458880.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanocaldococcus
           sp. FS406-22]
 gi|288939389|gb|ADC70144.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanocaldococcus
           sp. FS406-22]
          Length = 404

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 138/356 (38%), Positives = 197/356 (55%), Gaps = 19/356 (5%)

Query: 1   MHMKK-----VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLC 55
           M MKK     + +I +P+ + GP+KI G   + +  +PLAT E  L  SV RG  I   C
Sbjct: 57  MAMKKNIENMIGAIQIPLGFAGPLKINGEYAKGEFYIPLATTEGALVASVNRGCSIITKC 116

Query: 56  PDGIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS- 114
             G    +ID++MTR+   +T++   A+     I     +I  V E T++  + +++   
Sbjct: 117 -GGATVRVIDDKMTRAPCLKTKSIVDAIKVRDWIKENFEKIKEVAESTTRHGKLIKIEPI 175

Query: 115 QIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWS----YLHYGSVSGNICSDKK 170
            I G  L+ R  F TGDA G NMVT A +   ++I  +      ++   +VSGN C DKK
Sbjct: 176 LIVGRNLYPRFVFKTGDAMGMNMVTIATEKACNFIEEELKKEGIFVKTVAVSGNACVDKK 235

Query: 171 ATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAH 230
            + +N I GRGK+ VAEI +      KYL+T+ E I  +N  KN IG+ ++  +   NAH
Sbjct: 236 PSGMNLINGRGKSIVAEIYLEEKEVNKYLKTTSEAIAEVNRLKNYIGSAISNSM-GFNAH 294

Query: 231 FANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIK 290
           +AN++ A +LATGQD A IVEGS G+T A++ D+ LYFS T+P++ +G +G G  +   K
Sbjct: 295 YANIIGAIFLATGQDEAQIVEGSLGITMAEVEDNGLYFSVTLPDVPIGTIGGGTRVETQK 354

Query: 291 NNLTALGCIEERKTGDN-ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             L  LGC      GDN A + A I    VL GELSLL A    G L +AH  L R
Sbjct: 355 ECLEMLGCY-----GDNKALKFAEIVGGAVLAGELSLLGALA-AGHLGKAHQELGR 404


>gi|303244046|ref|ZP_07330385.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase
           [Methanothermococcus okinawensis IH1]
 gi|302485698|gb|EFL48623.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase
           [Methanothermococcus okinawensis IH1]
          Length = 388

 Score =  212 bits (540), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 128/348 (36%), Positives = 193/348 (55%), Gaps = 15/348 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+ + GP+KI G     +  +PLAT E  L  SV RG  I   C  G    ++D
Sbjct: 48  IGAVQIPLGFAGPLKINGKYANGEYYIPLATTEGALVASVNRGCGIITKC-GGCTVRVVD 106

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQI-AGNLLFLR 124
           ++MTR+   +T +   A+   + I     +I  V E T++  + + ++  I  G  ++ R
Sbjct: 107 DKMTRAPVIKTNSIIDAIKLKEWIENNFQKIKEVAETTTKHGKLISINPIIIVGRYVYPR 166

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSV-------SGNICSDKKATAINGI 177
             + TGDA G NMVT A +   ++I ++      GS+       SGN+C+DKK   IN I
Sbjct: 167 FTYKTGDAMGMNMVTIATEKACNFIENEMKKEENGSIKVHTVALSGNVCTDKKPAGINLI 226

Query: 178 MGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA 237
            GRGK  +AE+ +     +KYL+T+ + I  +N  KN IG+ ++  +   NAH+AN++ A
Sbjct: 227 EGRGKTIIAEVFLKEEEIKKYLKTTSKAIEQVNMYKNFIGSAISNSM-GFNAHYANIIGA 285

Query: 238 YYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
            +LATGQD A+IVEGS G+T A+  DD LYFS T+P++ +G VG G  +   K  L  +G
Sbjct: 286 LFLATGQDEAHIVEGSMGITVAECVDDGLYFSVTLPDVPIGTVGGGTRVETQKECLEMIG 345

Query: 298 CIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           C    + GD A + A I    VL GELSL+ A    G L +AH  L R
Sbjct: 346 C----RGGDKALKFAEIVGGAVLAGELSLMGALA-AGHLAKAHSELGR 388


>gi|45357650|ref|NP_987207.1| hydroxymethylglutaryl-coenzyme A
           reductase:3-hydroxy-3-methylglutaryl coenzyme A
           reductase [Methanococcus maripaludis S2]
 gi|45047210|emb|CAF29643.1| Hydroxymethylglutaryl-coenzyme A
           reductase:3-hydroxy-3-methylglutaryl Coenzyme A
           reductase [Methanococcus maripaludis S2]
          Length = 408

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 192/345 (55%), Gaps = 12/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+ + GP+ I G   Q +  VPLAT E  L  S+ RG  I   C  G    +ID
Sbjct: 71  IGAVQIPLGFAGPISINGKYAQGEFNVPLATTEGALVASINRGCSIITKC-GGATVRVID 129

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS-QIAGNLLFLR 124
           ++MTR+   +T +   AL   + I    A+I  + E T++  + +Q+    I G  ++ R
Sbjct: 130 DKMTRAPIIKTNSVVDALKLKEWILDNFAKIKEIAESTTRHGKLIQISPILIVGRNVYPR 189

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWS----YLHYGSVSGNICSDKKATAINGIMGR 180
             F TGDA G NMVT A +    +I S+       +   ++SGN+C DKK  AIN I GR
Sbjct: 190 FTFKTGDAMGMNMVTIATEKACSFIESELKKEGIIIDTVALSGNVCVDKKPAAINLIEGR 249

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ VAE+ +     +KYL+T+ + I  +NT KNLIG+ ++  +   NA +AN++ A +L
Sbjct: 250 GKSVVAEVFLKEEYVEKYLKTTSKAIEQVNTYKNLIGSAISSSL-GFNAQYANIVGALFL 308

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD A+IVEGS G+T A+   D LYFS T+P+L +  +G G  +   +  L  LGC  
Sbjct: 309 ATGQDEAHIVEGSMGITTAECTGDGLYFSVTLPDLPVATIGGGTRVETQRECLEILGCAG 368

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             K    A + A I  A VL GELSL+ A    G L +AH  L R
Sbjct: 369 AEK----AVKFAEIAGAAVLAGELSLIGALA-AGHLAKAHSELGR 408


>gi|159905247|ref|YP_001548909.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Methanococcus
           maripaludis C6]
 gi|159886740|gb|ABX01677.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanococcus
           maripaludis C6]
          Length = 408

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 192/345 (55%), Gaps = 12/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+ + GP+ I G   Q +  VP AT E  L  S+ RG  I   C  G    +ID
Sbjct: 71  IGAIQIPLGFAGPISINGKYAQGEFNVPFATTEGALVASINRGCSIITKC-GGATVRVID 129

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS-QIAGNLLFLR 124
           ++MTR+   +T++   AL   + I    A+I  V E T++  + +Q+    I G  ++ R
Sbjct: 130 DKMTRAPIIKTDSIVDALKLKEWILDNFAKIKEVAESTTRHGKLIQISPILIVGRNVYPR 189

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWS----YLHYGSVSGNICSDKKATAINGIMGR 180
             F TGDA G NMVT A +    +I S+       +   ++SGN C DKK  AIN I GR
Sbjct: 190 FTFKTGDAMGMNMVTIATEKACSFIESELKKEGIVVDTVALSGNACIDKKPAAINLIEGR 249

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ VAE+ +     +KYL+T+ + I  +NT KNLIG+ ++G +   NA +AN++ A +L
Sbjct: 250 GKSVVAEVFLKEEYVEKYLKTTSKAIEQVNTYKNLIGSAISGSL-GFNAQYANIVGALFL 308

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD A+IVEGS G+T A+   D LYFS T+P+L +  +G G  +   +  L  +GC  
Sbjct: 309 ATGQDEAHIVEGSMGITTAECTGDGLYFSVTLPDLPVATIGGGTRVETQRECLEIIGCAG 368

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             K    A + A I  A VL GELSL+ A    G L +AH  L R
Sbjct: 369 AEK----AVKFAEIAGAVVLAGELSLIGALA-AGHLAKAHSELGR 408


>gi|150401147|ref|YP_001324913.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Methanococcus
           aeolicus Nankai-3]
 gi|150013850|gb|ABR56301.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanococcus
           aeolicus Nankai-3]
          Length = 418

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 131/346 (37%), Positives = 194/346 (56%), Gaps = 13/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+ + GP+K+ G     +  VPLAT E  L  SV RG  I   C  G    +I 
Sbjct: 80  IGAIQIPLGYAGPLKVNGKHANKEYFVPLATTEGALVASVNRGCSIISKC-GGCTVRVIG 138

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS-QIAGNLLFLR 124
           ++MTR+  F T++   A+   + I     +I  + E T++  +   +    I G  ++ R
Sbjct: 139 DKMTRAPVFTTKSIVDAMELKEWIEANFQKIKEIAETTTRHGKLKSISPILIVGRFVYPR 198

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWS-----YLHYGSVSGNICSDKKATAINGIMG 179
             ++TGDA G NMVT A +   ++I SQ        +H  ++SGN+C+DKK   IN I G
Sbjct: 199 FTYSTGDAMGMNMVTIATEKACEFITSQIREEKNIIVHMAALSGNVCTDKKPAGINLIEG 258

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
           RGK  +AE+ +     +KYL+T+ + I  +N  KNLIG+ ++  +   NAH+AN++ A +
Sbjct: 259 RGKTVIAEVYLTNEEIKKYLKTTAKAIEQVNMYKNLIGSAISNSM-GFNAHYANIVGALF 317

Query: 240 LATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
           LATGQD A+IVEGS G+T A+  ++ LYFS T+P+L +G VG G  I      L  + C 
Sbjct: 318 LATGQDEAHIVEGSLGITVAESDENGLYFSVTLPDLPVGTVGGGTRIETQNECLKIIDC- 376

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NA + A I  ATVL GELSL+ A  + G L +AH  L R
Sbjct: 377 ---NGGGNALKFAEIVGATVLAGELSLMGALAS-GHLAKAHSELGR 418


>gi|134046615|ref|YP_001098100.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanococcus
           maripaludis C5]
 gi|132664240|gb|ABO35886.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanococcus
           maripaludis C5]
          Length = 408

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 192/345 (55%), Gaps = 12/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+ + GP+ I G   Q +  VP AT E  L  S+ RG  I   C  G    +ID
Sbjct: 71  IGAIQIPLGFAGPISINGKYAQGEFNVPFATTEGALVASINRGCSIITKC-GGATVRVID 129

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQ-IAGNLLFLR 124
           ++MTR+   +T +   AL   + I    A+I  V E T++  + +Q+    I G  ++ R
Sbjct: 130 DKMTRAPIIKTNSIVDALKLKEWILDNFAKIKEVAESTTRHGKLIQISPVLIVGRNVYPR 189

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWS----YLHYGSVSGNICSDKKATAINGIMGR 180
             F TGDA G NMVT A +    +I S+       +   ++SGN+C+DKK  AIN I GR
Sbjct: 190 FTFKTGDAMGMNMVTIATEKACSFIESELKKEGIIIDTVALSGNVCTDKKPAAINLIDGR 249

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ VAE+ +     +KYL+T+ + I  +NT KNLIG+ ++  +   NA +AN++ A +L
Sbjct: 250 GKSVVAEVFLKEEYVEKYLKTTSKAIEQVNTYKNLIGSAISSSL-GFNAQYANIVGALFL 308

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD A+IVEGS G+T A+   D LYFS T+P+L +  +G G  +   +  L  +GC  
Sbjct: 309 ATGQDEAHIVEGSMGITTAECTGDGLYFSVTLPDLPVATIGGGTRVETQRECLEIIGCAG 368

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             K    A + A I  A VL GELSL+ A    G L +AH  L R
Sbjct: 369 AEK----AVKFAEIAGAVVLAGELSLIGALA-AGHLAKAHSELGR 408


>gi|296109805|ref|YP_003616754.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanocaldococcus
           infernus ME]
 gi|295434619|gb|ADG13790.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanocaldococcus
           infernus ME]
          Length = 400

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 193/345 (55%), Gaps = 12/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+   GP+++ G   +    +PLAT E  L  SV RG  I   C   I   +ID
Sbjct: 63  IGAIQIPLGIAGPIRVNGEHAKGLFYIPLATTEGALVASVNRGCSIITKCGGAI-VRVID 121

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS-QIAGNLLFLR 124
           ++MTR+  F+T +   A+     I     +I  V E T++  + +++    I G  ++ R
Sbjct: 122 DKMTRAPCFKTRSVVEAIKVRDWILKNFDKIKEVAESTTRHGKLIKIEPILIVGRNIYPR 181

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSY----LHYGSVSGNICSDKKATAINGIMGR 180
             + TGDA G NMVT A +    +I+ +       +   S+SGN C DKK + +N I GR
Sbjct: 182 FCYKTGDAMGMNMVTIATEEACKFIVEELKKENIDVKLVSLSGNACVDKKPSGMNLIEGR 241

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ VAEI ++R   +KYL+T+PE I  +N  KN IG+ ++  +   NAH+AN++ A +L
Sbjct: 242 GKSVVAEIYLDREEVEKYLKTTPEAIAEVNRLKNYIGSAISNSM-GFNAHYANIVGAIFL 300

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD A+IVEGS G+T A++ DD LYFS T+P+L L  VG G ++   +  L  +GC  
Sbjct: 301 ATGQDEAHIVEGSLGITMAEVEDDKLYFSVTLPDLPLATVGGGTSVETQREALEIMGCYG 360

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             K      + A I  A VL GELSLL A  +   L +AH  L R
Sbjct: 361 SNKV----LKFAEIVGAAVLAGELSLLGALAS-NHLAKAHKELGR 400


>gi|150403009|ref|YP_001330303.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Methanococcus
           maripaludis C7]
 gi|150034039|gb|ABR66152.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanococcus
           maripaludis C7]
          Length = 408

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 191/345 (55%), Gaps = 12/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+ + GP+ I G   Q +  VP AT E  L  S+ RG  I   C  G    +ID
Sbjct: 71  IGAIQIPLGFAGPISINGKYAQGEFNVPFATTEGALVASINRGCSIITKC-GGATVRVID 129

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS-QIAGNLLFLR 124
           ++MTR+   +T +   AL   + I     +I  V E T++  + +Q+    I G  ++ R
Sbjct: 130 DKMTRAPIIKTNSIVDALKLKEWILDNFTKIKEVAESTTRHGKLIQISPILIVGRNVYPR 189

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWS----YLHYGSVSGNICSDKKATAINGIMGR 180
             F TGDA G NMVT A +    +I S+       +   ++SGN+C+DKK  AIN I GR
Sbjct: 190 FTFKTGDAMGMNMVTIATEKACSFIESELKKEGIIVDTVALSGNVCTDKKPAAINLIEGR 249

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ VAE+ +     +KYL+T+ + I  +NT KNLIG+ ++  +   NA +AN++ A +L
Sbjct: 250 GKSVVAEVFLKEEYVEKYLKTTSKAIEQVNTYKNLIGSAISSSL-GFNAQYANIVGALFL 308

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD A+IVEGS G+T A+   D LYFS T+P+L +  +G G  +   +  L  +GC  
Sbjct: 309 ATGQDEAHIVEGSMGITTAECTGDGLYFSVTLPDLPVATIGGGTRVETQRECLEIIGCAG 368

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             K    A + A I  A VL GELSL+ A    G L +AH  L R
Sbjct: 369 AEK----AVKFAEIAGAVVLAGELSLIGALA-AGHLAKAHSELGR 408


>gi|170595154|ref|XP_001902266.1| Hydroxymethylglutaryl-coenzyme A reductase family protein [Brugia
           malayi]
 gi|158590143|gb|EDP28883.1| Hydroxymethylglutaryl-coenzyme A reductase family protein [Brugia
           malayi]
          Length = 577

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 191/341 (56%), Gaps = 10/341 (2%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P   +GP+ + G     K  VP++T E  L  S  RG   ++    G+   +  + M
Sbjct: 186 VPVPTGIVGPLLVNGR----KCFVPMSTTEGALVASTNRGCR-AVFESGGVTVRMYRDGM 240

Query: 69  TRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+   +  N    + +    + +    EI  V + TS F R  +L + I G LLF+R E
Sbjct: 241 TRAPVVQFANVARTLEMKDFLDSSTGFEEIKAVFDSTSSFARLQRLETDITGRLLFIRFE 300

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV+K  +A + ++  +   +   S+SGN C DKKA+AIN I GRGK+ VA
Sbjct: 301 AKTGDAMGMNMVSKGTNAALSYLKQKCPEMEVLSLSGNYCVDKKASAINWIKGRGKSVVA 360

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I+ A+ Q  L+T+ + ++ L   K LIG+ +AG I   NAH AN++ A ++ATGQD 
Sbjct: 361 EAVISAAVVQTVLKTTVDALVRLGQAKLLIGSSMAGTIGGWNAHAANIVAAIFIATGQDV 420

Query: 247 ANIVEGSQGL-TYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
           A +V  S  L T  K   D LY SC++  L +G VG G  +PA    L  +GC+      
Sbjct: 421 AQVVSSSMCLTTMEKTELDDLYISCSMRCLEVGTVGGGTILPAQNACLQMMGCVTATSVP 480

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G+ A+ LA I  +TVL GELSLLAAQ +  +L+++H+RL R
Sbjct: 481 GECAKHLAEIICSTVLAGELSLLAAQCS-NDLVKSHIRLNR 520


>gi|288560349|ref|YP_003423835.1| hydroxymethylglutaryl-CoA reductase (NADPH) HmgA
           [Methanobrevibacter ruminantium M1]
 gi|288543059|gb|ADC46943.1| hydroxymethylglutaryl-CoA reductase (NADPH) HmgA
           [Methanobrevibacter ruminantium M1]
          Length = 400

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/341 (36%), Positives = 193/341 (56%), Gaps = 9/341 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+  +GP+KI G    D+  VPLAT E  L  SV RG   ++    G+ A +I 
Sbjct: 68  IGTVQVPIGVVGPLKINGEHADDEFFVPLATSEGALLASVNRGCS-AITASGGVNARVIG 126

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQI-AGNLLFLR 124
           ++MTR+   +T++   A+        K  E+  + E T+   + +++   I  GN ++ R
Sbjct: 127 DKMTRAPVIKTDSVVEAVKVKSWFETKFDELKSIAESTTSHGKLVKIDPIIIVGNYVYPR 186

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             ++TGD+ G NMVT A + V+  +      +H  ++SGN+C DKK  AIN + GRGK  
Sbjct: 187 FVYSTGDSMGMNMVTIATEKVLSKLYDDLG-VHAIALSGNLCVDKKPAAINLVEGRGKTV 245

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VA+I I   I +  L+T+ + +  +N  KNLIG+  AG + + NAHFANM+ A +LATGQ
Sbjct: 246 VADILIPEEIVKSKLKTTAKAMEEVNIAKNLIGSAAAGSM-AFNAHFANMIGAIFLATGQ 304

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           D A++VEGS G+T A+  D  LYF+ ++P+L +  +G G  +      L+ + C+   K 
Sbjct: 305 DEAHVVEGSLGITTAEDRDGDLYFAVSMPDLPIATIGGGTRLETASEGLSIIDCLGSGKV 364

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                + A I  +TVL GELSL+ A    G L +AH  L R
Sbjct: 365 ----NKFAEIVISTVLAGELSLVGALA-AGHLAKAHQELGR 400


>gi|25144592|ref|NP_498626.2| hypothetical protein F08F8.2 [Caenorhabditis elegans]
 gi|20451229|gb|AAA68386.2| Hypothetical protein F08F8.2 [Caenorhabditis elegans]
          Length = 550

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 194/340 (57%), Gaps = 10/340 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ + G     ++ VP+AT E  L  S  RG ++ +    G+  ++ +  MTR
Sbjct: 166 VPVGVAGPLTLNGT---SEIYVPMATTEGALIASTNRGMNV-IRAAGGVETSIFNSGMTR 221

Query: 71  S--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           +  + F T    +++    E    +    +  +  S+F +   +   I GNL +LR +  
Sbjct: 222 APVVKFPTARDAVSMKRWLEHPENQDRARQEFQSCSRFAKLKSIDITIDGNLAYLRFDAH 281

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NM++K+ D+ M +++  +  +   ++SGN+C DKKA A N   GRG++ VAE 
Sbjct: 282 TGDAMGMNMISKSCDSTMRFLMENFPEMTVLALSGNLCVDKKAAAKNWTEGRGRSVVAEC 341

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
            I R +  K LRT+PE++  L T K  IG+  AG +  +NAH AN++ A ++ATGQDAA 
Sbjct: 342 LIPREVVTKTLRTTPEQLAYLTTTKLHIGSSRAGAVGGSNAHAANIVAAIFIATGQDAAQ 401

Query: 249 IVEGSQGLTYAKLH-DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI--EERKTG 305
           +V  S   T  ++  D +LY SCT+P + +G VG G  +   +  L +LGC    + + G
Sbjct: 402 VVSSSMCSTRMEVTADKNLYVSCTLPCVEVGTVGGGTILAPQRACLESLGCAGPNKEQPG 461

Query: 306 DNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            NA RLA + AATVL GELSL+AA T   EL+ +H++L R
Sbjct: 462 QNAERLAEVIAATVLAGELSLMAALTT-NELVSSHMKLNR 500


>gi|146304412|ref|YP_001191728.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Metallosphaera
           sedula DSM 5348]
 gi|145702662|gb|ABP95804.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Metallosphaera
           sedula DSM 5348]
          Length = 410

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 132/341 (38%), Positives = 195/341 (57%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +  +P+   GP+ + G+  +    VPLAT E  L  SV RG  + +     +R  ++ 
Sbjct: 68  IGAAQVPLGVAGPIMVEGDYAKGSFFVPLATTEGALIASVNRGMKV-LRHAGPVRTKVLR 126

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F  E+A  A    + +     EI RV E TS   R +++     GN ++LR 
Sbjct: 127 DGMTRAPVFTFESALDAFKFTEWVKSNFQEIKRVAESTSSHARLIKIDPLQLGNNVWLRF 186

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           E+ TGDA G NMVT A +A   ++  ++      +VSGN CSDKK +  N ++GRGK+ V
Sbjct: 187 EYETGDAMGMNMVTVATEAACSYLEEKFPRARCVAVSGNACSDKKQSMTNELLGRGKSVV 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I   I + +LRT+ ++I  +N +KN +G   AG I   NAHFAN++ A ++ATGQD
Sbjct: 247 AEALIPSRILETHLRTTADRIQEVNLRKNWLGGARAGTIFQFNAHFANIIAAIFIATGQD 306

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G T+ +  +  LY S T+P+L +G VG G  +P  +  L+ +G        
Sbjct: 307 VAQVVESSTGYTWVENRNGDLYISVTLPSLEVGTVGGGTRLPTQREALSMMGVDGGGNPP 366

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NAR+LA I +A VL GEL+LL+A +   EL +AHLRL R
Sbjct: 367 GSNARKLAEIISAAVLAGELNLLSALSTR-ELGKAHLRLGR 406


>gi|330834441|ref|YP_004409169.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Metallosphaera
           cuprina Ar-4]
 gi|329566580|gb|AEB94685.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Metallosphaera
           cuprina Ar-4]
          Length = 410

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 128/341 (37%), Positives = 191/341 (56%), Gaps = 3/341 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +  +P+   GP+ I G+  +    VPLAT E  L  SV RG  +  L    ++  +I 
Sbjct: 68  IGATQIPLGVAGPVLIEGDYARGGFLVPLATTEGALIASVNRGMKVLRLS-GYVKTKIIR 126

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F  ++A  A +    +      I +V E+T+   +   +     GN +++R 
Sbjct: 127 DGMTRAPVFSFDSAIEAYSFSAWVKENFETIRKVAERTTSHGKLKSVEPFQLGNNVWIRF 186

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           EF TGDA G NMVT AA+AV  ++  ++      +VSGN+CSDKK +  N ++GRGK  V
Sbjct: 187 EFDTGDAMGMNMVTVAAEAVSSFLEERFPGARCVAVSGNMCSDKKQSVTNELLGRGKTVV 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I   + +K LRT+ EKI   N +KN +G   AG +   NAHFAN++ A ++ATGQD
Sbjct: 247 AEALIPSEVIEKNLRTTAEKIEETNLKKNWLGGARAGTLFQFNAHFANVIAAIFIATGQD 306

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTAL-GCIEERKT 304
            A +VE S G T+ +    +LY S T+P+L +G VG G  +P  +  L+ +         
Sbjct: 307 VAQVVESSTGYTWVENRSGNLYISVTLPSLEVGTVGGGTRLPTQREALSIMGVDGGGDPP 366

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G  AR+ A I +A VL GEL+LL+A +   EL +AH+RL R
Sbjct: 367 GSKARKFAEIVSAAVLAGELNLLSALSTR-ELGKAHMRLGR 406


>gi|159040995|ref|YP_001540247.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Caldivirga
           maquilingensis IC-167]
 gi|157919830|gb|ABW01257.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Caldivirga
           maquilingensis IC-167]
          Length = 410

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 132/342 (38%), Positives = 195/342 (57%), Gaps = 5/342 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ + G        VPLAT E  L  SV RGA + +    G R+ ++ 
Sbjct: 68  IGAVQVPLGVAGPLLVKGVYANGLYYVPLATTEGALVASVNRGAKV-ITENGGARSIVVK 126

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + M R+  F    A  A+  +  I     +I  V E +S+  R  ++   I GN  +LRL
Sbjct: 127 DGMARAPLFRLPTATDAVDFINWINTNIDKIREVAESSSRHLRLKEIQPFINGNNAWLRL 186

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F+TGDA G NMVT A++ V  WI   +      +VSGN+C DKK  A+N ++GRGK  +
Sbjct: 187 VFSTGDAMGMNMVTIASERVAQWIEGNYPKAKLITVSGNMCVDKKPNAVNFLLGRGKTVI 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           +E T++R    +    +PE+++ +N +KNL+G+  A      NAHFAN++ A ++ATGQD
Sbjct: 247 SEATVSRRYLMERFNITPEEVVNVNVRKNLLGSAYAHSY-GFNAHFANIVAAMFIATGQD 305

Query: 246 AANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERK 303
            A +VE S G+T+A++ D+  LY S T+P+L +G VG G  +P  +  L  LG       
Sbjct: 306 VAQVVESSMGITWAEVDDNGDLYVSVTLPSLEVGTVGGGTGLPTQREALQMLGVQGGGDP 365

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G NA +LA I AA VL GEL+LL AQ +  EL +AH RL R
Sbjct: 366 PGSNALKLAEIIAAAVLAGELNLLIAQ-HRRELGKAHERLGR 406


>gi|297619963|ref|YP_003708068.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanococcus
           voltae A3]
 gi|297378940|gb|ADI37095.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanococcus
           voltae A3]
          Length = 429

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 120/326 (36%), Positives = 189/326 (57%), Gaps = 13/326 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+ + GP+ + G   Q + ++PLAT E  L  S+ RG  I   C  G +A +I 
Sbjct: 92  IGAVQVPLGFAGPLIVNGEYAQGEFQIPLATTEGALIASINRGCSIISKC-GGSKARVIG 150

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQI-AGNLLFLR 124
           ++MTR+    T++   AL     I     +I  V E T++  + + +   I  G  ++ R
Sbjct: 151 DKMTRAPIIATKSVADALELKNWIEDNFDKIKEVAESTTRHGKLINVSPVIIVGKNVYPR 210

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWS----YLHYGSVSGNICSDKKATAINGIMGR 180
             F TGDA G NMVT A + V   +  + +     ++  ++SGN+C DKK +AIN I GR
Sbjct: 211 FCFTTGDAMGMNMVTIATEKVCGLLEQEMAQKGIIINTVALSGNVCVDKKPSAINLIEGR 270

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ VAE+ +   +   YL+T+ + I  +NT KNLIG+ +   +   NAHFAN++ A +L
Sbjct: 271 GKSIVAEVFLTEEMVNTYLKTTSKAIEYVNTNKNLIGSAIVNSL-GFNAHFANVIGALFL 329

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQDAA++VEGS G+T A+  +D LYFS T+P++ +  +G G  +   +  L  LGC  
Sbjct: 330 ATGQDAAHVVEGSMGITTAECQEDGLYFSVTLPDVPIATIGGGTRVETQQECLKILGC-- 387

Query: 301 ERKTGD-NARRLAAICAATVLCGELS 325
              +G+ N+++ A I A+ VL GELS
Sbjct: 388 ---SGNGNSKKFAEIVASAVLAGELS 410


>gi|281209280|gb|EFA83453.1| hmg CoA reductase A [Polysphondylium pallidum PN500]
          Length = 584

 Score =  202 bits (514), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 134/348 (38%), Positives = 197/348 (56%), Gaps = 22/348 (6%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ +        V +P+AT E  L  S  RG   ++    G RAT+I   M
Sbjct: 236 VPIPVGTAGPLMLN----NQPVNIPMATTEGCLVASTHRGCR-AISESGGARATIISRGM 290

Query: 69  TR-------SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
           TR       SI    E  E    +    T+KK       + TS+F R   L + +AG  L
Sbjct: 291 TRAPVVRFPSIVGVGECVEWLRESNNYETVKKE-----FDSTSRFARLTGLKTTVAGRSL 345

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           ++R +  TGDA G NMV+K  +AV++ + +Q+  +   S+SGN+C+DKK +AIN I GRG
Sbjct: 346 YIRFKCDTGDAMGMNMVSKGVEAVLNLLKNQFKDMEILSLSGNMCTDKKPSAINWIEGRG 405

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           +  V+E  I+  I QK L+TS + ++ LN  KNL+G+ +AG I   NAH AN++ A +LA
Sbjct: 406 RTVVSEAIISGEIVQKVLKTSVQAMVDLNISKNLVGSAMAGSIGGFNAHAANIVTAIFLA 465

Query: 242 TGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
           TGQD A  VE S  +T  +  +D   LY + T+P++ +G VG G  +PA  + L  +G  
Sbjct: 466 TGQDCAQNVESSNCITLMEACNDGKDLYITVTMPSIEVGTVGGGTFLPAQSSCLDIIGVK 525

Query: 300 EERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +    G NA +LA I  ATV+ GELSL+AA  + G LM++HL+L R
Sbjct: 526 GSKPGFPGQNADQLARIVCATVMAGELSLMAA-LSAGHLMKSHLQLNR 572


>gi|308459969|ref|XP_003092294.1| hypothetical protein CRE_12323 [Caenorhabditis remanei]
 gi|308253599|gb|EFO97551.1| hypothetical protein CRE_12323 [Caenorhabditis remanei]
          Length = 555

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 126/344 (36%), Positives = 194/344 (56%), Gaps = 10/344 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ + G      + VP+AT E  L  S  RG ++ +    G++ ++ +  MTR
Sbjct: 167 VPVGVAGPLTLNGT---SDIYVPMATTEGALIASTNRGMNV-IRSAGGVQTSIFNSGMTR 222

Query: 71  S--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           +  + F T    +++    E  + +    +  +  S+F +   +   I GNL +LR +  
Sbjct: 223 APVVKFSTAREAVSMKRWLEDPVNQKLARQEFQSCSRFAKLKSIDVTIDGNLAYLRFDAH 282

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NM++K+ D  M ++L ++  +   ++SGN+C DKKA A N   GRG++ VAE 
Sbjct: 283 TGDAMGMNMISKSCDITMRFLLEKFPDMRVLALSGNLCVDKKAAAKNFTEGRGRSVVAEC 342

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
            I R I  K LRT+PE +  L T K  IG+  AG I  +NAH AN++ A ++ATGQDAA 
Sbjct: 343 VIKRDIVLKTLRTTPEALAYLTTTKLHIGSARAGTIGGSNAHAANIVAAIFIATGQDAAQ 402

Query: 249 IVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI--EERKTG 305
           +V  S   T  ++ ++  LY SCT+P + +G VG G  +   +  L +L C    +   G
Sbjct: 403 VVSSSMCSTRMEVTEEQDLYVSCTLPCVEVGTVGGGTILAPQRACLESLECAGPNQENPG 462

Query: 306 DNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
            NA RLA I AATVL GELSL+AA T   +L+ +H++L R  L+
Sbjct: 463 QNAERLAEIIAATVLAGELSLMAALTT-NDLVSSHMKLNRSKLH 505


>gi|14601684|ref|NP_148225.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aeropyrum pernix
           K1]
 gi|11133215|sp|Q9YAS4|HMDH_AERPE RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|5105561|dbj|BAA80874.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aeropyrum pernix
           K1]
          Length = 421

 Score =  202 bits (513), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 198/345 (57%), Gaps = 5/345 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP++I G+  +    +PLAT E  L  SV RGA  ++    G RA +I 
Sbjct: 77  IGAVQVPVGVAGPLRINGDYARGDFYIPLATTEGALVASVNRGAK-AITLSGGARAKVIK 135

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+    T +   A      +  +  ++  V+   ++  R   ++  I GNL++LRL
Sbjct: 136 DGMTRAPLLWTPSVYEAHRLAMWVEDRIEDLRSVVAGVTRHGRLQHIYPYIIGNLVWLRL 195

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWS-YLHYGSVSGNICSDKKATAINGIMGRGKNF 184
            F+TGDA G NMVT ++D +  +I   +       ++SGN+C+DKK  AIN I+GRGK  
Sbjct: 196 SFSTGDAMGMNMVTISSDRICRYIEENYDGDAKCIALSGNMCTDKKPAAINKILGRGKYV 255

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VAE  I   + +  L+T+P+ I L+N  KNL+G+  AG   S NAHFAN++ A ++ATGQ
Sbjct: 256 VAEAVIKGEVVKNVLKTTPQNINLVNVTKNLLGSAAAGS-HSFNAHFANIIAAIFIATGQ 314

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERK 303
           DAA +VE S G T+ ++  + LY S T+P+L +G VG G  +P  +  L  LG       
Sbjct: 315 DAAQVVESSMGYTWTEVRGEDLYISVTLPSLEVGTVGGGTRLPTQRELLALLGVAGGGNP 374

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHL 348
            G NA +LA I A+ VL GEL+LL+A    G+L  AH  L R  L
Sbjct: 375 PGSNALKLAEIIASAVLAGELNLLSA-IAAGQLARAHELLGRGGL 418


>gi|322493709|emb|CBZ28999.1| 3-hydroxy-3-methylglutaryl-CoA reductase,putative [Leishmania
           mexicana MHOM/GT/2001/U1103]
          Length = 434

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/339 (34%), Positives = 185/339 (54%), Gaps = 8/339 (2%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G    ++V +P+AT E  L  S  RGA    L   G R  ++ E M
Sbjct: 97  VPVPVGLAGPLLLDG----EEVALPMATTEGALVASAHRGARAINL-SGGCRTAVLKEGM 151

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           TR+   E  + + A+  ++    +   +    E T++F + L +   +AG  + +R    
Sbjct: 152 TRAPVVEVNSFDEAIAVIKFCEERFNVLKEAFESTTRFGKLLSIKCAMAGRQVHMRFSAF 211

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NM+TK  D  +  +      +   ++SGN C+DKK +A+N + GRGK+ VAE 
Sbjct: 212 TGDAMGMNMITKGCDKALQVLQEHIPSVRVLTLSGNFCTDKKPSALNWVEGRGKSVVAEA 271

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
            I R + +  L+ + + ++ LN  KNL G+ LAG I   NAH AN++ A Y+ATGQD A 
Sbjct: 272 VIKRDVVEGVLKCTVDSVVSLNVTKNLRGSALAGSIGGFNAHAANIVAALYIATGQDPAQ 331

Query: 249 IVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGD 306
           +VE +  +T      D L  S T+P++ +G VG G  + + +  L  +GC    K   G 
Sbjct: 332 VVESATCMTTVDKAGDDLVISLTMPSIEVGAVGGGTGLSSQRAMLELMGCAGSNKEDPGA 391

Query: 307 NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           N+R++A + A  V+CGELSLL+     G L+ AH++L R
Sbjct: 392 NSRQIARVVAGAVVCGELSLLSGLA-AGHLLSAHMKLNR 429


>gi|146094120|ref|XP_001467171.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Leishmania infantum
           JPCM5]
 gi|134071535|emb|CAM70224.1| putative 3-hydroxy-3-methylglutaryl-CoA reductase [Leishmania
           infantum JPCM5]
 gi|322501265|emb|CBZ36344.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 434

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 118/339 (34%), Positives = 185/339 (54%), Gaps = 8/339 (2%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +V +P+AT E  L  S  RGA    L   G R  ++ E M
Sbjct: 97  VPVPVGLAGPLLLDGK----EVALPMATTEGALVASAHRGARAINLS-GGCRTAVLKEGM 151

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           TR+   E  + + A+T ++    +   +    E T++F + L +   +AG  + +R    
Sbjct: 152 TRAPVVEVNSFDEAITVIKFCEERFDVLKEAFESTTRFGKLLSIKCAMAGRQVHMRFSAF 211

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NM+TK  D  +  +      +   ++SGN C+DKK +A+N + GRGK+ VAE 
Sbjct: 212 TGDAMGMNMITKGCDKALQVLQQHIPSVRVLTLSGNFCTDKKPSALNWVEGRGKSVVAEA 271

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
            I R + +  L+ + + ++ LN  KNL G+ LAG I   NAH AN++ A Y+ATGQD A 
Sbjct: 272 VIKRDVVEGVLKCTVDSVVSLNVTKNLRGSALAGSIGGFNAHAANIVAALYIATGQDPAQ 331

Query: 249 IVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGD 306
           IVE +  +T      + L  S T+P++ +G VG G  + + +  L  +GC    K   G 
Sbjct: 332 IVESATCMTTVDKAGEDLVISLTMPSIEVGAVGGGTGLSSQRAMLELMGCAGSNKEDPGA 391

Query: 307 NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           N+R++A + A  V+CGELSLL+     G L+ AH++L R
Sbjct: 392 NSRQIARVVAGAVICGELSLLSGLA-AGHLLSAHMKLNR 429


>gi|167524306|ref|XP_001746489.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163775251|gb|EDQ88876.1| predicted protein [Monosiga brevicollis MX1]
          Length = 578

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 187/344 (54%), Gaps = 10/344 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+  +GP+ I     +   +VP+AT E  L  S  RG   ++    G +A ++ 
Sbjct: 142 IGYLPLPVGVVGPLVIN----EQPFRVPMATTEGALVASTNRGCR-AISKAGGAKAIIVK 196

Query: 66  ERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
             MTR+      +A  A       E    KA +      T++F R   + + +AG  L++
Sbjct: 197 NGMTRAPLLRLPSASAAAQVRLWIEQPENKAALTEAFNSTTRFGRLQSIDAWVAGRNLYV 256

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R     GDA G NMVTK     ++ +   +      S+SGN CSDKKA AIN + GRG++
Sbjct: 257 RFACHCGDAMGMNMVTKGCHKAVNLLQENFPDAQLISMSGNACSDKKAAAINWVSGRGRS 316

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            VAE  I   I +  L+T+P+ +I +N  KNLIG+ +AG +   NAH AN++ A +LATG
Sbjct: 317 VVAEALIPNDIVRSVLKTTPDAMISVNINKNLIGSAIAGTLGGYNAHAANIVAAVFLATG 376

Query: 244 QDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            D A +VE SQ LT  +   D L+ S T+P + +G VG G ++PA    L  LGC     
Sbjct: 377 NDPAQVVESSQCLTILEKDGDDLHVSVTMPAIEVGTVGGGTSLPAQAAALKMLGCQGANR 436

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +TG NA  LA + A++V+ GELSL+AA     +L++AH+ L R
Sbjct: 437 EQTGANADTLAHVVASSVMAGELSLIAALAT-DDLLKAHIELNR 479


>gi|124028378|ref|YP_001013698.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hyperthermus
           butylicus DSM 5456]
 gi|123979072|gb|ABM81353.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hyperthermus
           butylicus DSM 5456]
          Length = 428

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 179/316 (56%), Gaps = 4/316 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+  +GP+++ G+       VP+AT E  L  SV RGA    L   G RA ++ 
Sbjct: 74  IGAVQIPVGIVGPLRVRGDYANGDYYVPMATTEGALVASVNRGAKAITLS-GGARAKVLR 132

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + M R+  F T   E A   ++ +     E+ R  E T++  + L++   I GNL++LR 
Sbjct: 133 DGMARAPVFWTPGIEEAARFVEWVREHMDEVRREAESTTRHGKLLEVQPFITGNLVWLRF 192

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQW-SYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
            + TGDA G NM T A D   +WIL+ +   +   ++SGN+C+DKK   +N + GRGK  
Sbjct: 193 VYETGDAMGMNMATIATDKAAEWILANYPGTVRLIALSGNMCTDKKPALLNMLFGRGKTV 252

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VAE  I R +  K L+  PE+I  +N  KNL+GT  AG   S NAHFAN++ A ++ATGQ
Sbjct: 253 VAEAVIKRDVALKVLKARPEEIDFVNRVKNLLGTARAGSF-SLNAHFANIIAAIFIATGQ 311

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERK 303
           D A +VE S G T+ ++ +  LY S T+P+L +G VG G  +P  +  L  +G       
Sbjct: 312 DVAQVVESSMGYTWTEVRNGDLYISVTLPSLEVGTVGGGTRLPTQREALALMGVAGGGDP 371

Query: 304 TGDNARRLAAICAATV 319
            G NAR+ A I AATV
Sbjct: 372 PGSNARKFAEIVAATV 387


>gi|325958384|ref|YP_004289850.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanobacterium
           sp. AL-21]
 gi|325329816|gb|ADZ08878.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanobacterium
           sp. AL-21]
          Length = 402

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 120/341 (35%), Positives = 192/341 (56%), Gaps = 9/341 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ I G   + +  VP+AT E  L  S+ RG   ++    G  A +ID
Sbjct: 69  IGTVQIPVGIAGPLAIHGEHAEGEYYVPIATSEGALIASINRGFS-AIRAGGGATARIID 127

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIA-GNLLFLR 124
           ++MTR+   +T +   +L     I    +++    E T++  + +++   +  G  ++ R
Sbjct: 128 DKMTRAPVIKTSSVSESLKIKTWIQTNFSKLKEAAESTTRHGKLVKIDPVVVVGKYVYPR 187

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             + TGD+ G NMVT A +  ++ ++ + S  H  S+SGN+  DKK  A+N I GRGK  
Sbjct: 188 FVYTTGDSMGMNMVTIATETALNVLMEETSG-HVISLSGNVDVDKKPAAMNLIEGRGKTI 246

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AEI++ R +  K L+T+PE I+ +NT KN +G+ ++G +   NAH+ANM+   +LATGQ
Sbjct: 247 SAEISLPREVVAKTLKTTPEAIVEVNTAKNFVGSAISGSM-GFNAHYANMIGGIFLATGQ 305

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           D A+IVEGS G+T A+ +D +LYFS T+P++ +   G G  +   +  L  +G       
Sbjct: 306 DEAHIVEGSLGITVAEENDGNLYFSVTLPDVPVATFGGGTRLETARECLEIMGVYGSGGV 365

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G    + A I A TVL GELSL+ A +  G L  AH  L R
Sbjct: 366 G----KFAEIVAGTVLAGELSLMGALS-AGHLARAHKDLGR 401


>gi|268576286|ref|XP_002643123.1| Hypothetical protein CBG15296 [Caenorhabditis briggsae]
 gi|187027207|emb|CAP33633.1| hypothetical protein CBG_15296 [Caenorhabditis briggsae AF16]
          Length = 555

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 191/345 (55%), Gaps = 10/345 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V    +P+   GP+ I G+     + VP+AT E  L  S  RG ++ +    G+  ++++
Sbjct: 164 VGYTPVPVGVAGPLSINGST---DIYVPMATTEGALIASTNRGMNV-IREAGGVETSVVN 219

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
             MTR+  + F      + L    E  + +  + +  +  S+F R   +   I GNL +L
Sbjct: 220 SGMTRAPVVKFPRARDAVDLKLWIEDPINQNLVRQEFQSCSRFARLKSIDVTIDGNLAYL 279

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K+ D  M ++L ++  +   ++SGN+C DKKA A N   GRG++
Sbjct: 280 RFDAHTGDAMGMNMISKSCDLTMRFLLERFPEMQVLALSGNLCVDKKAAAKNFTEGRGRS 339

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            VAE  I R    K LRT+PE +  L T K  IG+  AG I  +NAH AN++ A ++ATG
Sbjct: 340 VVAECLIKRDTVIKTLRTTPEALAYLTTTKLHIGSARAGTIGGSNAHAANIVAAIFIATG 399

Query: 244 QDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI--E 300
           QDAA +V  +   T  ++ D+  LY SCT+P + +G VG G  +   +  L  L C    
Sbjct: 400 QDAAQVVSSAMCSTRMEVTDEKDLYVSCTLPCVEVGTVGGGTILSPQRACLECLECAGPN 459

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             + G NA RLA I AATVL GELSL+AA T   +L+ +H++L R
Sbjct: 460 HERPGGNAERLAEIIAATVLAGELSLMAALTT-NDLVSSHMKLNR 503


>gi|307169161|gb|EFN61977.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Camponotus
           floridanus]
          Length = 935

 Score =  199 bits (505), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 130/350 (37%), Positives = 195/350 (55%), Gaps = 20/350 (5%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G +      VP+AT E  L  S  RG+   + C  G+ + ++ + M
Sbjct: 544 LPVPVGIAGPLLIDGQLYY----VPMATTEGCLVASTNRGSRALIKC--GVTSRIVADGM 597

Query: 69  TRSIFFETEN---AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           TR       N   A  A+  +Q+ +    E+ R  +QTS+F R  ++H  IAG  LF+R 
Sbjct: 598 TRGPVVRFPNIVRASEAMIWMQQ-SENFQEMKRSFDQTSRFARLTKIHVLIAGRHLFIRF 656

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NM++K  +  +  + + +  +   S+SGN C+DKK  A+N I GRGK+ V
Sbjct: 657 VAKTGDAMGMNMLSKGTEKSLHTVQTYFPDMEIVSLSGNFCTDKKPAAVNWIEGRGKSVV 716

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E T+   I  K L+TS   ++ +N  KN+IG+ +AG I   NAH AN++ A ++ATGQD
Sbjct: 717 CEATVPADIVTKVLKTSVHSMVDVNISKNMIGSAMAGSIGGFNAHAANVVTAIFIATGQD 776

Query: 246 AANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC---- 298
            A  V  S  +T  +        LY SCT+P++ +G VG G  +PA    L  LG     
Sbjct: 777 PAQTVGSSNCMTLMEPSGPEGQDLYVSCTMPSIEIGTVGGGTGLPAQGACLAMLGVKGAH 836

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHL 348
           +EE   G+NA +LA I  ATVL GELSL+AA    G+L+++HL+  R ++
Sbjct: 837 LEE--PGENASKLARIICATVLAGELSLIAALA-AGQLVKSHLKHNRSNI 883


>gi|84489393|ref|YP_447625.1| HmgA [Methanosphaera stadtmanae DSM 3091]
 gi|84372712|gb|ABC56982.1| HmgA [Methanosphaera stadtmanae DSM 3091]
          Length = 402

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 191/341 (56%), Gaps = 9/341 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+  +GP+ I  N    +  VP+AT E  L  SV RG  + +   +G   +++ 
Sbjct: 70  IGTIQIPVGVVGPIVIDNNEENIETYVPMATTEGALLASVNRGCSV-IRRSNGCNVSILS 128

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS-QIAGNLLFLR 124
            +MTR+   +T++   A    + I     +I  V + T+   + L++    I G  ++ R
Sbjct: 129 NQMTRAPVLKTKSVHDANKLKKWIEDNFDKIKEVAQSTTNHGKLLKIDPIAIVGRFVYPR 188

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             + TGD+ G NMVT A    +D I  + + +H  ++SGN C DKKA+A+N I GRGK+ 
Sbjct: 189 FVYETGDSMGMNMVTIATQKALDLI-EKENNIHIIALSGNFCVDKKASAVNLIEGRGKSV 247

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VAE+ + + + ++ L+T+ + I+ +N  KNL+G+ +AG     NAH+ANM+ A +LATGQ
Sbjct: 248 VAEVIVPKEVVERVLKTTTDAIVEVNYAKNLVGSAIAGSY-GYNAHYANMVAAIFLATGQ 306

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           D A++VEGS G+T A+  +  LYFS T+P+L +  VG G  +     +L  L      K 
Sbjct: 307 DPAHVVEGSLGITSAENDNGDLYFSVTLPDLPVATVGGGTRLETAVESLNLLNA----KG 362

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +   R A+I A  VL GELSL+ A    G L  AH  L R
Sbjct: 363 SNKVNRYASIVAGIVLAGELSLVGALA-AGHLARAHEELGR 402


>gi|157872801|ref|XP_001684927.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Leishmania major strain
           Friedlin]
 gi|5052021|gb|AAD38406.1|AF155593_1 3-hydroxy-3-methylglutaryl coenzyme A reductase [Leishmania major]
 gi|68127997|emb|CAJ06753.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Leishmania major strain
           Friedlin]
          Length = 434

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 184/339 (54%), Gaps = 8/339 (2%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +V +P+AT E  L  S  RGA    L   G R  ++ E M
Sbjct: 97  VPVPVGLAGPLLLDGK----EVALPMATTEGALVASAHRGARAINLS-GGCRTAVLKEGM 151

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           TR+   E  + + A+T ++    +   +    E T++F + L +   +AG  + LR    
Sbjct: 152 TRAPVVEVNSFDEAITVIKFCEERFDVLREAFESTTRFGKLLSIKCAMAGRQVHLRFSAF 211

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NM+TK  D  +  +      +   ++SGN C+DKK +A+N + GRGK+ VAE 
Sbjct: 212 TGDAMGMNMITKGCDKALQVLQQHIPSVRVLTLSGNFCTDKKPSALNWVEGRGKSVVAEA 271

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
            I R + +  L+ + + ++ LN  KNL G+ LAG I   NAH AN++ A Y+ATGQD A 
Sbjct: 272 VIKRDVVESVLKCTVDSVVSLNVTKNLRGSALAGSIGGFNAHAANIVAALYIATGQDPAQ 331

Query: 249 IVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGD 306
           +VE +  +T      + L  S  +P++ +G VG G  + + +  L  +GC    K   G 
Sbjct: 332 VVESATCMTTVDKAGEDLVISLMMPSIEVGAVGGGTGLSSQRAMLELMGCAGSNKEDPGA 391

Query: 307 NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           ++R++A + A  V+CGELSLL+     G L+ AH++L R
Sbjct: 392 HSRQIARVVAGAVICGELSLLSGLAA-GHLLSAHMKLNR 429


>gi|162945934|gb|ABY20976.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 5 [Medicago
           truncatula]
          Length = 583

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 130/347 (37%), Positives = 192/347 (55%), Gaps = 17/347 (4%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           MP+ ++  P+ + G ++ D V+  VP+AT E  L  S  RG    H+S     G  + L+
Sbjct: 232 MPIGFVQIPVGVAGPLLLDGVEYTVPMATTEGCLVASTNRGCKAIHVS----GGASSVLL 287

Query: 65  DERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            + MTR+      +A+ A  L    E  L    +A    ++S+F R   L   IAG  L+
Sbjct: 288 RDGMTRAPVVRFSSAKRAAELKFFLEDPLNFDTLAVTFNKSSRFARLQSLQPTIAGKNLY 347

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R   +TGDA G NMV+K    V+D++ S +  +    +SGN CSDKKA A+N I GRGK
Sbjct: 348 IRFRCSTGDAMGMNMVSKGVQNVLDFLQSDFPDMDVIGISGNFCSDKKAAAVNWIEGRGK 407

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + V E  I   + +K L+TS E ++ LN  KNL G+ LAG +   NAH +N++ A Y+AT
Sbjct: 408 SVVCEAVIKEEVVKKVLKTSVEALVELNMLKNLTGSALAGALGGFNAHASNIVSAVYIAT 467

Query: 243 GQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           GQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG   
Sbjct: 468 GQDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKG 527

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                 G NAR LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 528 ANTESPGANARLLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 573


>gi|47228449|emb|CAG05269.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 882

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 126/341 (36%), Positives = 188/341 (55%), Gaps = 11/341 (3%)

Query: 18  PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ + G ++ D  +  VPLAT E  L  S  RG   ++    G R+ ++ + MTR     
Sbjct: 538 PVGVAGPLLLDDEQFHVPLATTEGCLVASTNRGCR-ALSLSSGCRSRILADGMTRGPLVR 596

Query: 76  TENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDAS 133
             +A  A  + A  E +   A I    ++TS+F R  +L   +AG  L++R +  TGDA 
Sbjct: 597 LPSACRAAEVKAWLETSDGFAAIKEAFDRTSRFARLSKLMVSLAGRNLYIRFQSQTGDAM 656

Query: 134 GHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRA 193
           G NM++K  +  +  +   +      +VSGN C+DKK+ AIN I+GRGK+ V E TI   
Sbjct: 657 GMNMLSKGTEEALRRLQQHYPDTQVLAVSGNYCTDKKSAAINWIVGRGKSVVCEATIPGK 716

Query: 194 ICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGS 253
           + ++ L++S   ++ LN  KNL+G+ +AG I   NAH AN++ A Y+A GQD A  V  S
Sbjct: 717 VVREVLKSSTADLVALNINKNLVGSAMAGSIGGFNAHAANLVAAIYIACGQDPAQTVGSS 776

Query: 254 QGLTY---AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGDNA 308
             +T    A    + LY SCT+P++ LG VG G N+P  +  L  LG       + G+NA
Sbjct: 777 NCITQMEAAGPDGEDLYISCTMPSIELGTVGGGTNLPPQQACLQMLGVQGTSSSRPGENA 836

Query: 309 RRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
           R+LA +   TVL GELSL+AA    G L+++H+   R  LN
Sbjct: 837 RQLARVVCGTVLAGELSLMAALA-AGHLVKSHMSHNRSKLN 876


>gi|307213456|gb|EFN88878.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Harpegnathos
           saltator]
          Length = 910

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 128/348 (36%), Positives = 190/348 (54%), Gaps = 16/348 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ I G +      VP+AT E  L  S  RG+   M C  G+ + ++ 
Sbjct: 535 IGYLPVPVGIAGPLLIDGELYH----VPMATTEGCLVASTNRGSRALMKC--GVTSRIVA 588

Query: 66  ERMTRSI---FFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           + MTR     F     A  A++ +Q+      E+    +QTS+F R  ++H +IAG  LF
Sbjct: 589 DGMTRGPVVRFPSIVRASEAMSWMQQ-EQNFQEMKDNFDQTSRFARLTRIHVRIAGRHLF 647

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R    TGDA G NM++K  +  +  + S +  +   S+SGN C+DKK  A+N I GRGK
Sbjct: 648 VRFVAKTGDAMGMNMLSKGTEKSLQTVQSHFPDMEILSLSGNFCTDKKPAAVNWIEGRGK 707

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + V E  +   +    L+TS   ++ +N  KN++G+ +AG I   NAH AN++ A ++AT
Sbjct: 708 SVVCEAVVPADVVTSVLKTSVHALVDVNISKNMVGSAVAGSIGGFNAHAANIVTAIFIAT 767

Query: 243 GQDAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
           GQD A  V  S  +T  +        LY SCT+P++ +G VG G  +PA    L  LG  
Sbjct: 768 GQDPAQNVGSSNCMTLMEPWGEEGQDLYVSCTMPSIEIGTVGGGTGLPAQAACLAMLGVK 827

Query: 300 EERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  G+NA +LA I  ATVL GELSL+AA T  G L+++HLR  R
Sbjct: 828 GAHATEPGENASKLARIVCATVLAGELSLMAALT-AGHLVKSHLRHNR 874


>gi|322785549|gb|EFZ12211.1| hypothetical protein SINV_14788 [Solenopsis invicta]
          Length = 799

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 126/347 (36%), Positives = 193/347 (55%), Gaps = 14/347 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + MP+  +GP+ I G        VP+AT E  L  S  RG+   + C  G+   +  
Sbjct: 460 IGYVPMPVGIVGPLLIDGQFYH----VPMATTEGCLVASTNRGSRALLKC--GVTTRVTA 513

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+   +  N   A  A+  I   +   E+ +  +QTS+F R  ++H++IAG  + L
Sbjct: 514 DGMTRAPVVQFPNIVRACEAISWIEQPQNFQELKKSFDQTSRFARLKKIHTRIAGQDVHL 573

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NM+++  +  +  + + +  +   S+SGN+C+DKK  A+N I GRGK+
Sbjct: 574 RFVATTGDAMGMNMLSQGTEKSLQTLQTYFPDMKIISLSGNLCTDKKPAAVNWIEGRGKS 633

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   +  + L+TS  +++ LN +KNLIG+ LAG I   NAH AN++ A ++ATG
Sbjct: 634 VVCEAIIPADVVARVLKTSVPELVKLNHKKNLIGSALAGSIGGFNAHAANIVTAIFIATG 693

Query: 244 QDAANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QD A  V  S  LT  +   +    L  +CT+P++ +G +G G  +PA    L  LG   
Sbjct: 694 QDPAQNVGSSNCLTLMEPWGVDGKDLRMTCTMPSIEVGTIGGGTVLPAQGACLGMLGIKG 753

Query: 301 ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  G NA++LA I  ATVL  ELSL+AA  + G+L+++HLR  R
Sbjct: 754 GHPTEPGQNAKKLAQIVCATVLAAELSLMAALAS-GDLVKSHLRHNR 799


>gi|328871733|gb|EGG20103.1| hypothetical protein DFA_07220 [Dictyostelium fasciculatum]
          Length = 583

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 123/346 (35%), Positives = 193/346 (55%), Gaps = 13/346 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G      V +P+AT E  L  S  RG   ++    G R T++   M
Sbjct: 233 VPIPVGAAGPLLLNGQT----VTIPMATTEGCLVASTHRGCK-AISESGGARCTILSRGM 287

Query: 69  TRSIFFETENAEMALTALQEI--TLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      N  +    +Q +  T     I +  E TS+F +   + + +AG  +++R +
Sbjct: 288 TRAPVVRFPNITLVGEFVQWVNATDNFVAIKQQFESTSRFAKLTNIKTTVAGRSVYIRFK 347

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV+K  D+V+  +  +++ L   S+SGN+C+DKK +AIN I GRG++ V 
Sbjct: 348 CDTGDAMGMNMVSKGVDSVLSMLRDRFADLEIVSLSGNMCTDKKPSAINWIDGRGRSVVC 407

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   I +K L+TS + ++ LN  KNL+G+ +AG I   NAH +N++ A +LATGQD 
Sbjct: 408 EAVITGDIVRKLLKTSVQGLVDLNISKNLVGSAMAGSIGGFNAHASNIVTAIFLATGQDC 467

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           A  VE S  +T  +  +D   LY + T+P++ +G VG G  +PA  + L  +G      +
Sbjct: 468 AQNVESSNCITLMEACNDGQDLYMTVTMPSIEVGTVGGGTFLPAQSSCLDIIGVRGSSTS 527

Query: 305 ---GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMH 347
              G NA +LA    A V+ GELSL++A  + G LM++HL+L R  
Sbjct: 528 LPAGSNADQLAKTICAAVMAGELSLMSA-LSAGTLMQSHLQLNRKQ 572


>gi|150399844|ref|YP_001323611.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Methanococcus
           vannielii SB]
 gi|150012547|gb|ABR54999.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanococcus
           vannielii SB]
          Length = 411

 Score =  195 bits (496), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 126/345 (36%), Positives = 189/345 (54%), Gaps = 12/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+ + GP+ + G   + +  VPLAT E  L  SV RG  I   C  G    +ID
Sbjct: 74  IGVVQIPLGFAGPLLVNGAFAKGEFNVPLATTEGALVASVNRGCSIITKC-GGATVRVID 132

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHS-QIAGNLLFLR 124
           ++MTR+   +T +   AL   + I     +I  V E T++  + + +    I G  ++ R
Sbjct: 133 DKMTRAPIIKTNSVVDALKLKEWILENFLKIKEVSESTTRHGKLISISPILIVGRNVYPR 192

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSY----LHYGSVSGNICSDKKATAINGIMGR 180
             F TGDA G NMVT A +    +I S+       +   ++SGN+C DKK  AIN I GR
Sbjct: 193 FTFKTGDAMGMNMVTIATEKACLFIESELKKEGIDVDTIALSGNVCIDKKPAAINLIEGR 252

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ +AE+ +      KYL+T+ + I  +NT KNLIG+ ++G +   NA +AN++ A +L
Sbjct: 253 GKSVIAEVFLKEEYVNKYLKTTSKAIEQVNTYKNLIGSAISGSL-GFNAQYANIVGAIFL 311

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD A++VEGS G+T A+   + LYFS T+P+L +  +G G  +      L  L C  
Sbjct: 312 ATGQDEAHVVEGSMGITTAECTKEGLYFSVTLPDLPIATIGGGTRVEPQNECLELLECAG 371

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             K+     + A I  A+VL GELSL+ A +  G L +AH  L R
Sbjct: 372 TGKS----EKFAEIVGASVLAGELSLIGALS-AGHLAKAHSELGR 411


>gi|292656702|ref|YP_003536599.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Haloferax volcanii
           DS2]
 gi|291370679|gb|ADE02906.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Haloferax volcanii
           DS2]
          Length = 403

 Score =  195 bits (496), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 179/341 (52%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V SI +PM   GP+ + G  +  +  +PLAT E  L  SV RG  + +    G  A ++ 
Sbjct: 67  VGSIQVPMGVAGPVSVDGGSVAGEKYLPLATTEGALLASVNRGCSV-INSAGGATARVLK 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F   +   A   +       A +    E+T+     L +   + GN ++LR 
Sbjct: 126 SGMTRAPVFRVADVAEAEALVSWTRDNFAALKEAAEETTNHGELLDVTPYVVGNSVYLRF 185

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NM T A +AV   ++   +     ++SGN+CSDKK  AIN + GRG++  
Sbjct: 186 RYDTKDAMGMNMATIATEAVC-GVVEAETAASLVALSGNLCSDKKPAAINAVEGRGRSVT 244

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++ I R + ++ L T+PE +  LNT+KNL+G+  A  +   NAH AN++ A +LATGQD
Sbjct: 245 ADVRIPREVVEERLHTTPEAVAELNTRKNLVGSAKAASL-GFNAHVANVVAAMFLATGQD 303

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VEG+  +T A++ D  LY S +I +L +G VG G  +P     L  LG        
Sbjct: 304 EAQVVEGANAITTAEVQDGDLYVSVSIASLEVGTVGGGTKLPTQSEGLDILGVSGGGDPA 363

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA  LA   A   L GELSLL+A  +   L  AH  L R
Sbjct: 364 GSNADALAECIAVGSLAGELSLLSALASR-HLSSAHAELGR 403


>gi|162945932|gb|ABY20975.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 4 [Medicago
           truncatula]
          Length = 545

 Score =  195 bits (495), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 189/343 (55%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  A ++ + M
Sbjct: 199 VQIPVGVAGPLLLDGK----EYTVPMATTEGCLVASTNRGCK-AIYVSGGASAVVLRDGM 253

Query: 69  TRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      +A+ A  L    E  L    I+    ++S+F R   + + IAG  L+ R  
Sbjct: 254 TRAPVVRFNSAKRASQLKFFLEDPLNFDSISHTFNKSSRFARLQNIKATIAGKNLYTRFT 313

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKKA A+N I GRGK+ V 
Sbjct: 314 CSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKAAAVNWIEGRGKSVVC 373

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+TS E ++ LN  KNL G+ +AG +   NAH +N++ A YLATGQD 
Sbjct: 374 EAVIKEEVVKKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYLATGQDP 433

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     + 
Sbjct: 434 AQNVESSHCMTMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKE 493

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G N+R+LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 494 SPGANSRQLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 535


>gi|296088511|emb|CBI37502.3| unnamed protein product [Vitis vinifera]
          Length = 551

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 191/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG      C  G  + ++ +R
Sbjct: 200 MPVGYVQIPVGIAGPLLLDGREYWVPMATTEGCLVASTNRGCKAIFTC-GGASSMVLRDR 258

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T +    L    E  +    +A V  ++S+F R   +H  IAG  L++R 
Sbjct: 259 MTRAPVVRFPTASRAADLKLFVEDPINFDTLAVVFNRSSRFARLQGIHCAIAGKNLYMRF 318

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 319 GCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 378

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+TS   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 379 CEAIIGDEVVRKVLKTSVAALVELNMLKNLTGSAVAGALGGFNAHASNIVSAVYIATGQD 438

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 439 PAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 498

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA I A +VL GELSL++A    G+L+++HL+  R
Sbjct: 499 ESPGSNSRLLATIVAGSVLAGELSLMSA-IAAGQLVKSHLKYNR 541


>gi|18000044|gb|AAL54879.1|AF004233_1 hydroxy-methyl-glutaryl-coenzyme A reductase [Nicotiana tabacum]
          Length = 604

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 192/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 253 MPIGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCK-AIYASGGATSVLLRDG 311

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  +K   +A V  Q+S+F R  ++   IAG  L++R 
Sbjct: 312 MTRAPCVRFGTAKRAAELKFFVEDPVKFETLAAVFNQSSRFARLQRIQCAIAGKNLYMRF 371

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ +++S +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 372 VCSTGDAMGMNMVSKGVQNVLDYLQNEYSDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 431

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 432 CEAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYIATGQD 491

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG      
Sbjct: 492 PAQNIESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANR 551

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 552 EVPGSNARLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 594


>gi|15227821|ref|NP_179329.1| HMG2 (3-HYDROXY-3-METHYLGLUTARYL-COA REDUCTASE 2);
           hydroxymethylglutaryl-CoA reductase [Arabidopsis
           thaliana]
 gi|1170317|sp|P43256|HMDH2_ARATH RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 2;
           Short=HMG-CoA reductase 2; Short=HMGR2
 gi|388558|gb|AAA67317.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Arabidopsis thaliana]
 gi|16323153|gb|AAL15311.1| At2g17370/F15M4.1 [Arabidopsis thaliana]
 gi|23506019|gb|AAN28869.1| At2g17370/F15M4.1 [Arabidopsis thaliana]
 gi|330251524|gb|AEC06618.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Arabidopsis
           thaliana]
          Length = 562

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 127/346 (36%), Positives = 196/346 (56%), Gaps = 17/346 (4%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRG---AHISMLCPDGIRATLI 64
           MP+ ++  P+ I G ++ D V+  VP+AT E  L  S  RG    H+S     G  + L+
Sbjct: 210 MPVGYVQIPVGIAGPLLLDGVEYSVPMATTEGCLVASTNRGFKAIHLS----GGAFSVLV 265

Query: 65  DERMTRSI---FFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
            + MTR+    F     A + +  LQ+ +     ++ +  ++S+F R   +   IAG  L
Sbjct: 266 KDAMTRAPVVRFPSARRAALVMFYLQDPS-NFERLSLIFNKSSRFARLQSITCTIAGRNL 324

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           + R   +TGDA G NMV+K    V+D++ S++  +    +SGN CSDKKA+A+N I GRG
Sbjct: 325 YPRFACSTGDAMGMNMVSKGVQNVLDFVKSEFPDMDVIGISGNYCSDKKASAVNWIEGRG 384

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  I   I +K L+TS E ++ LNT KNL+G+ +AG +   NAH +N++ A ++A
Sbjct: 385 KHVVCEAFIKAEIVEKVLKTSVEALVELNTLKNLVGSAMAGSLGGFNAHSSNIVSAVFIA 444

Query: 242 TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           TGQD A  VE S  +T      D L+ S ++P + +G VG G  + +    L  LG    
Sbjct: 445 TGQDPAQNVESSHCMTMILPDGDDLHISVSMPCIEVGTVGGGTQLASQAACLNLLGVKGS 504

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              K G NA++LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 505 NNEKPGSNAQQLARIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 549


>gi|225431671|ref|XP_002265638.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 572

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 191/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG      C  G  + ++ +R
Sbjct: 221 MPVGYVQIPVGIAGPLLLDGREYWVPMATTEGCLVASTNRGCKAIFTC-GGASSMVLRDR 279

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T +    L    E  +    +A V  ++S+F R   +H  IAG  L++R 
Sbjct: 280 MTRAPVVRFPTASRAADLKLFVEDPINFDTLAVVFNRSSRFARLQGIHCAIAGKNLYMRF 339

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 340 GCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 399

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+TS   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 400 CEAIIGDEVVRKVLKTSVAALVELNMLKNLTGSAVAGALGGFNAHASNIVSAVYIATGQD 459

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 460 PAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 519

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA I A +VL GELSL++A    G+L+++HL+  R
Sbjct: 520 ESPGSNSRLLATIVAGSVLAGELSLMSA-IAAGQLVKSHLKYNR 562


>gi|154341983|ref|XP_001566943.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134064268|emb|CAM40467.1| putative 3-hydroxy-3-methylglutaryl-CoA reductase [Leishmania
           braziliensis MHOM/BR/75/M2904]
          Length = 434

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 115/339 (33%), Positives = 182/339 (53%), Gaps = 8/339 (2%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +V +P+AT E  L  S  RGA    L   G R  ++ E M
Sbjct: 97  VPVPVGLAGPLLLDGK----EVGLPMATTEGALVASTHRGARAINL-SGGCRTAVLKEGM 151

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           TR+   E  + + A+  ++    +   +    E T++F +   +   +AG  + +R    
Sbjct: 152 TRAPVVEVSSFDEAIALVKFCEERFDMLKEAFESTTRFGKLQSIKCAMAGRQVHMRFSAF 211

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NM+TK  D  +  +      +   ++SGN C+DKK +A+N + GRGK+ VAE 
Sbjct: 212 TGDAMGMNMITKGCDKALRVLQQHIPSMRVLALSGNFCTDKKPSAVNWVEGRGKSVVAEA 271

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
            I R + +  L+ + + ++ LN  KNL G+ LAG I   NAH AN++ A Y+ATGQD A 
Sbjct: 272 VIKRCVVEGVLKCTVDSVVSLNVTKNLRGSALAGSIGGFNAHAANIVAALYIATGQDPAQ 331

Query: 249 IVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGD 306
           +VE +  +T      + L  S T+P++ +G VG G  + +    L  +GC    K   G 
Sbjct: 332 VVESATCMTTIDKVGEDLMISLTMPSIEVGAVGGGTGLSSQSAMLELMGCAGANKEDPGA 391

Query: 307 NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           N+R++A + A  V+CGELSL+A     G L+ AH++L R
Sbjct: 392 NSRQIARVVAGAVICGELSLMAGLA-AGHLLSAHMKLNR 429


>gi|327262987|ref|XP_003216303.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like
           [Anolis carolinensis]
          Length = 881

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 126/351 (35%), Positives = 191/351 (54%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+  +GP+ +     Q    VP+AT E  L  S  RG   ++    G ++ ++ 
Sbjct: 524 IGYMPIPVGVVGPLLLDNKEFQ----VPMATTEGCLVASTNRGCR-AICLGGGAKSRILA 578

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR   I   T      + A  E      +I  V + TS+F R  +LH  +AG  L++
Sbjct: 579 DGMTRGPVIRLPTACQSAEVKAWLETPEGFKKIKDVFDSTSRFARLQRLHVGLAGRNLYI 638

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +  ++  LH  +VSGN C+DKK  AIN + GRGK+
Sbjct: 639 RFQARTGDAMGMNMISKGTEKALAKLQEEFPDLHVLAVSGNYCTDKKPAAINWVEGRGKS 698

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 699 VVCEAIIPAKVVKEVLKTTTEAMIEVNVNKNLVGSAMAGSIGGYNAHAANIVTAMYIACG 758

Query: 244 QDAANIVEGSQGLTY---AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           QDAA  V  S  +T    A   ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 759 QDAAQNVSSSNCITLMESAGPANEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 818

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                 G+NAR+LA I  ATV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 819 ASSENPGENARQLAKIVCATVMAGELSLMAALA-AGHLVRSHMIHNRSKIN 868


>gi|255575235|ref|XP_002528521.1| hmg-CoA reductase, putative [Ricinus communis]
 gi|223532023|gb|EEF33833.1| hmg-CoA reductase, putative [Ricinus communis]
          Length = 576

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 189/343 (55%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + GN    +  VP+AT E  L  S  RG   ++    G  +TL+ + M
Sbjct: 230 VQIPVGIAGPLLLDGN----EYTVPMATTEGCLVASTNRGCK-AIYVSGGATSTLLRDGM 284

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F+T      L    E       IA V  ++S+F R   +   IAG  L++R  
Sbjct: 285 TRAPVVRFQTAQRAAELKFFMEDPNNFDTIALVFNKSSRFGRLQSVQCAIAGKNLYMRFR 344

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKKA A+N I GRGK+ V 
Sbjct: 345 CSTGDAMGMNMVSKGVQNVLDYLQNEFPDMDVIGISGNFCSDKKAAAVNWIEGRGKSVVC 404

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  +   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A YLATGQD 
Sbjct: 405 EAIVKEEVVKKVLKTNVAALVELNVLKNLTGSAVAGALGGFNAHASNIVTAVYLATGQDP 464

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     + 
Sbjct: 465 AQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVRGASKD 524

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G N+R LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 525 SPGSNSRLLATIVAGSVLAGELSLMSALAA-GQLVRSHMKYNR 566


>gi|306416887|gb|ADM87300.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Glycyrrhiza
           uralensis]
          Length = 573

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 192/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ + G ++ D  +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 222 MPIGFVQIPVGVAGPLLLDGKEYTVPMATTEGCLVASTNRGCK-AIHASGGASSVLLRDG 280

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F+T      L    E  L    ++ V  ++S+F R   +   IAG  L++R 
Sbjct: 281 MTRAPVVRFQTAKRAAQLKFYLEDPLNFDSLSVVFNKSSRFARLQSIQPAIAGKNLYIRF 340

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKKA A+N I GRGK+ V
Sbjct: 341 RCSTGDAMGMNMVSKGVQNVLDFLQNDFPDMEVIGISGNFCSDKKAAAVNWIEGRGKSVV 400

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   +  K L+TS E ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 401 CEAIIKEEVVNKVLKTSVEALVELNMLKNLTGSAVAGALGGFNAHASNIVSAIYIATGQD 460

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 461 PAQNVESSHCITMMEAVNDGKDLHVSVTMPSVEVGTVGGGTQLASQSACLNLLGVKGASK 520

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 521 ESPGANARQLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 563


>gi|25990288|gb|AAL28015.2|AF389879_1 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Andrographis
           paniculata]
 gi|37791454|gb|AAR03707.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Andrographis
           paniculata]
          Length = 595

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 194/350 (55%), Gaps = 11/350 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++L   G  + ++ + 
Sbjct: 241 MPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCK-AILASGGAFSAVLRDG 299

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  L    ++ V   +S+F R   +   +AG  L++R 
Sbjct: 300 MTRAPVVRFATAKRAAELKFFLEDPLNFETLSMVFNSSSRFGRLQSIKCAVAGKNLYIRF 359

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ +++S +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 360 SCSTGDAMGMNMVSKGVQNVIDFLGNEFSDMEVIGLSGNYCSDKKPAAVNWIEGRGKSVV 419

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 420 CEAIIKEEVVKKVLKTNVSSLVELNMLKNLTGSAVAGALGGFNAHASNLVSAVYIATGQD 479

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
            A  +E S  +T  +  +D   L+ S T+P++ +G VG G  +P+    L  LG     K
Sbjct: 480 PAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLPSQSACLNLLGVKGASK 539

Query: 304 --TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE 351
              G N+R LA I A TVL GELSL++A  + G+L+ +H++  R   N +
Sbjct: 540 EVPGSNSRLLATIVAGTVLAGELSLMSA-ISAGQLVNSHMKFNRASHNKD 588


>gi|91082547|ref|XP_973850.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-CoA reductase
           [Tribolium castaneum]
 gi|270007562|gb|EFA04010.1| hypothetical protein TcasGA2_TC014159 [Tribolium castaneum]
          Length = 863

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 126/348 (36%), Positives = 190/348 (54%), Gaps = 16/348 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+ + GP+ + G      V VP+AT E  L  S  RG    + C  G+ + ++ 
Sbjct: 502 IGYMPVPVGYAGPLNLDGR----HVYVPMATTEGCLVASTNRGCRALLDC--GVTSRVVS 555

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR       +   A  A+  +   +    + +  + +S+F R  +L  +IAG  LF+
Sbjct: 556 DGMTRGPVVRFPSITKASEAMSWMKCSQNFEAMKQQFDSSSRFARLSKLLIKIAGRHLFV 615

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R E  TGDA G NMV+K  +  + ++  Q+  +   S+SGN C+DKK  A+N I GRGK+
Sbjct: 616 RFEAKTGDAMGMNMVSKGTEMSLKYVQKQFPEMEILSLSGNFCTDKKPAAVNWIEGRGKS 675

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   I +K L+TS   ++ +N  KN+IG+ +AG I   NAH AN++ A Y+ATG
Sbjct: 676 VVCEAIIPSEIVKKVLKTSTPALVDVNNSKNMIGSAVAGSIGGFNAHAANIVTAIYIATG 735

Query: 244 QDAANIVEGSQGLT----YAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
           QD A  +  S  +T    + +  +D LY SCT+P++ +G VG G  +PA  + L  L   
Sbjct: 736 QDPAQNIGSSNCMTLMEPWGETGED-LYVSCTMPSIEIGTVGGGTVLPAQSSCLEMLRVK 794

Query: 300 EERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                  G+NA +LA I   TVL GELSL+AA T  G L+ +HLR  R
Sbjct: 795 GSHPDCPGENASQLARIVCGTVLAGELSLMAALT-AGHLVRSHLRHNR 841


>gi|18276268|sp|Q12649|HMDH_PHYBL RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
            Short=HMG-CoA reductase
 gi|9188117|emb|CAB97179.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Phycomyces
            blakesleeanus]
          Length = 1176

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 131/342 (38%), Positives = 184/342 (53%), Gaps = 11/342 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GPM I G++I     +P+AT E  L  S  RG   ++    G    +I + M
Sbjct: 816  MPIPVGVAGPMNIDGDLIH----IPMATTEGCLVASTARGCK-AINAGGGASTIVIADGM 870

Query: 69   TRSIFFETENAEMALTALQEITLKKAEIA-RVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
            TR    E      A      I  +  +I       TS+F R  +L   +AG L+F+R   
Sbjct: 871  TRGPCVEFPTILRAAACKLWIENEGNDIVTNAFNSTSRFARLRKLKIALAGKLVFIRFST 930

Query: 128  ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
             TGDA G NM++K  +  +  I   +  +   S+SGN C+DKK  AIN I GRGK+ V E
Sbjct: 931  TTGDAMGMNMISKGCEKALSIITEHFPDMQIISLSGNYCTDKKPAAINWIEGRGKSVVTE 990

Query: 188  ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
              I  AI +K L+T+   ++ LN  KNLIG+ +AG +   NAH AN+L A YLATGQD A
Sbjct: 991  AVIPGAIVEKVLKTTVAALVELNISKNLIGSAMAGSVGGFNAHAANILTAIYLATGQDPA 1050

Query: 248  NIVEGSQGLTYAKLHDDS--LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
              VE S  +T  K  +D+  L+ SCT+P++ +G +G G  +P  ++ L  LG      T 
Sbjct: 1051 QNVESSNCITLMKAVNDTKDLHISCTMPSIEVGTIGGGTILPPQQSMLDMLGVRGPHPTE 1110

Query: 305  -GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NA+RLA I  A V+ GELSL AA    G L++AH+   R
Sbjct: 1111 PGKNAQRLARIICAAVMAGELSLCAALAA-GHLVKAHMAHNR 1151


>gi|321470030|gb|EFX81008.1| protein HMG coenzyme A reductase-like protein [Daphnia pulex]
          Length = 852

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 134/356 (37%), Positives = 196/356 (55%), Gaps = 29/356 (8%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDG-IRATLIDER 67
           + +P+ + GP+ + G    +   +P+AT E  L  S  RG   S L P+G +R  LI + 
Sbjct: 503 VPLPVGFAGPLIVDG----ESYFIPMATTEGCLVASTNRGC--SALAPNGGVRTQLIADG 556

Query: 68  MTRSIFFETENAEMA---LTALQEIT----LKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           M+R   F   +   A   +  LQE +    LKK+        TS+F R  ++  QIAG  
Sbjct: 557 MSRGPVFRLPDIRRAGDVMAWLQEPSNIDLLKKS-----FNATSRFGRLQKIRCQIAGRH 611

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           +F+R    TGDA G NMV+K  +A +  I S ++ L   S+SGN C+DKK  A+N + GR
Sbjct: 612 VFIRFVAKTGDAMGMNMVSKGTEAAIKVIQSHFADLAVVSLSGNFCTDKKPAAVNWLDGR 671

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ V+E  I  AI +  L+T+   ++ LN  KNLIG+ +AG I   NAH AN++ A ++
Sbjct: 672 GKSVVSEAIIPAAIVRDKLKTNVASLVDLNITKNLIGSSIAGSIGGFNAHAANIVSAIFI 731

Query: 241 ATGQDAANIVEGSQGLTY-----AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTA 295
           ATGQD A +V  S  +T       ++ D  LY SCT+P+L +G +G G  +PA    L  
Sbjct: 732 ATGQDPAQVVSSSNCMTLMEPWGPEMQD--LYISCTMPSLEVGTIGGGTWLPAQGACLDM 789

Query: 296 LGC--IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
           LG       + G NA RLA I  A VL GELSL+++    G L+++H+   R + N
Sbjct: 790 LGLRGSNAEEPGANACRLARIICAAVLAGELSLMSSLAT-GTLVQSHMTHNRSYAN 844


>gi|146186446|gb|ABQ09275.1| HMG CoA-reductase [Oryzias latipes]
          Length = 410

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 184/343 (53%), Gaps = 13/343 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 71  IGYVPVPVGVAGPLHLDGKQFQ----VPMATTEGCLVASTNRGCRAIALA-GGASSRILA 125

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR       +A  A  + A  E T     +    + TS+F R  +L   +AG  L++
Sbjct: 126 DSMTRGPVVRLPSACSAAEVRAWLESTDGFQAVKEAFDNTSRFARLQRLLVGLAGRNLYI 185

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NM++K  +  +  +   +  L   +VSGN C+DKK  AIN I GRGK+
Sbjct: 186 RFHATTGDAMGMNMISKGTEQALGLLQQHFPELQVVAVSGNFCTDKKPAAINWIEGRGKS 245

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI   + Q+ L+T+   ++ +N QKNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 246 AVCEATIPSKVVQEVLKTTTAALVEVNIQKNLVGSAMAGSIGGFNAHAANLVAAIYIACG 305

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           QD A  V  S  +T  +      + LY SCT+P++ LG VG G N+P  +  L  LG   
Sbjct: 306 QDPAQAVGSSNCITLMEPSGPMGEDLYISCTMPSIELGTVGGGTNLPPQQACLQMLGVQG 365

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHL 341
             +   G+NAR+LA +  ATVL GELSL++A    G L+++H+
Sbjct: 366 ASQDHPGENARQLARVVCATVLAGELSLMSALAA-GHLVKSHM 407


>gi|47551099|ref|NP_999724.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Strongylocentrotus
           purpuratus]
 gi|123346|sp|P16393|HMDH_STRPU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|161523|gb|AAA30060.1| HMGCoA reductase (EC 1.1.1.34) [Strongylocentrotus purpuratus]
          Length = 932

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 127/351 (36%), Positives = 188/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG   ++    GI + LI 
Sbjct: 547 IGYMPVPVGVAGPLLLDGQEFQ----VPMATTEGCLVASTNRGCR-ALRSAGGIHSVLIG 601

Query: 66  ERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR       +A+ A    Q  E+    A I    E TS+F +   + + +AG  +FL
Sbjct: 602 DGMTRGPLVRLPSAQEAGAIKQWLEVPENFAAIKERFESTSRFAKLKSIQTALAGRYMFL 661

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  + + +  +   S+SGN C+DKK  AIN I GRGK+
Sbjct: 662 RFKALTGDAMGMNMISKGTEQALHALQTMFPNIEIMSLSGNYCTDKKVAAINWIEGRGKS 721

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E T+   I Q+ L+TS   ++ LN  KNL+G+ +AG I   NAH AN++ A Y+ATG
Sbjct: 722 VVCEATVPAHIVQQVLKTSASALVDLNIHKNLVGSAMAGSIGGFNAHAANIVTAIYIATG 781

Query: 244 QDAANIVEGSQGLTYAKLHDD---SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  +  S  +T  +        LY SCT+P++ LG VG G  +P     L  +    
Sbjct: 782 QDAAQNIASSNCMTLMETRGPKGGDLYLSCTMPSIELGTVGGGTVLPPQSACLQMMDVKG 841

Query: 301 E--RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                +G NA +LA I  ATV+ GELSL++A    G L+++H++  R  LN
Sbjct: 842 SNIHGSGLNASQLARIVCATVMAGELSLMSALAA-GHLVKSHMKHNRSALN 891


>gi|316976086|gb|EFV59429.1| hydroxymethylglutaryl-coenzyme A reductase domain protein
           [Trichinella spiralis]
          Length = 849

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 127/348 (36%), Positives = 189/348 (54%), Gaps = 16/348 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           I +P+ + GP+K+        V +PL+T E  L  S+ RG     L   G+R  L+ +RM
Sbjct: 472 IPVPVGFAGPLKVDDRT----VYIPLSTTEGCLVASLNRGCRALQL-SAGVRTVLLGDRM 526

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR   + FE            E       +  +   TS++ +   +   ++G  ++LR  
Sbjct: 527 TRGPVVCFEDIVQAHEFKLWIENEDNYLLLKNIFNSTSRYAKLTAIDVALSGRFVYLRFS 586

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSY---LHYGSVSGNICSDKKATAINGIMGRGKN 183
             TGDA G NM++K  + V+  +  Q +Y   +   S+SGN C DKKA+A+N I+GRGK+
Sbjct: 587 ATTGDAMGMNMISKGVELVLSEL--QHNYFPNMKIISLSGNYCVDKKASAMNWIVGRGKS 644

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
              E  + R++    L+T  + ++ LNT KNL+G+  AG +   NAH AN++ A +L+TG
Sbjct: 645 VSCEAVVRRSVVTDILKTDVDSLVELNTLKNLVGSARAGVLGGFNAHSANIVAAIFLSTG 704

Query: 244 QDAANIVEGSQGLTY-AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE-- 300
           QD A +V  SQ LT+  K  +  L  SCT+P L +G VG G  +PA K  L  LGC    
Sbjct: 705 QDIAEVVGSSQCLTFLEKTENGDLRISCTMPTLEVGTVGGGTVLPAQKACLEILGCAGSC 764

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHL 348
           +   G+NARR + I  A VL GELSLL+A    G L+ +H+R  R +L
Sbjct: 765 DEFPGNNARRFSRIICAAVLAGELSLLSALC-AGHLVRSHMRYNRSNL 811


>gi|729726|sp|Q01559|HMDH_NICSY RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|19746|emb|CAA45181.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Nicotiana
           sylvestris]
          Length = 604

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 191/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 253 MPIGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCK-AIYASGGATSVLLRDG 311

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  +K   +A V  Q+S+F R  ++   IAG  L++R 
Sbjct: 312 MTRAPCVRFGTAKRAAELKFFVEDPVKFETLAAVFNQSSRFARLQRIQCAIAGKNLYMRF 371

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 372 VCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 431

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 432 CEAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYIATGQD 491

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG      
Sbjct: 492 PAQNIESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANR 551

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 552 EVPGSNARLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 594


>gi|2654423|gb|AAB87727.1| hydroxy-methylglutaryl-coenzyme A reductase [Nicotiana tabacum]
          Length = 604

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 189/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 253 MPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCK-AIFASGGAISVLLRDG 311

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  L    ++ V  ++S+F R   +   IAG  L++R 
Sbjct: 312 MTRAPVVRFATAKRAAELKFFVEDPLNFETLSLVFNKSSRFARLQSIQCAIAGKNLYMRF 371

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 372 SCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 431

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A YLATGQD
Sbjct: 432 CEAIITEEVVKKVLKTEVASLVELNVLKNLTGSAMAGALGGFNAHASNIVSAVYLATGQD 491

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG      
Sbjct: 492 PAQNVESSHCITMIEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANR 551

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 552 EAAGSNARLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 594


>gi|17224608|gb|AAL37041.1|AF303583_1 3-hydroxy-3-methylglutaryl coenzyme A [Pisum sativum]
          Length = 577

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 191/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ + G ++ D ++  VP+AT E  L  S  RG      C  G  + L+ + 
Sbjct: 226 MPIGFVQIPVGVAGPLLLDGIEYTVPMATTEGCLVASTNRGCKAIHAC-GGASSVLLRDG 284

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F +      L    E  L   E++    ++S+F R   +   IAG  L++R 
Sbjct: 285 MTRAPVVRFSSAKRAAQLKFYLEDPLNFDELSLSFNKSSRFARLQSIQPAIAGKNLYIRF 344

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKKA A+N I GRGK+ V
Sbjct: 345 RCSTGDAMGMNMVSKGVQNVLDFLQNDFFDMEVIGISGNFCSDKKAAAVNWIEGRGKSVV 404

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + QK L+T+ E ++ LN  KNL G+ +AG +   NAH +N++ A +LATGQD
Sbjct: 405 CEAVIKEEVVQKVLKTNVEALVELNMLKNLTGSAIAGALGGFNAHASNIVSAIFLATGQD 464

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     K
Sbjct: 465 PAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 524

Query: 304 --TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 525 DSPGANSRLLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 567


>gi|302348836|ref|YP_003816474.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Acidilobus
           saccharovorans 345-15]
 gi|302329248|gb|ADL19443.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Acidilobus
           saccharovorans 345-15]
          Length = 419

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 193/345 (55%), Gaps = 11/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +  +P+  +GP+K+ G+  + +  VP+AT E  L   V RG   ++    G R+ ++ 
Sbjct: 78  IGAAQIPLGVVGPLKVQGDYARGEFYVPMATTEGALVAGVNRGVK-AVTMSGGARSKVLY 136

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTR---FLQLHSQIAGNLLF 122
           + MTR+    T +   A +    I   K  I  + E+  + TR    + + + I GN+L+
Sbjct: 137 DGMTRAPIIWTPSVVEAQSLASWI---KGNIGALREEVKKVTRHGELVDVQTYIVGNILW 193

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG-SVSGNICSDKKATAINGIMGRG 181
            R  F TGDA G N+ T A+D +  +I   +   H   SVSGN+CSDKK ++IN ++GRG
Sbjct: 194 PRFVFRTGDAMGMNIATIASDLLCSYIDEHYKGEHRCLSVSGNLCSDKKPSSINRLLGRG 253

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K  V+E  +   + +  +RT+PE +  +N  KNL+G  +AG   S N H AN++ A ++A
Sbjct: 254 KYVVSEAIVKGDVLRDLMRTTPESVDFINKSKNLLGNAVAGS-PSFNGHVANIIAAIFIA 312

Query: 242 TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-E 300
           TGQD A +VE S   T+ ++  + LY S T+P+L +G VG G  +P  +  L  LG    
Sbjct: 313 TGQDVAQVVESSMAYTWTEVRGNDLYISVTLPSLEVGTVGGGTWLPTQREALELLGVAGG 372

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               G NA +LA I AA  L GEL+LLA+Q   GEL +AH RL R
Sbjct: 373 GNPPGVNALKLAEIVAAVALAGELNLLASQVT-GELAKAHERLGR 416


>gi|115607094|gb|ABJ16394.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Ligularia
           fischeri]
          Length = 579

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 190/343 (55%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GPM + GN    +  VP+AT E  L  S  RG   ++    G  + L+ + M
Sbjct: 231 VQIPVGIAGPMLLDGN----EFSVPMATTEGCLVASTNRGFK-AIYLSGGATSVLLKDGM 285

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F T      L    E  L    +A V  ++S+F R  ++   IAG  L++R  
Sbjct: 286 TRAPVVRFGTAKRASDLKFFLEEPLNFETLASVFNKSSRFGRLQRIQCAIAGKNLYIRFT 345

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NM++K    V+D++   +  +    +SGN CSDKK  A+N I GRGK+ V 
Sbjct: 346 CSTGDAMGMNMISKGVQNVLDYLQVDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVC 405

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I+  + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A YLATGQD 
Sbjct: 406 EAIISDEVVKKVLKTTVASLVELNMLKNLTGSAIAGALGGFNAHASNIVSAVYLATGQDP 465

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK- 303
           A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     K 
Sbjct: 466 AQNIESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGAQLASQSACLNLLGVKGANKE 525

Query: 304 -TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NAR+LA I A++VL GELSL++A    G+L+++H++  R
Sbjct: 526 LAGSNARQLAKIVASSVLAGELSLMSA-IAAGQLVKSHMKYNR 567


>gi|2495266|sp|Q59468|HMDH_HALVO RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|149027|gb|AAA73174.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Haloferax
           volcanii]
 gi|31415496|gb|AAP44988.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Shuttle vector
           pNG168]
          Length = 403

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 179/341 (52%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V SI +PM   GP+ + G  +  +  +PLAT E  L  SV RG  + +    G  A ++ 
Sbjct: 67  VGSIQVPMGVAGPVSVDGGSVAGEKYLPLATTEGALLASVNRGCSV-INSAGGATARVLK 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F   +   A   +       A +    E+T+     L +   + GN ++LR 
Sbjct: 126 SGMTRAPVFRVADVAEAEALVSWTRDNFAALKEAAEETTNHGELLDVTPYVVGNSVYLRF 185

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NM T A +AV   ++   +     ++SGN+CSDKK  AIN + GRG++  
Sbjct: 186 RYDTKDAMGMNMATIATEAVC-GVVEAETAASLVALSGNLCSDKKPAAINAVEGRGRSVT 244

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++ I R + ++ L T+PE+   LNT+KNL+G+  A  +   NAH AN++ A +LATGQD
Sbjct: 245 ADVRIPREVVEERLHTTPERGRELNTRKNLVGSAKAASL-GFNAHVANVVAAMFLATGQD 303

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VEG+  +T A++ D  LY S +I +L +G VG G  +P     L  LG        
Sbjct: 304 EAQVVEGANAITTAEVQDGDLYVSVSIASLEVGTVGGGTKLPTQSEGLDILGVSGGGDPA 363

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA  LA   A   L GELSLL+A  +   L  AH  L R
Sbjct: 364 GSNADALAECIAVGSLAGELSLLSALASR-HLSSAHAELGR 403


>gi|162945926|gb|ABY20972.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Medicago
           truncatula]
          Length = 550

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 189/343 (55%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + GN    +  VP+AT E  L  S  RG   ++    G  A ++ + M
Sbjct: 204 VQIPVGVAGPLLLDGN----EYTVPMATTEGCLVASTNRGCK-AIYVSGGASAVVLRDGM 258

Query: 69  TRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      +A+ A  L    E       ++    ++S+F R   + + +AG  L+ R  
Sbjct: 259 TRAPVVRFNSAKRASQLKFFLEDPQNFDSLSHTFNKSSRFARLQSIKATMAGKNLYTRFT 318

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKKA A+N I GRGK+ V 
Sbjct: 319 CSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKAAAVNWIEGRGKSVVC 378

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+TS E ++ LN  KNL G+ +AG +   NAH +N++ A YLATGQD 
Sbjct: 379 EAVIKEEVVKKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVSAIYLATGQDP 438

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     + 
Sbjct: 439 AQNVESSHCMTMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKE 498

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G N+R+LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 499 TPGANSRQLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 540


>gi|158513199|sp|A2X8W3|HMDH1_ORYSI RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 1;
           Short=HMG-CoA reductase 1
 gi|218191458|gb|EEC73885.1| hypothetical protein OsI_08675 [Oryza sativa Indica Group]
          Length = 539

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 128/346 (36%), Positives = 192/346 (55%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  SV RG   ++    G  + L+ 
Sbjct: 190 VGYVQLPVGVAGPLLLDGR----EYHVPMATTEGCLVASVNRGCR-AISASGGAFSVLLR 244

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + M+R+   +  +A  A  L A  E       +A V  ++S+F R   +   +AG  L++
Sbjct: 245 DAMSRAPAVKLPSAMRAAELKAFAEAPANFELLAAVFNRSSRFGRLQDIRCALAGRNLYM 304

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K  + V+ ++ + +  +   SVSGN CSDKK TA+N I GRGK+
Sbjct: 305 RFSCITGDAMGMNMVSKGVENVLGYLQNVFPDMDVISVSGNYCSDKKPTAVNWIEGRGKS 364

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+ EK++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 365 VVCEAIIKGDVVQKVLKTTVEKLVELNIIKNLAGSAVAGALGGFNAHASNIVTALFIATG 424

Query: 244 QDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  D  D L+ S T+P++ +G +G G  + +    L  LG    
Sbjct: 425 QDPAQNVESSQCITMLEEVDDGDDLHISVTMPSIEVGTIGGGTCLASQAACLNLLGVKGS 484

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NA+RLA I A +VL GELSLLAA  + G L+++H+   R
Sbjct: 485 NHGSPGANAKRLATIVAGSVLAGELSLLAALAS-GHLVKSHMMYNR 529


>gi|29468498|gb|AAO85554.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Nicotiana attenuata]
          Length = 604

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 191/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 253 MPIGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCK-AIYASGGANSVLLRDG 311

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  +K   +A V  Q+S+F R  ++   IAG  L++R 
Sbjct: 312 MTRAPCVRFGTAKRAAELKFFVEDPVKFETLAAVFNQSSRFARLQRIQCAIAGKNLYMRF 371

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 372 VCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 431

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 432 CEAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVFIATGQD 491

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG      
Sbjct: 492 PAQNIESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANR 551

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 552 EAPGSNARLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 594


>gi|330806143|ref|XP_003291033.1| hydroxymethylglutaryl CoA reductase [Dictyostelium purpureum]
 gi|325078830|gb|EGC32461.1| hydroxymethylglutaryl CoA reductase [Dictyostelium purpureum]
          Length = 553

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 192/343 (55%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G +    V +P+AT E  L  S  RG   ++    G R ++    M
Sbjct: 209 VPIPVGAAGPILLNGQM----VTIPMATTEGCLVASTHRGCK-AISESGGSRCSITSRGM 263

Query: 69  TRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      +   A   +  I   +    +  V + TS+F R   +   +AG  +++R +
Sbjct: 264 TRAPVVRFSDIVKAAEFVNWINSPENYGTLKEVFDSTSRFARLSNIKCTVAGRSVYIRFK 323

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV+K  +AV+D + S +  +   SVSGN+C+DKK ++IN I GRG++ V 
Sbjct: 324 CDTGDAMGMNMVSKGVEAVLDLLKSLFDDMALLSVSGNMCTDKKPSSINWIEGRGRSVVC 383

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + QK L+TS + ++ LN  KNL+G+ +AG I   NAH +N++ A +LATGQD 
Sbjct: 384 EALITGDVVQKVLKTSVQALVDLNIAKNLVGSAMAGSIGGFNAHASNIVTAVFLATGQDC 443

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE--R 302
           A  VE S  +T  +  +D   LY + T+P++ +G VG G ++PA  + L  +G       
Sbjct: 444 AQNVESSNCITQMEACNDGQDLYMTVTMPSIEVGTVGGGTSLPAQASCLDIIGVRGSIAG 503

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           K G NA +LA    A V+ GELSL+AA  + G LM++HL+L R
Sbjct: 504 KPGANADQLAKTICAAVMAGELSLMAA-LSAGHLMKSHLQLNR 545


>gi|1346298|sp|P48022|HMDH2_SOLLC RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 2;
           Short=HMG-CoA reductase 2
 gi|170452|gb|AAA34169.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum
           lycopersicum]
          Length = 602

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 188/343 (54%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    L+ + M
Sbjct: 256 VQIPVGIAGPLLLNGK----EFSVPMATTEGCLVASTNRGCK-AIYASGGATCILLRDGM 310

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F T      L    E  +K   +A V  Q+S+F R  ++   IAG  L++RL 
Sbjct: 311 TRAPCVRFGTAKRAAELKFFVEDPIKFESLANVFNQSSRFARLQRIQCAIAGKNLYMRLC 370

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK  A+N I GRGK+ V 
Sbjct: 371 CSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVC 430

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD 
Sbjct: 431 EAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVFIATGQDP 490

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG       
Sbjct: 491 AQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANRE 550

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NAR LA + A +VL GELSL++A ++ G+L+ +H++  R
Sbjct: 551 APGSNARLLATVVAGSVLAGELSLMSAISS-GQLVNSHMKYNR 592


>gi|162945928|gb|ABY20973.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Medicago
           truncatula]
          Length = 542

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 189/343 (55%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + GN    +  VP+AT E  L  S  RG   ++    G  A ++ + M
Sbjct: 196 VQIPVGVAGPLLLDGN----EYTVPMATTEGCLVASTNRGCK-AIYVSGGASAVVLRDGM 250

Query: 69  TRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      +A+ A  L    E       ++    ++S+F R   + + +AG  L+ R  
Sbjct: 251 TRAPVVRFNSAKRASQLKFFLEDPQNFDSLSHTFNKSSRFARLQSIKATMAGKNLYTRFT 310

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKKA A+N I GRGK+ V 
Sbjct: 311 CSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKAAAVNWIEGRGKSVVC 370

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+TS E ++ LN  KNL G+ +AG +   NAH +N++ A YLATGQD 
Sbjct: 371 EAVIKEDVVKKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVSAIYLATGQDP 430

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     + 
Sbjct: 431 AQNVESSHCMTMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKE 490

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G N+R+LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 491 TPGANSRQLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 532


>gi|196001137|ref|XP_002110436.1| hypothetical protein TRIADDRAFT_37359 [Trichoplax adhaerens]
 gi|190586387|gb|EDV26440.1| hypothetical protein TRIADDRAFT_37359 [Trichoplax adhaerens]
          Length = 867

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 125/341 (36%), Positives = 187/341 (54%), Gaps = 12/341 (3%)

Query: 10  SMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMT 69
           ++P+   GP+ + G        VP+AT E  L  S  RG      C +G+R+ + ++ MT
Sbjct: 534 AVPVGVAGPLFLDGKPYH----VPMATTEGCLVASTNRGCRALTQC-NGVRSAIYNDGMT 588

Query: 70  RSIFFETENAEMALTA---LQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           R+   +  +   A  A   L E    +A I +    TS+F + + +H  + G LLF+R +
Sbjct: 589 RAPVVKFPSVGKACEAKLWLDEPDNFEA-IRKAFNATSRFAQLVGIHCGLEGPLLFIRFK 647

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NM++K  DA +  +   +  +   S+SGN C+DKK  AIN I GRGK+ V 
Sbjct: 648 SRTGDAMGMNMISKGTDAALRCLEDAFPEMDIISLSGNYCTDKKPAAINWIEGRGKSVVC 707

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + ++ L+T+PE +I +N  KNLIG+ +A  I   NAH AN++ A Y+ATGQD 
Sbjct: 708 EAEITARVIKEVLKTTPEDLIEVNYDKNLIGSAMAASIGGFNAHAANIVTAIYIATGQDP 767

Query: 247 ANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKT 304
           A  VE S  +T  + H +++   CT+P + +G VG G  +      L  LG         
Sbjct: 768 AQNVESSNCITTMEKHGENVRMYCTMPCIEVGTVGGGTILGPQSACLEMLGIRGANVSSP 827

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G+NAR+LA I  ATV+ GELSLL+A    G L+ +H++  R
Sbjct: 828 GENARQLARIVCATVMAGELSLLSALA-AGHLVRSHMKYNR 867


>gi|162945930|gb|ABY20974.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 3 [Medicago
           truncatula]
          Length = 567

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 192/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ + G ++ D  +  VP+AT E  L  S  RG   ++    G  A ++ + 
Sbjct: 216 MPIGFVQIPVGVAGPLLLDGKEYTVPMATTEGCLVASTNRGCK-AIYVSGGASAVVLRDG 274

Query: 68  MTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+      +A+ A  L    E       ++    ++S+F R   + + +AG  L++R 
Sbjct: 275 MTRAPVVRFNSAKRASQLKFFLEDPQNFDSLSHTFNKSSRFARLQNIKATMAGKNLYIRF 334

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ S +  +    +SGN CSDKKA A+N I GRGK+ V
Sbjct: 335 TCSTGDAMGMNMVSKGVQNVLDFLQSDFPDMDVIGISGNFCSDKKAAAVNWIEGRGKSVV 394

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+ S E ++ LN  KNL G+ +AG +   NAH +N++ A YLATGQD
Sbjct: 395 CEAVIKEEVVKKVLKISVESLVELNMLKNLTGSAMAGALGGFNAHASNIVSAIYLATGQD 454

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 455 PAQNVESSQCMTMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 514

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R+LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 515 ETPGANSRQLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 557


>gi|91086027|ref|XP_973160.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl coenzyme A
           reductase [Tribolium castaneum]
 gi|270010188|gb|EFA06636.1| hypothetical protein TcasGA2_TC009557 [Tribolium castaneum]
          Length = 812

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 194/350 (55%), Gaps = 22/350 (6%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           I +P+   GP+ + G     +  +P++T E  L  S  RG      C  GI++ ++ + M
Sbjct: 463 IPVPLGVAGPLVLDGK----QYYIPMSTTEGCLIASANRGCRAVEHC--GIKSRIVSDGM 516

Query: 69  TRSIFFETENAEMALTALQEITL--KKAE----IARVIEQTSQFTRFLQLHSQIAGNLLF 122
           TR           ++T   E+TL  +K E    +    + TS+F R  ++ S++AG  LF
Sbjct: 517 TRGPVVRFN----SITKASEVTLWLEKPENFLKVKENFDSTSRFARLSRITSRVAGRYLF 572

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           LR    TGDA G NM++K  +  + ++   +  +   S+SGN C+DKK  A+N + GRGK
Sbjct: 573 LRFVAETGDAMGMNMLSKGTEKALFFVQRFFPEMEILSLSGNYCADKKPAAVNWVEGRGK 632

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + V E  ++  +    L++S + ++ LNT KN+IG+ +AG I   NAH AN++ A ++AT
Sbjct: 633 SVVCEAIVSGDVVSSVLKSSTQVLVDLNTSKNMIGSAMAGSIGGFNAHAANIVTAIFIAT 692

Query: 243 GQDAANIVEGSQGLTYAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC- 298
           GQD A  +  S  +T  +   D+   LY SCT+P++ +G +G G  +PA    L  LG  
Sbjct: 693 GQDPAQNIASSNCITIMEPWGDNGQDLYVSCTMPSIEIGTIGGGTILPAQSACLDMLGVR 752

Query: 299 -IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMH 347
              E   G N+++LA I  ATVL GELSL+AA    G+L+++HL+  R +
Sbjct: 753 GPNEESPGANSKQLARIVCATVLAGELSLMAALAT-GQLVKSHLKYNRSY 801


>gi|187608454|ref|NP_001119931.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Danio rerio]
 gi|122891025|emb|CAM13174.1| novel protein similar to vertebrate
           3-hydroxy-3-methylglutaryl-Coenzyme A reductase (HMGCR)
           [Danio rerio]
          Length = 893

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 189/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 536 IGYMPVPVGVAGPLLLDGKQFQ----VPMATTEGCLVASTNRGCRAIALA-GGASSRVLA 590

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR   + F +      + A  E       I    +QTS+F R  +L   +A   L++
Sbjct: 591 DGMTRGPVVRFPSACQAAEVKAWLESPEGFKTIKEAFDQTSRFARLEKLLIGLASRNLYI 650

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +  ++  L   +VSGN C+DKK  AIN I GRGK+
Sbjct: 651 RFQSRTGDAMGMNMISKGTEQALARLKEEFPELQVLAVSGNYCTDKKPAAINWIEGRGKS 710

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI   + ++ L+TS E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 711 VVCETTIPAKVVKEILKTSTEALVDVNISKNLVGSAMAGSIGGYNAHAANIVAAIYIACG 770

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
           QD A  V  S  +T  +      + LY SCT+P++ LG VG G N+P  +  L  LG + 
Sbjct: 771 QDPAQTVGSSNCITLMEASGATGEDLYISCTMPSIELGTVGGGTNLPPQQACLKMLGVLG 830

Query: 300 -EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             +   G+NAR+LA +  ATVL GELSL++A    G L+++H+   R  +N
Sbjct: 831 ASQECPGENARQLAKVVCATVLAGELSLMSALAA-GHLVKSHMTHNRSKVN 880


>gi|160773189|gb|AAI55136.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase a [Danio rerio]
          Length = 884

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 189/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 527 IGYMPVPVGVAGPLLLDGKQFQ----VPMATTEGCLVASTNRGCRAIALA-GGASSRVLA 581

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR   + F +      + A  E       I    +QTS+F R  +L   +A   L++
Sbjct: 582 DGMTRGPVVRFPSACQAAEVKAWLESPEGFKTIKEAFDQTSRFARLEKLLIGLASRNLYI 641

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +  ++  L   +VSGN C+DKK  AIN I GRGK+
Sbjct: 642 RFQSRTGDAMGMNMISKGTEQALARLKEEFPELQVLAVSGNYCTDKKPAAINWIEGRGKS 701

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI   + ++ L+TS E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 702 VVCETTIPAKVVKEILKTSTEALVDVNISKNLVGSAMAGSIGGYNAHAANIVAAIYIACG 761

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
           QD A  V  S  +T  +      + LY SCT+P++ LG VG G N+P  +  L  LG + 
Sbjct: 762 QDPAQTVGSSNCITLMEASGATGEDLYISCTMPSIELGTVGGGTNLPPQQACLKMLGVLG 821

Query: 300 -EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             +   G+NAR+LA +  ATVL GELSL++A    G L+++H+   R  +N
Sbjct: 822 ASQECPGENARQLAKVVCATVLAGELSLMSALAA-GHLVKSHMTHNRSKVN 871


>gi|121583750|ref|NP_001073446.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase a [Danio rerio]
 gi|108742092|gb|AAI17623.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase a [Danio rerio]
          Length = 884

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 189/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 527 IGYMPVPVGVAGPLLLDGKQFQ----VPMATTEGCLVASTNRGCRAIALA-GGASSRVLA 581

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR   + F +      + A  E       I    +QTS+F R  +L   +A   L++
Sbjct: 582 DGMTRGPVVRFPSACQAAEVKAWLESPEGFKTIKEAFDQTSRFARLEKLLIGLASRNLYI 641

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +  ++  L   +VSGN C+DKK  AIN I GRGK+
Sbjct: 642 RFQSRTGDAMGMNMISKGTEQALARLKEEFPELQVLAVSGNYCTDKKPAAINWIEGRGKS 701

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI   + ++ L+TS E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 702 VVCETTIPAKVVKEILKTSTEALVDVNISKNLVGSAMAGSIGGYNAHAANIVAAIYIACG 761

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
           QD A  V  S  +T  +      + LY SCT+P++ LG VG G N+P  +  L  LG + 
Sbjct: 762 QDPAQTVGSSNCITLMEASGATGEDLYISCTMPSIELGTVGGGTNLPPQQACLKMLGVLG 821

Query: 300 -EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             +   G+NAR+LA +  ATVL GELSL++A    G L+++H+   R  +N
Sbjct: 822 ASQECPGENARQLAKVVCATVLAGELSLMSALAA-GHLVKSHMTHNRSKVN 871


>gi|125583444|gb|EAZ24375.1| hypothetical protein OsJ_08129 [Oryza sativa Japonica Group]
          Length = 427

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 128/346 (36%), Positives = 194/346 (56%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  SV RG   ++    G  + L+ 
Sbjct: 78  VGYVQLPVGVAGPLLLDGR----EYHVPMATTEGCLVASVNRGCR-AISASGGAFSVLLR 132

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + M+R+   +  +A  A  L A  E       +A V  ++S+F R   +   +AG  L++
Sbjct: 133 DAMSRAPAVKLPSAMRAAELKAFAEAPANFELLAAVFNRSSRFGRLQDIRCALAGRNLYM 192

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K  + V+ ++ + +  +   SVSGN CSDKK TA+N I GRGK+
Sbjct: 193 RFSCITGDAMGMNMVSKGVENVLGYLQNVFPDMDVISVSGNYCSDKKPTAVNWIEGRGKS 252

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+ EK++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 253 VVCEAIIKGDVVQKVLKTTVEKLVELNIIKNLAGSAVAGALGGFNAHASNIVTALFIATG 312

Query: 244 QDAANIVEGSQGLT-YAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T   +++D D L+ S T+P++ +G +G G  + +    L  LG    
Sbjct: 313 QDPAQNVESSQCITMLEEVNDGDDLHISVTMPSIEVGTIGGGTCLASQAACLNLLGVKGS 372

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NA+RLA I A +VL GELSLLAA  + G L+++H+   R
Sbjct: 373 NHGSPGANAKRLATIVAGSVLAGELSLLAALAS-GHLVKSHMMYNR 417


>gi|119872326|ref|YP_930333.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Pyrobaculum
           islandicum DSM 4184]
 gi|119673734|gb|ABL87990.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pyrobaculum
           islandicum DSM 4184]
          Length = 399

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 195/341 (57%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ I G+       +PLAT E  L  SV RGA I +    G R  ++ 
Sbjct: 59  IGAVQIPVGVAGPLLIKGDYANGYFYIPLATTEGALVASVNRGAKI-ITESGGTRVKVLK 117

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F+ ++   A+  ++ +     E+ +V E T++  +  ++   I GN ++LR 
Sbjct: 118 DGMTRAPLFKLQSVIEAIKFVEWVYQHFDELKKVAESTTKHGKLKEVQPFIVGNYVWLRF 177

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F+TGDA G NMVT A DA+  +I  ++      ++SGN+C DKKA A+N I+GRGK  +
Sbjct: 178 VFSTGDAMGMNMVTIATDAIAKYISEKFPEAKLVALSGNMCVDKKANAVNFILGRGKTVI 237

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I R + +K+   SPE +  +N +KNLIG+ LA      NAHFAN++ A ++ATGQD
Sbjct: 238 AEALIKRDVLEKF-GVSPEDVHNVNVEKNLIGSALAHSY-GFNAHFANIIAAIFIATGQD 295

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G+T  +  ++ LY S  +P+L +G VG G  +P  +  L  LG        
Sbjct: 296 VAQVVESSMGITTTEPREEGLYISVFLPSLEVGTVGGGTGLPTQREALELLGVAGPGNPP 355

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA + A I A+ VL GEL+LL A T   EL  AH RL R
Sbjct: 356 GTNALKFAEIVASAVLAGELNLLLALTR-NELASAHQRLGR 395


>gi|1708251|sp|P54960|HMDH_BLAGE RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|1655537|emb|CAA49628.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Blattella germanica]
          Length = 856

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 121/347 (34%), Positives = 188/347 (54%), Gaps = 14/347 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G ++     VPLAT E  L  S  RG    M C  G+ + ++ 
Sbjct: 500 IGYMPVPVGVAGPLNLDGRLVH----VPLATTEGCLVASTNRGMRALMRC--GVTSRIVA 553

Query: 66  ERMTRSIFFETENAEMALTAL--QEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR       N + A  A+   ++     +I +  + TS+F R  ++H ++AG  LF+
Sbjct: 554 DGMTRGPVVRFPNIDRASEAMLWMQVPYNFEQIKKNFDSTSRFARLSKIHIRVAGRHLFI 613

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NM++K  +  + ++   +  +   S+SGN C+DKK  A+N I GRGK+
Sbjct: 614 RFIATTGDAMGMNMLSKGTEVALAYVQQVYPDMEILSLSGNFCTDKKPAAVNWIEGRGKS 673

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  +   I +  L+TS + ++ +N  KNLIG+ +AG I   NAH AN++ A ++ATG
Sbjct: 674 VVCEAIVPADIIKSVLKTSVQALMDVNITKNLIGSAVAGSIGGFNAHAANIVTAIFIATG 733

Query: 244 QDAANIVEGSQGLTYAKLHDD---SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           QD A  V  S  +T  +   +    LY SCT+P++ +G +G G  +P     L  LG   
Sbjct: 734 QDPAQNVGSSNCMTLMEPWGEDGKDLYVSCTMPSIEIGTIGGGTVLPPQAACLDMLGVRG 793

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             E   G+NA  LA I   TVL GELSL++A    G L+++H+R  R
Sbjct: 794 ANEMCPGENANTLARIVCGTVLAGELSLMSALAA-GHLVKSHMRHNR 839


>gi|158564098|sp|Q0DY59|HMDH1_ORYSJ RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 1;
           Short=HMG-CoA reductase 1
          Length = 532

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 128/346 (36%), Positives = 194/346 (56%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  SV RG   ++    G  + L+ 
Sbjct: 183 VGYVQLPVGVAGPLLLDGR----EYHVPMATTEGCLVASVNRGCR-AISASGGAFSVLLR 237

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + M+R+   +  +A  A  L A  E       +A V  ++S+F R   +   +AG  L++
Sbjct: 238 DAMSRAPAVKLPSAMRAAELKAFAEAPANFELLAAVFNRSSRFGRLQDIRCALAGRNLYM 297

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K  + V+ ++ + +  +   SVSGN CSDKK TA+N I GRGK+
Sbjct: 298 RFSCITGDAMGMNMVSKGVENVLGYLQNVFPDMDVISVSGNYCSDKKPTAVNWIEGRGKS 357

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+ EK++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 358 VVCEAIIKGDVVQKVLKTTVEKLVELNIIKNLAGSAVAGALGGFNAHASNIVTALFIATG 417

Query: 244 QDAANIVEGSQGLT-YAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T   +++D D L+ S T+P++ +G +G G  + +    L  LG    
Sbjct: 418 QDPAQNVESSQCITMLEEVNDGDDLHISVTMPSIEVGTIGGGTCLASQAACLNLLGVKGS 477

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NA+RLA I A +VL GELSLLAA  + G L+++H+   R
Sbjct: 478 NHGSPGANAKRLATIVAGSVLAGELSLLAALAS-GHLVKSHMMYNR 522


>gi|304314711|ref|YP_003849858.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Methanothermobacter
           marburgensis str. Marburg]
 gi|302588170|gb|ADL58545.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Methanothermobacter
           marburgensis str. Marburg]
          Length = 397

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 120/341 (35%), Positives = 187/341 (54%), Gaps = 9/341 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ + G     +  VPLAT E  L  SV RG  +   C  G    +  
Sbjct: 64  IGAVQIPLGVAGPLLVKGEHADGEYYVPLATSEGALVASVNRGCSVITGC-GGASVRITG 122

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQI-AGNLLFLR 124
           + MTR+    T +   AL   + I      +    E T++  + +++   I AG  ++ R
Sbjct: 123 DSMTRAPVIRTGSVVEALKLREWIQENIDALREEAESTTRHGKLIKIDPIIVAGPYVYPR 182

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             + TGD+ G NMVT A +  ++ +L++ +  H  ++SGN+C+DKK  +IN + GRGK+ 
Sbjct: 183 FVYTTGDSMGMNMVTIATEKALE-LLTEETGAHVIALSGNLCTDKKPASINLVEGRGKSI 241

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+T+   + ++ L+T+PE ++ +NT KNL+G+ LAG +   NAH+AN++ A +LATGQ
Sbjct: 242 SAEVTVPGEMVERVLKTTPEAVVEVNTAKNLLGSALAGSM-GFNAHYANIIGAIFLATGQ 300

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           D A+IVEGS G+T A+  +  LYFS  +P++ L  VG G  +      L  +G    R +
Sbjct: 301 DEAHIVEGSLGVTVAEEKNGDLYFSVNLPDVPLATVGGGTGLETASECLDIMGV---RGS 357

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G      A I    VL GELSL+ A    G L  AH  L R
Sbjct: 358 G-GVHEFAEIVGGAVLAGELSLMGALA-AGHLARAHSELGR 396


>gi|290976372|ref|XP_002670914.1| 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) reductase [Naegleria
           gruberi]
 gi|284084478|gb|EFC38170.1| 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) reductase [Naegleria
           gruberi]
          Length = 547

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 125/347 (36%), Positives = 192/347 (55%), Gaps = 12/347 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAH-ISMLCPDGIRATLI 64
           V  + +P+  +GP+ I G        +P+AT E  L  S  RG   +S     G+ + ++
Sbjct: 204 VGYVPLPVGIVGPIIIDGKPYH----IPMATVEGCLVASTHRGCKALSSSFEGGVNSVIL 259

Query: 65  DERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            + MTR    +  N +      Q I   +   E+ RV    S+F R L++   IAG   F
Sbjct: 260 SDGMTRGPVVQFANTKRCNELKQFIDNPENFKELCRVFNSDSRFARLLEVKVGIAGRKAF 319

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRG 181
           LR +  TGDA G NM++KA    + ++ ++ +  +   S+SGN C+DKK +A+N I GRG
Sbjct: 320 LRFKCRTGDAMGMNMISKATQKALKFLKNEHFQDMDILSLSGNYCTDKKPSAMNWIEGRG 379

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V + TI + + +  L+T+ ++I+ LN  KNLIG+ +AG +   NAH AN++ A +LA
Sbjct: 380 KSVVVDATIPKDVVKNVLKTTVDEIVSLNISKNLIGSAMAGSVGGFNAHAANIVTAIFLA 439

Query: 242 TGQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           TGQDAA  VE S  +T  +  D+  LY S T+P++ +G VG G ++ A K  L  +G   
Sbjct: 440 TGQDAAQNVESSNCMTIMEKTDNGDLYVSVTMPSIEVGTVGGGTHLDAQKTCLKIIGVAG 499

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +   G NA+ LA   A+TV+ GELSL+AA      L+ AH+   R
Sbjct: 500 ANQENPGQNAQTLAKCVASTVMAGELSLMAALA-ADHLVSAHIAHNR 545


>gi|156550478|ref|XP_001601404.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-CoA reductase
           [Nasonia vitripennis]
          Length = 934

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 128/338 (37%), Positives = 185/338 (54%), Gaps = 17/338 (5%)

Query: 17  GPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSI---F 73
           GP+K+ G +I     VP+AT E  L  S  RG+     C  G+ + ++ + MTR     F
Sbjct: 560 GPLKVDGELIH----VPMATTEGCLVASTNRGSRALTGC-GGVTSRVVADGMTRGPVVRF 614

Query: 74  FETENAEMALTALQEITLKKAE-IARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDA 132
                A  A+T +Q  T +  E +    ++TS+F R  ++   IAG  LF+R    TGDA
Sbjct: 615 PSITRASEAMTWMQ--TPENFEKMKSSFDETSRFARLTRIQVHIAGRHLFIRFVAKTGDA 672

Query: 133 SGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINR 192
            G NM++K  +  +  +   ++ +   S+SGN+C+DKK  A+N I GRGK+ V E  I  
Sbjct: 673 MGMNMLSKGTEKSLHTVQETFTDMEILSLSGNVCTDKKPAAVNWIEGRGKSVVCEAIIPA 732

Query: 193 AICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEG 252
            I    L+T+   ++ +N  KN+IG+ +AG I   NAH AN++ A Y+ATGQD A  V  
Sbjct: 733 EIVSSILKTTTHALVDVNICKNMIGSAVAGSIGGFNAHAANIVTAIYIATGQDPAQNVGS 792

Query: 253 SQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGDN 307
           S  +T  +      + LY SCT+P++ +G VG G  +PA    L  LG         G N
Sbjct: 793 SNCMTLMEPWGPDGNDLYVSCTMPSIEIGTVGGGTGLPAQGACLAMLGVRGANAEDPGRN 852

Query: 308 ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           A +LA I  ATVL GELSL+AA T  G L+++HLR  R
Sbjct: 853 ANKLARIVCATVLAGELSLMAALT-AGHLVKSHLRHNR 889


>gi|313125770|ref|YP_004036040.1| 3-hydroxy-3-methylglutaryl-coenzyme a reductase [Halogeometricum
           borinquense DSM 11551]
 gi|312292135|gb|ADQ66595.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Halogeometricum
           borinquense DSM 11551]
          Length = 408

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 121/344 (35%), Positives = 180/344 (52%), Gaps = 11/344 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V ++ +PM   GP++I G  +  +  +PLAT E  L  SV RG  + +    G    ++ 
Sbjct: 72  VGAVQVPMGVAGPVRIRGGRLDGERYLPLATTEGALLASVNRGCSV-LNDAGGANVRILK 130

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F   +   A   ++ +   +  +    E+T+     L +   + GN + LR 
Sbjct: 131 SGMTRAPVFRVADVVEAEALVEWVRDNRDALREAAEETTNHGELLDVTPYVVGNSVHLRF 190

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NMVT A  A  + +  +       ++SGN+C+DKK  AIN + GRG++  
Sbjct: 191 RYDTKDAMGMNMVTIATRAACELVEDETDA-SLVALSGNLCTDKKPAAINAVEGRGRSVT 249

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            ++TI R + +  L T+PE +  LNT+KNL+G+  A  +   NAH AN++ A +LATGQD
Sbjct: 250 TDVTIPREVVEDRLHTTPEAVAELNTRKNLVGSAKAASL-GFNAHVANVVAAMFLATGQD 308

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
            A +VEG+  +T A++ D  LY S +I +L +G VG G  +P     L  LG    R  G
Sbjct: 309 EAQVVEGANAITTAEVQDGDLYVSISIASLEVGTVGGGTKLPTQAEGLDVLGV---RGGG 365

Query: 306 D----NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           D    NA  LA   A   L GELSLL+A  +   L  AH  L R
Sbjct: 366 DPAGSNADALAEAIAVGSLAGELSLLSALASR-HLSSAHAELGR 408


>gi|327311070|ref|YP_004337967.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Thermoproteus
           uzoniensis 768-20]
 gi|326947549|gb|AEA12655.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Thermoproteus
           uzoniensis 768-20]
          Length = 405

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 125/341 (36%), Positives = 188/341 (55%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +  +P+   GP+ + G   +    +PLAT E  L  SV RGA I +    G RA ++ 
Sbjct: 66  IGAAQIPIGVAGPLLVEGEYARGMFYIPLATTEGALVASVNRGAKI-VTESGGARARVVR 124

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + M R+  F+  +   AL  ++ +   + EI R  E T++  +  ++   + GN ++LR 
Sbjct: 125 DGMARAPLFKLPSLIDALDFVKWVEAHREEIKRAAESTTRHGKLKEIQPFVVGNNVWLRF 184

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NM T A++A   +I   +      ++SGN+C DKK  A+N +MGRGK  V
Sbjct: 185 VFETGDAMGMNMATIASEAAAKYIERGYPKAELVALSGNMCVDKKPNAVNFLMGRGKTVV 244

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I R    + L  +PE +  +N +KNL+G+ LA      NAHFAN++ A ++ATGQD
Sbjct: 245 AEALIRREALSR-LGVTPEAVHEVNVRKNLLGSALAHSY-GFNAHFANIITAIFIATGQD 302

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G+T+ +  ++ LY S T+P+L +G VG G  +P  +  L+ LG        
Sbjct: 303 VAQVVESSMGITWTEPREEGLYISVTLPSLEVGTVGGGTGLPTQREALSMLGVAGSGDPP 362

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA + A I A+ VL GEL+L+ A     EL  AH  L R
Sbjct: 363 GVNALKFAEIVASAVLAGELNLILALAR-NELARAHQALGR 402


>gi|2246450|gb|AAB62581.1| 3-hydroxy-3-methylglutaryl CoA reductase 2 [Solanum lycopersicum]
          Length = 601

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 187/343 (54%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    L+ + M
Sbjct: 255 VQIPVGIAGPLLLNGK----EFSVPMATTEGCLVASTNRGCK-AIYASGGATCILLRDGM 309

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F T      L    E  +K   +A V  Q+S+F R  ++   IAG  L++R  
Sbjct: 310 TRAPCVRFGTAKRAAELKFFVEDPIKFETLANVFNQSSRFARLQRIQCAIAGKNLYMRFV 369

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK  A+N I GRGK+ V 
Sbjct: 370 CSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVC 429

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD 
Sbjct: 430 EAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVFIATGQDP 489

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG       
Sbjct: 490 AQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANRE 549

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NAR LA + A +VL GELSL++A ++ G+L+ +H++  R
Sbjct: 550 APGSNARLLATVVAGSVLAGELSLMSAISS-GQLVNSHMKYNR 591


>gi|242045176|ref|XP_002460459.1| hypothetical protein SORBIDRAFT_02g028630 [Sorghum bicolor]
 gi|241923836|gb|EER96980.1| hypothetical protein SORBIDRAFT_02g028630 [Sorghum bicolor]
          Length = 583

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 189/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     ++ VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 224 VGYVQLPVGVAGPLLLDGR----RLYVPMATTEGCLVASTNRGCK-AIAESGGASSVVLK 278

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L A  E       +A V  ++S+F R   +   IAG  L++
Sbjct: 279 DGMTRAPAVRFPSARRAAELKAFLEDPANFDTLAVVFNRSSRFGRLQGVKCAIAGRNLYM 338

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++ + +  +   S+SGN CSDKK+ A+N I GRGK+
Sbjct: 339 RFSCSTGDAMGMNMVSKGVQNVLDYLQADFPDMDVISISGNFCSDKKSAAVNWIDGRGKS 398

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 399 VVCEAVIKEEVVKKVLKTNVQALVELNVIKNLAGSAVAGALGGFNAHASNIVAAIFIATG 458

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 459 QDPAQNVESSQCITMLEAINDGKDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGA 518

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A  VL GELSL++AQ   G L+ +H++  R
Sbjct: 519 NRESPGSNARLLATVVAGAVLAGELSLISAQAA-GHLVRSHMKYNR 563


>gi|312069146|ref|XP_003137546.1| hypothetical protein LOAG_01960 [Loa loa]
 gi|307767293|gb|EFO26527.1| hypothetical protein LOAG_01960 [Loa loa]
          Length = 582

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 135/342 (39%), Positives = 190/342 (55%), Gaps = 12/342 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P   +GP+ + G     K  VP++T E  L  S  RG   ++    GI   +  + M
Sbjct: 190 VPVPTGIVGPLLMNGR----KYFVPMSTTEGALIASTNRGCR-AVFESGGITVRIYRDGM 244

Query: 69  TRSIFFETENAEMALTALQEITLKKA---EIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           TR+   +  N    L  +++     A   EI  V + TS F R  ++   I G LLF+R 
Sbjct: 245 TRAPVVQFANVARTL-EMKDFLDSPAGFEEIKTVFDSTSSFARLRRVEVDITGRLLFIRF 303

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           E  TGDA G NMV+K A+ V+ ++  ++  +   S+SGN C DKKA+AIN I GRGK+ V
Sbjct: 304 EAETGDAMGMNMVSKGANVVLSYLKEKYPEMEVLSLSGNYCVDKKASAINWIKGRGKSMV 363

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE TI  A+ Q  L+T+ + ++ L   K LIG+ LAG I   NAH AN++ A ++ATGQD
Sbjct: 364 AEATIPAAVVQTVLKTTVDALVRLGQAKLLIGSSLAGTIGGWNAHAANVVAAIFIATGQD 423

Query: 246 AANIVEGSQGL-TYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-IEERK 303
            A +V  S  L T  K     LY SC +  L +G VG G  +PA    L  +GC      
Sbjct: 424 VAQVVSSSMCLTTMEKTELGDLYISCNMRCLEVGTVGGGTILPAQNACLQIMGCGTPTSV 483

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G+ A RLA I  +TVL GELSLLAAQ +  +L+++H+RL R
Sbjct: 484 PGECATRLAEIICSTVLAGELSLLAAQCS-NDLVKSHIRLNR 524


>gi|12082120|dbj|BAB20771.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum tuberosum]
          Length = 595

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 186/343 (54%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    L+ + M
Sbjct: 253 VQIPVGIAGPLLLNGK----EFSVPMATTEGCLVASTNRGCK-AIYASGGATCILLRDGM 307

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F T      L    E  +K   +A V  Q+S+F R  ++   IAG  L++R  
Sbjct: 308 TRAPCVRFGTAKRAAELKFFVEDPIKFETLANVFNQSSRFARLQRIQCAIAGKNLYMRFV 367

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK  A+N I GRGK+ V 
Sbjct: 368 CSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVC 427

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD 
Sbjct: 428 EAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVFIATGQDP 487

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG       
Sbjct: 488 AQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANRE 547

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NAR LA + A +VL GELSL++A  + G+L+ +H++  R
Sbjct: 548 APGSNARLLATVVAGSVLAGELSLMSA-ISAGQLVNSHMKYNR 589


>gi|90959866|dbj|BAE92730.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Gentiana lutea]
          Length = 586

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 191/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG    + C  G  + L+ + 
Sbjct: 233 MPVGYVQLPVGIAGPLLLDGREYMVPMATTEGCLVASTNRGCKAMVAC-GGATSVLLKDG 291

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  L    I+ +  ++S+F +  ++   IAG  L++R 
Sbjct: 292 MTRAPVVRFGTAKRAAELKFFVEDPLNFDTISVIFNKSSRFAKLQRIQCAIAGKNLYMRF 351

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ S +  +    +SGN C+DKK +A+N I GRGK+ V
Sbjct: 352 TCSTGDAMGMNMVSKGVQNVLDFLQSDFPDMDVIGISGNFCADKKPSAVNWIEGRGKSVV 411

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   I +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 412 CEAIIKEEIVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAIYIATGQD 471

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 472 PAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQAACLNLLGVKGASK 531

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 532 ETAGANSRLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 574


>gi|328717956|ref|XP_001951894.2| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like
           [Acyrthosiphon pisum]
          Length = 860

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 122/332 (36%), Positives = 184/332 (55%), Gaps = 12/332 (3%)

Query: 18  PMKITGNVIQDKV--KVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ + G ++ D V  +VP+AT E  L  S  RG     +C  G+   ++D+ MTR     
Sbjct: 505 PVGVAGPLLVDDVFYQVPMATTEGCLVASTNRGCRALTIC-GGVITRVVDDGMTRGPVVR 563

Query: 76  TENAEMALTALQEITLKKAEIARVI----EQTSQFTRFLQLHSQIAGNLLFLRLEFATGD 131
             +   A  A  ++ +   E  ++I    + TS+F R  +L  +IAG  LF+R   +TGD
Sbjct: 564 FSSVTTASEA--KMWMDNPEKFKIIKSAFDSTSRFARLTKLLVRIAGRHLFIRFTASTGD 621

Query: 132 ASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITIN 191
           A G NM++K  +  +  I   +  +   S+SGN CSDKK  A+N I GRGK  V+E  + 
Sbjct: 622 AMGMNMLSKGTEKSLKVIGEYFPDMEVLSLSGNFCSDKKPAAVNWIEGRGKYVVSEAIVP 681

Query: 192 RAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVE 251
             I  + L+T+   ++ +N  KNL+G+ +AG I   NAH AN++ A Y+ATGQD A  V 
Sbjct: 682 SKIVTEVLKTTVAALVDVNISKNLMGSAIAGSIGGNNAHAANVVTAVYIATGQDPAQNVA 741

Query: 252 GSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGDNAR 309
            S  +T  +   + LY SCT+P++ +G VG G ++P     L  LG      +  G NA+
Sbjct: 742 SSNCMTLMEAFGEDLYVSCTMPSVEIGTVGGGTSLPGQSACLEMLGVRGANSQTPGANAK 801

Query: 310 RLAAICAATVLCGELSLLAAQTNPGELMEAHL 341
            LA I  ATVL GELSL++A T  G L+++H+
Sbjct: 802 LLARILCATVLAGELSLMSALT-AGHLVKSHM 832


>gi|18000042|gb|AAL54878.1|AF004232_1 hydroxy-methyl-glutaryl-coenzyme A reductase [Nicotiana tabacum]
          Length = 604

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 121/344 (35%), Positives = 190/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 253 MPIGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCK-AIYASGGATSVLLRDG 311

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  +K   +A V  Q+S+F R  ++   IAG  L++R 
Sbjct: 312 MTRAPCVRFGTAKRAAELKFFVEDPVKFETLAAVFNQSSRFARLQRIQCAIAGKNLYMRF 371

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 372 VCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 431

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T    ++  N  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 432 CEAIITEEVVKKVLKTEVAALVEPNMLKNLTGSAMAGALGGFNAHASNIVSAVFIATGQD 491

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG      
Sbjct: 492 PAQNIESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANR 551

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 552 EAPGSNARLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 594


>gi|66501005|ref|XP_623118.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Apis
           mellifera]
          Length = 908

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 188/345 (54%), Gaps = 16/345 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G +      VP+AT E  L  S  RG+   + C  G+ + ++ + M
Sbjct: 532 VPVPLGIAGPLLLDGELYY----VPMATTEGCLVASTNRGSRALLKC--GVTSRVVADGM 585

Query: 69  TRSIFFETEN---AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           TR       N   A  A+  +Q+    K E+      TS+F R  +++ +IAG  LF+R 
Sbjct: 586 TRGPVVRFPNIVRASEAMAWMQDPDNFK-EMKNSFNLTSRFARLTKINIRIAGRHLFIRF 644

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NM++K  +  ++ +   +  +   S+SGN C+DKK  A+N + GRGK+ V
Sbjct: 645 VATTGDAMGMNMLSKGTEKSLNTVKEHFPDMEILSLSGNFCTDKKPAAVNWVCGRGKSVV 704

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  +   I    L+TS   ++ +N  KN+IG+ +AG I   NAH AN++ A ++ATGQD
Sbjct: 705 CEAVVPADIVTNVLKTSVHALVDVNISKNMIGSAIAGSIGGFNAHAANIVTAIFIATGQD 764

Query: 246 AANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IE 300
            A  V  S  +T  +        LY SCT+P++ +G VG G  +PA    L+ LG     
Sbjct: 765 PAQNVGSSNCMTLMEPWGTDGSDLYVSCTMPSIEIGTVGGGTILPAQGACLSILGVKGAH 824

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             + G+NA RLA I  ATVL GELSL+AA T  G L+++HLR  R
Sbjct: 825 SDEPGENASRLARIVCATVLAGELSLMAALT-AGHLVKSHLRHNR 868


>gi|311358828|gb|ADP94147.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Withania
           somnifera]
          Length = 575

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 191/345 (55%), Gaps = 16/345 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++  P G  + L  + M
Sbjct: 229 VQIPVGIAGPLLLNGC----EYSVPMATTEGCLVASTNRGCK-AIYAPGGATSILFRDGM 283

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F T +    L    E       +A V  ++S+F R  ++   +AG  L+LR  
Sbjct: 284 TRAPVVKFPTASRASELLFFLENPANFDTLAVVFNKSSRFARLQKIQCSLAGRNLYLRFS 343

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV+K    V++++  ++  +  G +SGN CSDKK  A+N + GRGK+ V 
Sbjct: 344 CGTGDAMGMNMVSKGVQNVLEFLQDEFPDMEIGGISGNFCSDKKPAAVNWVQGRGKSVVC 403

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I+  + +K L+TS   ++ LNT KNL G+ +AG +   NAH AN++ A ++ATGQD 
Sbjct: 404 EAMISGDVVEKVLKTSVSALVELNTIKNLTGSAIAGALGGFNAHAANIVSAIFIATGQDP 463

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG----CIE 300
           A  +E S  +T  +   D  +L+ S T+P + +G +G G  + +    L  LG    C E
Sbjct: 464 AQNIESSHCITMMEAISDGKALHISVTMPCIEVGTIGGGTQLASQSACLNLLGVKGACRE 523

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +  N+R LAAI A +VL GELSL++A  + G+L+++H++  R
Sbjct: 524 SPAS--NSRLLAAIVAGSVLAGELSLMSAIAS-GQLVKSHMKYNR 565


>gi|257051364|ref|YP_003129197.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Halorhabdus
           utahensis DSM 12940]
 gi|256690127|gb|ACV10464.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Halorhabdus
           utahensis DSM 12940]
          Length = 403

 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 121/341 (35%), Positives = 178/341 (52%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +PM   GP+ + G     +  VPLAT E  L  SV RG   ++    G  A ++ 
Sbjct: 67  IGTVQIPMGVTGPLPVDGEAADGEYTVPLATTEGALVASVNRGV-TAIRDAGGSTARIMK 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             +TR+  F   +   A    + +   +AE+A V E T     F  +   + G+ +FLR 
Sbjct: 126 SGITRAPVFSVADVGEAKAVAEWVRENEAELAAVAEDTDPHIAFEDVTPYVVGDSVFLRF 185

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + TGDA G NMVT A+ A  + + ++ +     ++SGN+CSDKK  AIN + GRG    
Sbjct: 186 RYDTGDAMGMNMVTIASRAASELVEAE-TPAELVALSGNLCSDKKPAAINSVEGRGYTVA 244

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++ +   + +     + E I  +NT+KNL+G+  AG +   NAH AN++ A +LA GQD
Sbjct: 245 ADVFLPDDLVEDTFHATSEAIATVNTRKNLVGSAKAGSL-GFNAHVANIVGAAFLALGQD 303

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VEGS  +T  +  +D LY S T+ +L +G VG G  +P     L+ LG        
Sbjct: 304 EAQVVEGSNAITSLEAREDGLYASVTLASLEVGTVGGGTALPTQSEALSVLGLAGGGDPV 363

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA  LA I A T L GELSLL A  +   L  AH  L R
Sbjct: 364 GSNAEALAEIIATTALAGELSLLGALASR-HLSSAHEELGR 403


>gi|330795675|ref|XP_003285897.1| hydroxymethylglutaryl CoA reductase [Dictyostelium purpureum]
 gi|325084136|gb|EGC37571.1| hydroxymethylglutaryl CoA reductase [Dictyostelium purpureum]
          Length = 517

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 126/336 (37%), Positives = 191/336 (56%), Gaps = 14/336 (4%)

Query: 17  GPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFET 76
           GP+ + G +    V +P+AT E  L  S  RGA  ++    G ++ ++   MTR+     
Sbjct: 166 GPILLDGKL----VSIPMATTEGCLVASTHRGAK-AITKSGGAKSVVLQNGMTRAPVCRL 220

Query: 77  ENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASG 134
            +A  A    Q I  ++   ++A     TS+F R   +   IAG L++LR + +TGDA G
Sbjct: 221 PSAVKAAELKQWIENQENFYQVASAFNSTSRFARLKNIKVVIAGRLVYLRFKSSTGDAMG 280

Query: 135 HNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAI 194
            NMV+K  +  M+ I   +  L   S+SGN+C+DKK +AIN + GRGK+ VAE  I+  I
Sbjct: 281 MNMVSKGVEKAMEVISEYFPELEVLSLSGNVCTDKKPSAINWLEGRGKSVVAEAVISGDI 340

Query: 195 CQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQ 254
            +  L+T+ + ++ LN  KNLIG+ +AG I   NAH +N++ A Y+ATGQD A  VE S 
Sbjct: 341 VRDVLKTTVDSLVSLNVDKNLIGSAMAGSIGGFNAHASNIVTALYIATGQDPAQNVESSN 400

Query: 255 GLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTAL---GCIEERKTGDNAR 309
            +T  +  ++   LY S T+P++ +G VG G ++PA    L  L   G   ER  G N+ 
Sbjct: 401 CITLMESINNGKDLYISVTMPSIEVGTVGGGTHLPAQAACLDLLKIRGANVER-PGANSE 459

Query: 310 RLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +L+ + AA VL GELSL++A    G L+ +HL+  R
Sbjct: 460 QLSRVVAAAVLSGELSLMSALA-AGHLVRSHLKHNR 494


>gi|45272118|gb|AAR02862.2| HMG-CoA reductase [Dicentrarchus labrax]
          Length = 887

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 126/351 (35%), Positives = 186/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 530 IGYMPVPVGVAGPLHLDGKQFQ----VPMATTEGCLVASTNRGCRAIALG-GGASSRILA 584

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR       +A  A  + A  E T     I    + TS+F R  +L   +AG  L++
Sbjct: 585 DSMTRGPVVRLPSAYQAAEVKAWLESTDGFQAIKEAFDNTSRFARLQKLLVCLAGRNLYI 644

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NM++K  +  +  +   +  L   +VSGN C+DKK  AIN I GRGK+
Sbjct: 645 RFHSKTGDAMGMNMISKGTEQALSRLQQHFPELQVVAVSGNYCTDKKPAAINWIEGRGKS 704

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI   + ++ L+T+   ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 705 AVCEATIPAKVVREVLKTTTGALVEVNISKNLVGSAMAGSIGGCNAHAANLVAAIYIACG 764

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           QD A  V  S  +T  +      + LY SCT+P++ LG VG G N+P  +  L  LG   
Sbjct: 765 QDPAQSVGSSNCITLMEASGPTGEDLYISCTMPSIELGTVGGGTNLPPQQACLQMLGVQG 824

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             +   G+NAR+LA +  ATVL GELSL+AA    G L+++H+   R  +N
Sbjct: 825 ASQECPGENARQLARVVCATVLAGELSLMAALAA-GHLVKSHMTHNRSKVN 874


>gi|304596|gb|AAA33215.1| hydroxymethylglutaryl CoA reductase [Dictyostelium discoideum]
          Length = 481

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 127/344 (36%), Positives = 193/344 (56%), Gaps = 14/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           I +P+   GP+ + G +    V +P+AT E  L  S  RGA  ++    G +  L+   M
Sbjct: 123 IPIPVGVAGPILLDGKL----VSIPMATTEGCLVASTHRGAK-AITKSGGAKTVLLQSGM 177

Query: 69  TRSIFFETENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      ++  A    Q I  ++   ++A     TS+F R   +   IAG L++LR +
Sbjct: 178 TRAPVCRLPSSIRAGELKQWIENQENFYQVASAFNSTSRFARLKSIKVVIAGRLVYLRFK 237

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K  +  ++ I   +  +   S+SGN+C+DKK ++IN + GRGK+ VA
Sbjct: 238 SSTGDAMGMNMVSKGVEKALEVITEYFPEMEVLSLSGNVCTDKKPSSINWLEGRGKSVVA 297

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I+  I +  L+T+ E ++ LN  KNLIG+ +AG I   NAH +N++ A Y+ATGQD 
Sbjct: 298 EAVISGDIVRDVLKTTVEALVSLNIDKNLIGSAMAGSIGGFNAHASNIVTALYIATGQDP 357

Query: 247 ANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTAL---GCIEE 301
           A  VE S  +T  +  +    LY S T+P++ +G VG G ++PA    L  L   G   E
Sbjct: 358 AQNVESSNCITLMESINGGKDLYISVTMPSIEVGTVGGGTHLPAQSACLDLLKIRGANLE 417

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           R  G N+ +LA + AA VL GELSL++A    G L+ +HL+  R
Sbjct: 418 RP-GANSEQLARVVAAAVLSGELSLMSALA-AGHLVRSHLKHNR 459


>gi|169867621|ref|XP_001840389.1| hydroxymethylglutaryl-CoA reductase [Coprinopsis cinerea
            okayama7#130]
 gi|116498550|gb|EAU81445.1| hydroxymethylglutaryl-CoA reductase [Coprinopsis cinerea
            okayama7#130]
          Length = 1354

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 128/350 (36%), Positives = 189/350 (54%), Gaps = 12/350 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  I +P+   GP+ + G        +P+AT E  L  S  RG   ++    G+   L+ 
Sbjct: 953  VGYIPIPLGIAGPLNVDGV----SYHIPMATAEGTLVASTSRGCK-ALNAGGGVTTVLLQ 1007

Query: 66   ERMTRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR    +     MA  A   I  ++    I    E TS+F R L L + +AG  LF+
Sbjct: 1008 DGMTRGPAIDFPTIIMAAEAKAWIASEEGYGIIKEAFESTSRFARLLSLKTNLAGRTLFV 1067

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
            R + ATGDA G NM++K  +  ++ + + +  +   ++SGN C+DKK  AIN I GRGK+
Sbjct: 1068 RFKTATGDAMGMNMISKGTEKALEVMQTFFPEMVVLALSGNYCTDKKPAAINWIDGRGKS 1127

Query: 184  FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
             VAE  I   + +  L+T+ E ++ LN +KNLIG+ +AG +   NAH AN+L A +LATG
Sbjct: 1128 VVAEAVIPGKVVKTVLKTTVEALVNLNIKKNLIGSAMAGSVGGFNAHAANILTAMFLATG 1187

Query: 244  QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            QD A  VE S  +T  +  +D   L  + T+P++ +G VG G  +   +  L  LG    
Sbjct: 1188 QDPAQNVESSNCMTLMEAINDGEDLLMTVTMPSIEVGTVGGGTVLAPQQAILEMLGIRGA 1247

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
              T  G+NA+RLA I A+ V+ GELSLL+A    G L+ AH+   R   N
Sbjct: 1248 HPTSPGENAQRLARIIASAVMAGELSLLSALAA-GHLIRAHMAHNRSTAN 1296


>gi|71159371|gb|AAK95407.2| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Malus x domestica]
          Length = 379

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 116/344 (33%), Positives = 190/344 (55%), Gaps = 10/344 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G    ++  VP+AT E  L  S  RG   ++    G  + L +
Sbjct: 28  VGYVQIPVGVAGPLLLDG----EEYMVPMATTEGCLVASTNRGFK-AIYASGGAESVLFN 82

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E  L    +A V   +S+F +  ++   IAG  L+L
Sbjct: 83  DSMTRAPIVRFHSVVRAAQLKFFVENPLNFDALAVVFNMSSRFAKLEKIRCAIAGRNLYL 142

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NM++K    V++++ +++  +    +SGN CSDKKA A+N I GRGK+
Sbjct: 143 RFSCSTGDAMGMNMISKGVQCVIEFLQNEFPDMEVVGISGNFCSDKKAAAVNWIEGRGKS 202

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
              E  I   + +K L+T  + ++ LN  KNL+G+ +AG +   NAH +N++ A ++ATG
Sbjct: 203 VTCEAVIKEELVRKVLKTDVDSLVKLNVNKNLVGSAMAGALGGFNAHASNIVSAVFIATG 262

Query: 244 QDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           QD A  +E S  +T  +   + L+ S T+P++ +G VG G  + +    L  LG     K
Sbjct: 263 QDPAQNIESSHCITLMEADGNDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGAGK 322

Query: 304 --TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R+LA I A  VL GELSL++A  + G+L+++H++  R
Sbjct: 323 DSPGLNSRQLARIVAGAVLAGELSLMSAIAS-GQLVKSHMKYNR 365


>gi|66818797|ref|XP_643058.1| hydroxymethylglutaryl CoA reductase [Dictyostelium discoideum AX4]
 gi|166203661|sp|P34136|HMDH2_DICDI RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 2;
           Short=HMG-CoA reductase 2
 gi|60471153|gb|EAL69120.1| hydroxymethylglutaryl CoA reductase [Dictyostelium discoideum AX4]
          Length = 526

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 127/344 (36%), Positives = 193/344 (56%), Gaps = 14/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           I +P+   GP+ + G +    V +P+AT E  L  S  RGA  ++    G +  L+   M
Sbjct: 168 IPIPVGVAGPILLDGKL----VSIPMATTEGCLVASTHRGAK-AITKSGGAKTVLLQSGM 222

Query: 69  TRSIFFETENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      ++  A    Q I  ++   ++A     TS+F R   +   IAG L++LR +
Sbjct: 223 TRAPVCRLPSSIRAGELKQWIENQENFYQVASAFNSTSRFARLKSIKVVIAGRLVYLRFK 282

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K  +  ++ I   +  +   S+SGN+C+DKK ++IN + GRGK+ VA
Sbjct: 283 SSTGDAMGMNMVSKGVEKALEVITEYFPEMEVLSLSGNVCTDKKPSSINWLEGRGKSVVA 342

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I+  I +  L+T+ E ++ LN  KNLIG+ +AG I   NAH +N++ A Y+ATGQD 
Sbjct: 343 EAVISGDIVRDVLKTTVEALVSLNIDKNLIGSAMAGSIGGFNAHASNIVTALYIATGQDP 402

Query: 247 ANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTAL---GCIEE 301
           A  VE S  +T  +  +    LY S T+P++ +G VG G ++PA    L  L   G   E
Sbjct: 403 AQNVESSNCITLMESINGGKDLYISVTMPSIEVGTVGGGTHLPAQSACLDLLKIRGANLE 462

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           R  G N+ +LA + AA VL GELSL++A    G L+ +HL+  R
Sbjct: 463 RP-GANSEQLARVVAAAVLSGELSLMSALA-AGHLVRSHLKHNR 504


>gi|168211|gb|AAA33358.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hevea
           brasiliensis]
          Length = 373

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 122/343 (35%), Positives = 186/343 (54%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ + M
Sbjct: 27  VQIPVGIAGPLLLDGK----EYTVPMATTEGCLVASANRGCK-AIYASGGATSVLLRDGM 81

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F T      L    E       IA V  ++S+F R   +   IAG  L++R  
Sbjct: 82  TRAPVVRFPTAKRAADLKFFMEDPDNFDTIAVVFNKSSRFARLQSVQCAIAGKNLYMRFS 141

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+KA   V+D++ + +  +    ++GN C+DKKA A+N I GRGK+ V 
Sbjct: 142 CSTGDAMGMNMVSKAVQNVIDYLQNDFPDMDVIGLTGNFCADKKAAAVNWIEGRGKSVVC 201

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +NM+ A Y+ATGQD 
Sbjct: 202 EAIIKEEVVKKVLKTNVAALVELNMIKNLTGSAVAGSLGGFNAHASNMVTAVYIATGQDP 261

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           A  VE S  +T  +  +D   L+ S ++P++ LG VG G  + +    L  LG     K 
Sbjct: 262 AQNVESSHCITMMEAVNDGKDLHISVSMPSIELGTVGGGTQLASQSACLNLLGVKGASKD 321

Query: 305 --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G N+R LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 322 SPGSNSRLLATIVAGSVLAGELSLMSA-IAAGQLVNSHMKYNR 363


>gi|242015780|ref|XP_002428525.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase, putative
           [Pediculus humanus corporis]
 gi|212513159|gb|EEB15787.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase, putative
           [Pediculus humanus corporis]
          Length = 874

 Score =  189 bits (479), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 126/351 (35%), Positives = 191/351 (54%), Gaps = 18/351 (5%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G +    V VP+AT E  L  S  RG+   + C  G+ + ++ + M
Sbjct: 524 VPVPVGVAGPLLLDGKL----VYVPMATTEGCLVASTNRGSRALLKC--GVISRVVSDGM 577

Query: 69  TRSIFFETEN---AEMALTALQEITLKKAEIARV-IEQTSQFTRFLQLHSQIAGNLLFLR 124
           TR       N   A  A+T +Q    +  EI +   + +S+F R  ++H +IA   LF+R
Sbjct: 578 TRGPVIRFPNMARASEAMTWMQ--NPENFEILKASFDSSSRFARLSKIHIKIASRHLFVR 635

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
               TGDA G NM++K  +  ++ +   +S +   S+SGN C+DKK  A+N I GRGK+ 
Sbjct: 636 FIAQTGDAMGMNMLSKGTEIALNTVKEHFSDMEILSLSGNFCADKKPAAVNWIEGRGKSV 695

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VAE  +   +    L+TS + +I +N  KNLIG+ +AG I   NAH AN++ A ++ATGQ
Sbjct: 696 VAEAIVPADVVTNVLKTSVQALIDVNITKNLIGSAVAGSIGGFNAHAANIVTAIFIATGQ 755

Query: 245 DAANIVEGSQGLTYAKLHDD---SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           D A  V  S  +T  +   D    LY SC++P++ +G VG G  +P     L  LG    
Sbjct: 756 DPAQNVGSSNCITLMEPWGDDGNDLYISCSMPSIEIGTVGGGTVLPPQSACLDMLGVKGS 815

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNG 350
            E+  G+NA +LA I   TVL GELSL++A    G L+ +HL+  R    G
Sbjct: 816 NEKNPGENACKLARIVCGTVLAGELSLMSALA-AGHLVRSHLKHNRSSTKG 865


>gi|1346297|sp|P48020|HMDH1_SOLTU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 1;
           Short=HMG-CoA reductase 1; Short=HMGR; Short=HMGR1
 gi|169485|gb|AAA93498.1| hydroxymethylglutaryl coenzyme A reductase [Solanum tuberosum]
          Length = 596

 Score =  189 bits (479), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 188/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 248 MPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCK-AIFVSGGADSVLLRDG 306

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  L    ++ +  ++S+F R   +   IAG  L++  
Sbjct: 307 MTRAPVVRFTTAKRAAELKFFVEDPLNFETLSLMFNKSSRFARLQGIQCAIAGKNLYITF 366

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ S++  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 367 SCSTGDAMGMNMVSKGVQNVLDYLQSEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 426

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A YLATGQD
Sbjct: 427 CEAIIKEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYLATGQD 486

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG      
Sbjct: 487 PAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANR 546

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 547 DAPGSNARLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 589


>gi|11133014|sp|Q41437|HMDH2_SOLTU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 2;
           Short=HMG-CoA reductase 2; AltName: Full=HMG2.2
 gi|1245484|gb|AAB52551.1| HMG-CoA reductase [Solanum tuberosum]
          Length = 595

 Score =  189 bits (479), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 118/343 (34%), Positives = 186/343 (54%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    ++ + M
Sbjct: 253 VQIPVGIAGPLLLNGK----EFSVPMATTEGCLVASTNRGCK-AIYASGGATCIVLRDGM 307

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F T      L    E  +K   +A V  Q+S+F R  ++   IAG  L++R  
Sbjct: 308 TRAPCVRFGTAKRAAELKFFVEDPIKFETLANVFNQSSRFGRLQRIQCAIAGKNLYMRFV 367

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK  A+N I GRGK+ V 
Sbjct: 368 CSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVC 427

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD 
Sbjct: 428 EAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVFIATGQDP 487

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG       
Sbjct: 488 AQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANRE 547

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NAR LA + A +VL GELSL++A  + G+L+ +H++  R
Sbjct: 548 APGSNARLLATVVAGSVLAGELSLMSA-ISAGQLVNSHMKYNR 589


>gi|147806058|emb|CAN72217.1| hypothetical protein VITISV_039086 [Vitis vinifera]
          Length = 575

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 189/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  +P+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 226 MPVGYVQIPVGIAGPLLLDGREYSIPMATTEGCLVASTNRGCK-AIYASGGATSVLLRDA 284

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  L    +A V  ++S+F R   +   IAG  L++R 
Sbjct: 285 MTRAPVVRFGTAKRAAELMLFLENPLNFETLALVFNRSSRFGRLQSIKCAIAGKNLYIRF 344

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NM++K    V+D++ + +  +    +SGN CSDKK TA+N I GRGK+ V
Sbjct: 345 SSSTGDAMGMNMISKGVQNVLDFLQNDFPDMDVIGISGNYCSDKKPTAVNWIEGRGKSVV 404

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 405 CEAIIKEEVVKKVLKTNVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYIATGQD 464

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 465 PAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANK 524

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 525 ESPGTNARLLATIVAGSVLAGELSLMSA-IAAGQLVRSHMKYNR 567


>gi|260821882|ref|XP_002606332.1| hypothetical protein BRAFLDRAFT_57278 [Branchiostoma floridae]
 gi|229291673|gb|EEN62342.1| hypothetical protein BRAFLDRAFT_57278 [Branchiostoma floridae]
          Length = 876

 Score =  188 bits (478), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 127/346 (36%), Positives = 192/346 (55%), Gaps = 17/346 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G R+ +I + M
Sbjct: 529 MPVPVGVAGPLLLDGQEYQ----VPMATTEGCLVASTNRGCRAIKLS-GGARSYIIGDGM 583

Query: 69  TRSIFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLFLR 124
           TR       +A  A +AL+ I L+  +    +      TS+F R   + S +AG  +++R
Sbjct: 584 TRGPVVRMPSAAQA-SALK-IWLRDNDNLDLLKEAFNSTSRFCRLDSIMSAVAGRHIYIR 641

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
            +  TGDA G NM++K  +  +  +   +  +   S+SGN C+DKKATAIN + GRGK+ 
Sbjct: 642 FKAVTGDAMGMNMLSKGTEKALKKLEEFFPDMELLSLSGNYCTDKKATAINWLEGRGKSV 701

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           V+E  I     +K L+TS   ++ LN  KNLIG+ +AG I   NAH AN++ A ++ATGQ
Sbjct: 702 VSEAVIKGEEVKKVLKTSVSALVDLNISKNLIGSSMAGSIGGFNAHAANIVAAIFIATGQ 761

Query: 245 DAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           DAA +V  S  +T  +    + + LY SCT+P+L +G VG G  +P  +  L  +G    
Sbjct: 762 DAAQVVASSNCMTLMEATGENGEDLYISCTMPSLEVGTVGGGTVLPPQRACLKMMGIDGS 821

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            + + G NAR+LA +  +TV+ GELSL++A    G L+ +HLR  R
Sbjct: 822 HDSEPGMNARQLAQVVCSTVMAGELSLMSALA-AGHLVRSHLRHNR 866


>gi|3095078|gb|AAC15475.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Tagetes erecta]
          Length = 574

 Score =  188 bits (478), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 125/346 (36%), Positives = 185/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    L+ 
Sbjct: 221 VGYVQIPVGIAGPLLLNGT----EFSVPMATTEGCLVASTNRGCK-AIYISGGATCILLK 275

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F T      L    E  +    +A V  ++S+F R   +   IAG   + 
Sbjct: 276 DGMTRAPVVRFGTAKRAAELKQFLEDPMNFDTLAVVFNKSSRFGRLQSVQCAIAGKNXYN 335

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   ATGDA G NMVTK    V+D++   +  +    +SGN CSDKK  AIN I GRGK+
Sbjct: 336 RFCCATGDAMGMNMVTKGVQNVLDFLQHDFPDMDVMGISGNYCSDKKPAAINWIEGRGKS 395

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A YLATG
Sbjct: 396 VVCEAIIKEEVVQKVLKTTVPALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYLATG 455

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 456 QDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 515

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            + + G NAR LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 516 SKEEPGSNARVLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 560


>gi|62912094|gb|AAF80475.2|AF162705_1 3-hydroxy-3-methylglutaryl coenzyme A reductase [Anthonomus
           grandis]
          Length = 832

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 189/351 (53%), Gaps = 18/351 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVK-VPLATYEYPLWHSVKRGAHISMLCPDGIRATLI 64
           V  + +P+   GP+     ++ DK   +P+AT E  L  S  RG     L   GI++ ++
Sbjct: 472 VGYVPVPLGIAGPL-----LLDDKFYYIPMATTEGCLVASANRGCR--ALEKTGIKSRIV 524

Query: 65  DERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQ---TSQFTRFLQLHSQIAGNLL 121
            + MTR      ++   A   +  +  K+    +V EQ   TS+F R  ++ + IAG  L
Sbjct: 525 ADGMTRGPVVRFQSITRACEVIYWLK-KRENFTKVKEQFDSTSRFARLSKVSTHIAGRCL 583

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           F+R    TG+A G NM++K  +  + +I S +  +   S+SGN+C+DKK +AIN I GRG
Sbjct: 584 FIRFVAETGEAMGMNMISKGTEKSLAYIKSHFEDMEILSLSGNVCTDKKPSAINWIEGRG 643

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  +   I    L+T+   ++ LN  KN++G+ ++  I   NAH AN++ A Y+A
Sbjct: 644 KSVVCEAIVPANIVHSILKTTTHALVDLNISKNMVGSAVSAAIGGFNAHAANIVTAIYIA 703

Query: 242 TGQDAANIVEGSQGLTYAKLHDD---SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           TGQD A  V  S  +T  +   D    L  SCT+P++ +G VG G  +PA    L  LG 
Sbjct: 704 TGQDVAQNVGSSNCITLMEPCGDKGEDLLISCTMPSVEIGTVGGGTVLPAQGACLEMLGV 763

Query: 299 --IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMH 347
                   GDNA++LA I    VL GELSL+AA    G L+++HLRL R +
Sbjct: 764 KGAHSENPGDNAKQLAKIVCGAVLAGELSLMAALVT-GHLVKSHLRLNRSY 813


>gi|15678590|ref|NP_275705.1| 3-hydroxy-3-methylglutaryl CoA reductase [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|3929352|sp|O26662|HMDH_METTH RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|2621639|gb|AAB85068.1| 3-hydroxy-3-methylglutaryl CoA reductase [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 397

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 119/341 (34%), Positives = 184/341 (53%), Gaps = 9/341 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+++ G     +  VPLAT E  L  SV RG  + +    G    +  
Sbjct: 64  IGVVQIPLGVAGPLRVRGEHADGEYYVPLATSEGALVASVNRGCSV-ITRAGGATVRVTG 122

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQI-AGNLLFLR 124
           + MTR+    T +   AL   + I      +    E T++  + +++   I AG+ ++ R
Sbjct: 123 DSMTRAPVIRTGSVVEALQLREWIYENMDALREEAESTTRHGKLVKIDPIIVAGSYVYPR 182

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             + TGD+ G NMVT A +  ++ +L++ +  H  ++SGN+C+DKK  A+N I GRGK+ 
Sbjct: 183 FVYTTGDSMGMNMVTIATERALE-LLTRETGAHVIALSGNLCTDKKPAAVNLIEGRGKSI 241

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AEIT+   + +  L+T+PE ++ +NT KNLIG+  AG +   NAH+AN++ A +LATGQ
Sbjct: 242 TAEITVPGEMVESVLKTTPEAVVEVNTAKNLIGSAAAGSM-GFNAHYANIIGAIFLATGQ 300

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           D A+IVEGS G+T A+     LYF+  +P++ L  VG G  +      L  +G     + 
Sbjct: 301 DEAHIVEGSLGVTIAEERKGDLYFAVNLPDVPLATVGGGTGLETASECLDIMGV----RG 356

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G      A I    VL GELSL+ A    G L  AH  L R
Sbjct: 357 GGRVHAFAEIVGGAVLAGELSLMGALA-AGHLARAHSELGR 396


>gi|47213283|emb|CAF92135.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 869

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 125/347 (36%), Positives = 186/347 (53%), Gaps = 13/347 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VPLAT E  L  S  RG     L   G ++ ++ 
Sbjct: 529 IGYMPVPVGVAGPLHLDGKQFQ----VPLATTEGCLVASTNRGCRAIALG-GGAKSRVLG 583

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR       +A  A  + A  E +     I    +QTS+F R  +L   +AG  L++
Sbjct: 584 DSMTRGPVVRLPSACQAAEVKAWLESSDGFQAIKDAFDQTSRFARLEKLLVGLAGRNLYI 643

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NM++K  +  +  +   +  L   SVSGN C+DKK  AIN I GRGK+
Sbjct: 644 RFHSKTGDAMGMNMISKGTEQALCVLQQHFPTLQVVSVSGNYCTDKKPAAINWIEGRGKS 703

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI   + ++ L+T+   ++ +N  KNL+G+ +AG +   NAH AN++ A Y+A G
Sbjct: 704 VVCEATIPAKVVREVLKTTAAALVEVNISKNLVGSAMAGSVGGFNAHAANLVAAIYIACG 763

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           QD A  V  S  +T  +      + LY +CT+P++ LG VG G N+P  +  L  LG   
Sbjct: 764 QDPAQSVGSSNCITLMEASGPAGEDLYINCTMPSIELGTVGGGTNLPPQQACLQMLGVQG 823

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +   G+NAR+LA +  ATVL GELSL+AA    G L+++H+   R
Sbjct: 824 ASQDCPGENARQLARVVCATVLAGELSLMAALAA-GHLVKSHMTHNR 869


>gi|71017861|ref|XP_759161.1| hypothetical protein UM03014.1 [Ustilago maydis 521]
 gi|46098782|gb|EAK84015.1| hypothetical protein UM03014.1 [Ustilago maydis 521]
          Length = 1007

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 187/347 (53%), Gaps = 13/347 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ I G  +     +P+AT E  L  S  RG   ++    G+   L  
Sbjct: 600 VGYMPIPLGIAGPLNIDGQFM----PIPMATTEGTLVASTSRGCK-ALNAGGGVTTVLTQ 654

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR    E  +   A  A + I  ++    I    + TS+F R   L   +AG  L++
Sbjct: 655 DAMTRGPALEFPSVVQAAKAKRWIDSQEGAQTIKAAFDSTSRFARLSSLRCVLAGRTLYV 714

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQW-SYLHYGSVSGNICSDKKATAINGIMGRGK 182
           R   +TGDA G NM++K  +  +  +  Q+   +   S+SGN C+DKK  AIN I GRGK
Sbjct: 715 RFATSTGDAMGMNMISKGVEKALGLMTEQYFPEMKVLSLSGNYCTDKKPAAINWIEGRGK 774

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + VAE  +   + +  L+ +   ++ LNT+KNLIG+ +AG +   NAH AN+L A YLAT
Sbjct: 775 SVVAEAVVPGNVVRSVLKCTVRDLVNLNTKKNLIGSAMAGSVGGFNAHAANILTAIYLAT 834

Query: 243 GQDAANIVEGSQGLTYAKL--HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           GQD A  VE S  +T  +    D+ L  + ++P++ +G VG G  +P  ++ L  +G   
Sbjct: 835 GQDPAQNVESSNCITLMEAINDDEDLLITVSMPSIEVGTVGGGTVLPPQRSMLEMMGIAG 894

Query: 301 ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  G NA+RLA I AA+V+ GELSL+ A    G L++AH++  R
Sbjct: 895 AHSTTPGANAQRLARIIAASVMAGELSLMGALCA-GHLIQAHMKHNR 940


>gi|11133196|sp|Q9XEL8|HMDH2_CAPAN RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 2;
           Short=HMG-CoA reductase 2
 gi|4704615|gb|AAD28179.1|AF110383_1 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Capsicum annuum]
          Length = 604

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 185/343 (53%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ + M
Sbjct: 258 VQIPVGIAGPLLLNGR----EYSVPMATTEGCLVASTNRGCK-AIYASGGATSILLRDGM 312

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F T      L    E  +    +A V  Q+S+F R  ++   IAG  L +R  
Sbjct: 313 TRAPCVRFGTAKRAAELKFFVEDPINFETLANVFNQSSRFARLQRIQCAIAGKNLHMRFV 372

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ ++++ +    +S N CSDKK  A+N I GRGK+ V 
Sbjct: 373 CSTGDAMGMNMVSKGVQNVLDYLQNEYADMDVIGISANFCSDKKPAAVNWIEGRGKSVVC 432

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+T    ++ LN  KNL G+ LAG +   NAH +N++ A Y+ATGQD 
Sbjct: 433 EAIITEEVVKKVLKTEVAALVELNMLKNLTGSALAGALGGFNAHASNIVSAVYIATGQDP 492

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG       
Sbjct: 493 AQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANRE 552

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NAR LA I A +VL GELSL++A  + G+L+ +H++  R
Sbjct: 553 APGSNARLLATIVAGSVLAGELSLMSA-ISAGQLVNSHMKYNR 594


>gi|11133016|sp|Q41438|HMDH3_SOLTU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 3;
           Short=HMG-CoA reductase 3; AltName: Full=HMG3.3
 gi|1245486|gb|AAB52552.1| HMG-CoA reductase [Solanum tuberosum]
 gi|7415990|dbj|BAA93631.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum tuberosum]
          Length = 574

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 186/343 (54%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           I +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L  + M
Sbjct: 231 IQIPVGIAGPLLLNGK----EFSVPMATTEGCLVASTNRGCK-AIYVSGGATSVLFRDAM 285

Query: 69  TRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      +A+ A  L    E  +    ++ V  ++S+F R   +   IAG  L++R  
Sbjct: 286 TRAPVVRFGSAKRAAELKFFVEDPMNFETLSVVFNKSSRFARLQNIQCAIAGKNLYMRFS 345

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK  A+N I GRGK+ V 
Sbjct: 346 CSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDIIGISGNYCSDKKPAAVNWIEGRGKSVVC 405

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A YLATGQD 
Sbjct: 406 EAIIKEDVVKKVLKTEVATLVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYLATGQDP 465

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG       
Sbjct: 466 AQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANRE 525

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NAR LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 526 APGSNARLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 567


>gi|297832342|ref|XP_002884053.1| 3-hydroxy-3-methylglutaryl-CoA reductase 2 [Arabidopsis lyrata
           subsp. lyrata]
 gi|297329893|gb|EFH60312.1| 3-hydroxy-3-methylglutaryl-CoA reductase 2 [Arabidopsis lyrata
           subsp. lyrata]
          Length = 564

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/346 (35%), Positives = 196/346 (56%), Gaps = 17/346 (4%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRG---AHISMLCPDGIRATLI 64
           MP+ ++  P+ I G ++ D+++  VP+AT E  L  S  RG    H+S     G  + L+
Sbjct: 212 MPVGYVQIPVGIAGPLLLDRIEYSVPMATTEGCLVASTNRGFKAIHLS----GGAFSVLM 267

Query: 65  DERMTRSI---FFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
            + MTR+    F     A + +  LQ+       ++ +  ++S+F R   +  +IAG  L
Sbjct: 268 KDAMTRAPVVRFPSARRAALVMFYLQD-PANFERLSLIFNKSSRFARLQSITCKIAGRNL 326

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           + R   +TGDA G NMV+K    V+D++ S++  +    +S N CSDKKA+A+N I GRG
Sbjct: 327 YPRFACSTGDAMGMNMVSKGVQNVLDFVKSEFPDMDVIGISWNYCSDKKASAVNWIEGRG 386

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  I   I +K L+TS E ++ LNT KNL G+ +AG +   NAH +N++ A ++A
Sbjct: 387 KHVVCEAFIKAEIVEKVLKTSVEALVELNTLKNLAGSAMAGSLGGFNAHASNIVSAVFIA 446

Query: 242 TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           TGQD A  VE S  +T  +   + L+ S ++P + +G VG G  + +    L  LG    
Sbjct: 447 TGQDPAQNVESSHCITLIEAEGNDLHISVSMPCIEVGTVGGGTQLASQSACLNLLGVKGS 506

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              + G NA++LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 507 NNEEPGSNAQQLARIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 551


>gi|121663754|emb|CAE00496.2| hydroxymethylglutaryl-CoA reductase [Rhizomucor miehei]
          Length = 1058

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 181/343 (52%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    +  + M
Sbjct: 709  MPLPLGVAGPLNIDG----IPTHIPMATTEGCLVASTARGCK-AINAGGGATTIVTADGM 763

Query: 69   TRSIFFETENAEMALTALQEITLKKAE-IARVIEQTSQFTRFLQLHSQIAGNLLFLRLEF 127
            TR    E  N   A    + I  +  E IA     TS+F R  +L   +AG L+F+R   
Sbjct: 764  TRGPCVEFPNITRAGECKRWIENEGYEVIADAFNATSRFARLRKLKVTLAGKLVFIRFST 823

Query: 128  ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
             TGD  G NM++K  +A +  +  ++  +   S+SGN C+DKK   IN I GRGK+ VAE
Sbjct: 824  TTGDDMGMNMISKGCEAALSVLAEEFPDMQIISLSGNYCTDKKPAVINWIEGRGKSVVAE 883

Query: 188  ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
              I   I +K L+T+   ++ LNT KNLIG+ +AG +   NAH AN+L A YLA GQD A
Sbjct: 884  AIIPGPIVEKVLKTTVSALVELNTSKNLIGSAMAGALGGFNAHAANILTAIYLAAGQDPA 943

Query: 248  NIVEGSQGLTYAKLHDD--SLYFSCTIPN-LILGCVGNGKNIPAIKNNLTALGCIEERKT 304
              VE S  +T  K  +D   L+ SCT+P+   +G VG G  +P  +  L  LG      T
Sbjct: 944  QNVESSNCITLMKAVNDGKDLHISCTMPSHRKIGTVGGGTILPPQQAILDMLGVRGPHPT 1003

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNARRLA I  A V+ GELSL AA    G L++AH+   R
Sbjct: 1004 NPGDNARRLARIICAAVMAGELSLCAALAA-GHLVKAHMAHNR 1045


>gi|212275480|ref|NP_001130818.1| hypothetical protein LOC100191922 [Zea mays]
 gi|194690196|gb|ACF79182.1| unknown [Zea mays]
          Length = 573

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 188/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     ++ VP+AT E  L  S  RG   ++    G  + +  
Sbjct: 219 VGYVQLPVGVAGPLLLDGR----RLYVPMATTEGCLVASTNRGCK-AIAESGGASSVVFR 273

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L A  E       +A V  ++S+F R   +   IAG  L++
Sbjct: 274 DGMTRAPVVRFPSARRAAELKAFLEDPANFDTLAVVFNRSSRFGRLQGVKCAIAGRNLYM 333

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++ + +  +   S+SGN CSDKK+ A+N I GRGK+
Sbjct: 334 RFSCSTGDAMGMNMVSKGVQNVLDYLQADFPDMDVISISGNFCSDKKSAAVNWIDGRGKS 393

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 394 VVCEAVIKEEVVKKVLKTNVQALVELNVIKNLAGSAVAGALGGFNAHASNIVAAIFIATG 453

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 454 QDPAQNVESSQCITMLEAINDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLDLLGVKGA 513

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A  VL  ELSL++AQ   G L+++H++  R
Sbjct: 514 NRESPGSNARLLATVVAGAVLAAELSLISAQAA-GHLVQSHMKYNR 558


>gi|232267|sp|Q00583|HMDH3_HEVBR RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 3;
           Short=HMG-CoA reductase 3
 gi|168215|gb|AAA33360.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hevea
           brasiliensis]
          Length = 586

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/343 (35%), Positives = 186/343 (54%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ + M
Sbjct: 240 VQIPVGIAGPLLLDGK----EYTVPMATTEGCLVASANRGCK-AIYASGGATSVLLRDGM 294

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F T      L    E       IA V  ++S+F R   +   IAG  L++R  
Sbjct: 295 TRAPVVRFPTAKRAADLKFFMEDPDNFDTIAVVFNKSSRFARLQSVQCAIAGKNLYMRFS 354

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+KA   V+D++ + +  +    ++GN C+DKKA A+N I GRGK+ V 
Sbjct: 355 CSTGDAMGMNMVSKAVQNVIDYLQNDFPDMDVIGLTGNFCADKKAAAVNWIEGRGKSVVC 414

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +NM+ A Y+ATGQD 
Sbjct: 415 EAIIKEEVVKKVLKTNVAALVELNMIKNLTGSAVAGSLGGFNAHASNMVTAVYIATGQDP 474

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK- 303
           A  VE S  +T  +  +D   L+ S ++P++ LG VG G  + +    L  LG     K 
Sbjct: 475 AQNVESSHCITMMEAVNDGKDLHISVSMPSIELGTVGGGTQLASQSACLNLLGVKGASKD 534

Query: 304 -TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G N+R LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 535 SPGSNSRLLATIVAGSVLAGELSLMSA-IAAGQLVNSHMKYNR 576


>gi|297744455|emb|CBI37717.3| unnamed protein product [Vitis vinifera]
          Length = 553

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 189/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ +I  P+ I G ++ D  +  +P+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 204 MPVGYIQIPVGIAGPLLLDGREYSIPMATTEGCLVASTNRGCK-AIYASGGATSVLLRDA 262

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  L    +A V  ++S+F +   +   IAG  L++R 
Sbjct: 263 MTRAPVVRFGTAKRAAELMLFLENPLNFETLALVFNRSSRFGKLQSIKCAIAGKNLYIRF 322

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NM++K    V+D++ + +  +    +SGN CSDKK TA+N I GRGK+ V
Sbjct: 323 SSSTGDAMGMNMISKGVQNVLDFLQNDFPDMDVIGISGNYCSDKKPTAVNWIEGRGKSVV 382

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 383 CEAIIKEEVVKKVLKTNVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYIATGQD 442

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 443 PAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANK 502

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 503 ESPGTNARLLATIVAGSVLAGELSLMSA-IAAGQLVRSHMKYNR 545


>gi|157169112|gb|ABV25902.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Antirrhinum majus]
          Length = 555

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 190/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  A L+ 
Sbjct: 204 VGYVQIPVGIAGPLLLNGC----EFSVPMATTEGCLVASTNRGCK-AIYASGGATAVLLR 258

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F+T N    L    E  L    ++ V  ++S+F R   +   IAG  L++
Sbjct: 259 DGMTRAPVVRFDTANRATDLKFFLEDPLNFDTLSLVFNKSSRFARLQGIQCAIAGKNLYI 318

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+
Sbjct: 319 RFSCSTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKS 378

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  ++  I  K L+T+   ++ LN  KNL G+ +AG +   NAH AN++ A ++ATG
Sbjct: 379 VVCEAVVSGDIVTKVLKTTVPALVELNMLKNLAGSAIAGALGGFNAHAANIVSAVFIATG 438

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  +E S  +T  +  +D   L+ S T+P++ +G VG G ++ +    L  LG    
Sbjct: 439 QDPAQNIESSHCITMMEAVNDGNDLHVSVTMPSIEVGTVGGGTHLASQSACLNLLGVKGA 498

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +   G N++ LA I A +VL GELSL++A  + G+L ++H++  R
Sbjct: 499 SKESPGSNSQLLATIVAGSVLAGELSLMSA-ISAGQLDKSHMKYNR 543


>gi|126459698|ref|YP_001055976.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pyrobaculum
           calidifontis JCM 11548]
 gi|126249419|gb|ABO08510.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pyrobaculum
           calidifontis JCM 11548]
          Length = 399

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 128/341 (37%), Positives = 191/341 (56%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ + G+       VPLAT E  L  SV RGA + +    G RA ++ 
Sbjct: 56  IGAVQVPVGVAGPLLVRGDYANGHFYVPLATTEGALVASVNRGAKL-VTESGGARAKVLK 114

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + M R+  F   +   A+  +  +     E+ +V E T++  R  ++   I GN ++LRL
Sbjct: 115 DGMARAPLFRLPSLVEAVEFVNWVLQNFEEVKKVAESTTRHGRLKEIQPFIVGNYVWLRL 174

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F+TGDA G NMVT A+DAV  ++  ++      ++SGN+C DKK  A+N ++GRGK  V
Sbjct: 175 VFSTGDAMGMNMVTVASDAVAKYLQEKFPNARLVALSGNMCVDKKPNAVNFLLGRGKTVV 234

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  + R +  + L  +PE +  +N +KNL+G+ LA      NAHFAN++ A ++ATGQD
Sbjct: 235 AEAVVKREVLGR-LGVTPEAVHEVNVRKNLMGSALAHSY-GFNAHFANIIAALFIATGQD 292

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G+T  +  ++ LY S  +P+L +G VG G  +P  +  L  LG        
Sbjct: 293 VAQVVESSMGITTTEPREEGLYISVFLPSLEVGTVGGGTGLPTQREALALLGVAGPGDPP 352

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA + A I AA VL GEL+LL A     EL  AH RL R
Sbjct: 353 GTNALKFAEIAAAAVLAGELNLLVALAR-NELATAHERLGR 392


>gi|225428346|ref|XP_002283183.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 575

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 189/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ +I  P+ I G ++ D  +  +P+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 226 MPVGYIQIPVGIAGPLLLDGREYSIPMATTEGCLVASTNRGCK-AIYASGGATSVLLRDA 284

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  L    +A V  ++S+F +   +   IAG  L++R 
Sbjct: 285 MTRAPVVRFGTAKRAAELMLFLENPLNFETLALVFNRSSRFGKLQSIKCAIAGKNLYIRF 344

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NM++K    V+D++ + +  +    +SGN CSDKK TA+N I GRGK+ V
Sbjct: 345 SSSTGDAMGMNMISKGVQNVLDFLQNDFPDMDVIGISGNYCSDKKPTAVNWIEGRGKSVV 404

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 405 CEAIIKEEVVKKVLKTNVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYIATGQD 464

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 465 PAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANK 524

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 525 ESPGTNARLLATIVAGSVLAGELSLMSA-IAAGQLVRSHMKYNR 567


>gi|90578709|ref|ZP_01234519.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio angustum
           S14]
 gi|90439542|gb|EAS64723.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio angustum
           S14]
          Length = 419

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 123/342 (35%), Positives = 190/342 (55%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + S+ +P+   GP+K+ G     +  VPLAT E  L  S  RGA + +    G  A L++
Sbjct: 86  IGSVKLPLGVAGPLKVNGLFASGEYFVPLATTEAALVASYHRGA-LLISAAGGASAILLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  E+   A   +  +T +      + E T+++ +   ++  + GN ++L  
Sbjct: 145 EGVTRAPGFAFESLVQASKFITWVTTQYDTFKTIAESTTRYGKLSDINLSMEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT + +AV ++IL+        + +  N+  DKKATA      RGK  
Sbjct: 205 EYLTGDASGQNMVTISTNAVFEYILANTPIKPVEAFLDCNLSGDKKATAQTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++R + +KYL T+PEK++    +   +G  L+G I   NAH+AN L A+Y+A GQ
Sbjct: 265 TAEVHLSRELVKKYLHTTPEKMVDFG-KMTTVGGALSGTI-GVNAHYANALAAFYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E S G+T  +L   D L  S T+PNL++G VG G ++P+ K  L  LG      
Sbjct: 323 DAACVAESSVGITRMELNQQDGLCVSVTLPNLMVGTVGGGTHLPSQKACLELLGLYGS-- 380

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +++ LA +CAA  L GELS++ A  + G   +AH RL R
Sbjct: 381 --GHSQALAEVCAALCLAGELSIIGAFCS-GHFAKAHHRLAR 419


>gi|322797282|gb|EFZ19429.1| hypothetical protein SINV_04907 [Solenopsis invicta]
          Length = 567

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 189/344 (54%), Gaps = 14/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+  +GP+ I G +      VP+AT E  L  S  RG+     C  G+   +I + M
Sbjct: 227 VPVPVGIVGPLLIDGQLYH----VPMATTEVCLVASTNRGSRALRKC--GVTTCVIADGM 280

Query: 69  TRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+   +  +      A+  I   +   E+    ++TS+F R  +++S+IAG  L LR  
Sbjct: 281 TRAPVVQFPDIVRTCEAMSWIKQPQNFQELKNSFDRTSRFARLKKINSRIAGRDLHLRFI 340

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV++     +  + + +  +   S+SGN+C+DKK  A+N I GRGK+ + 
Sbjct: 341 ATTGDAMGMNMVSQGTQKSLQKLQTYFPDMKIISLSGNLCTDKKPAAVNWIEGRGKSVIC 400

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   +    L+TS  ++I LN +KNLIG+ LAG I   NAH AN++ A ++ATGQD 
Sbjct: 401 EAVIPADVVAWVLKTSVPELIKLNVKKNLIGSALAGSIGGYNAHAANIVTAIFIATGQDP 460

Query: 247 ANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           A  +  S  LT  +   +    L+ +CT+P++ +G +G G  +PA    L  LG      
Sbjct: 461 AQNISSSNCLTVMESCGVDGKDLHMTCTMPSIEVGTIGGGTVLPAQGACLGMLGIKGGHP 520

Query: 304 T--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           T  G NA +LA I  ATVL  ELSL+AA  + G+L+++HL+  R
Sbjct: 521 TEPGQNAEKLARIVCATVLAAELSLMAALAS-GDLVKSHLQHNR 563


>gi|1346300|sp|P48021|HMDH_CAMAC RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|289881|gb|AAA33040.1| 3-hydroxy-3-methylglutaryl coA reductase [Camptotheca acuminata]
          Length = 593

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 186/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG      C  G  + L+ + 
Sbjct: 242 MPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIFAC-GGATSVLLRDA 300

Query: 68  MTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+      +A+ A  L    E  L    +A V   +S+F +   +   IAG  L++R 
Sbjct: 301 MTRAPVVRFGSAKRAADLKFFLENPLNFETLAAVFNSSSRFGKLQNIKCAIAGKNLYMRY 360

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NM++K    V+D++   +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 361 SCSTGDAMGMNMISKGVQNVLDFLQDDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVV 420

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A YLATGQD
Sbjct: 421 CEAVIKEEVVKKVLKTNVASLVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYLATGQD 480

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 481 PAQNVESSHCITMMEAINDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 540

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 541 EAPGSNARLLATIVAGSVLAGELSLMSAIAA-GQLVNSHMKYNR 583


>gi|281204156|gb|EFA78352.1| hydroxymethylglutaryl CoA reductase [Polysphondylium pallidum
           PN500]
          Length = 550

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 126/344 (36%), Positives = 189/344 (54%), Gaps = 14/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           I +P+   GP+ + G +    V +P+AT E  L  S  RG   ++    G R+ ++   M
Sbjct: 193 IPIPVGVAGPLLLDGKL----VSIPMATTEGCLVASTHRGCK-AITKSGGARSVILQNGM 247

Query: 69  TRSIF--FETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+    F +      L +  E      +IA     TS+F R   +   IAG L++LR +
Sbjct: 248 TRAPVCRFPSVVRAAELKSWIENQENFYQIASAFNSTSRFARLKSIKVVIAGRLVYLRFK 307

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K  +  ++ I   +  +   S+SGN+C+DKK +AIN + GRGK+ V 
Sbjct: 308 SSTGDAMGMNMVSKGVEKALEVIGEYFPEMEVLSLSGNLCTDKKPSAINWLEGRGKSVVC 367

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E TI+  I +  L+T    ++ LN  KNLIG+ +AG I   NAH +N++ A Y+ATGQD 
Sbjct: 368 EATISGDIVRDVLKTDIPSLVALNIDKNLIGSAMAGSIGGFNAHASNIVTALYMATGQDP 427

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTAL---GCIEE 301
           A  VE S  +T  +  +D   LY S T+P++ +G VG G ++PA    L  L   G   E
Sbjct: 428 AQNVESSNCITLMEPTNDGKDLYISVTMPSIEVGTVGGGTHLPAQAACLDLLKVRGANVE 487

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           R  G N+ +LA + A  V+ GELSL++A    G L+ +HL+  R
Sbjct: 488 RP-GSNSEQLARVVAGAVMAGELSLMSALAA-GHLVRSHLQHNR 529


>gi|282165672|ref|YP_003358057.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanocella
           paludicola SANAE]
 gi|282157986|dbj|BAI63074.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanocella
           paludicola SANAE]
          Length = 408

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 117/343 (34%), Positives = 187/343 (54%), Gaps = 7/343 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ I G+  +    +PLAT E  L  SV RG  +      G+   ++ 
Sbjct: 70  IGAVQIPLGIAGPITIHGDYAKGDFYLPLATTEGALVASVNRGCSVCR-AAGGVTVAVMQ 128

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+   + ++ + A      +   +  AE+  V+  T++    L++   + G  +FL
Sbjct: 129 DEMTRAPVVKAKDLKEAKRLADAVKTPEMFAEMRAVVGTTTRHGELLRVDPYVVGRSVFL 188

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R+ F T DA G NMVT A+D VM  +  ++  +   ++S N+C+DKK  AIN I GRG+ 
Sbjct: 189 RMAFDTKDAMGMNMVTIASDKVMRELEKKFD-VKLVALSSNMCTDKKPAAINVIEGRGRT 247

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            VAE+ + R +  + L+ +PE +  +N +KN +G+  A      NA  AN++ A Y+A G
Sbjct: 248 TVAEVIVPREVVLERLKAAPEDMCDVNYRKNFLGSARAVSF-GFNAQVANVIAAMYIACG 306

Query: 244 QDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EER 302
           QD A++VEGS  +T A++  D L+FS + P+L +G VG G  +      L  LG      
Sbjct: 307 QDPAHVVEGSNAITSAEMDGDDLHFSVSFPSLPMGTVGGGTGLATQSECLNLLGVKGGGT 366

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NAR+LA I A+  L GELSLL A  +  +L +AH +  R
Sbjct: 367 PPGSNARKLAEIVASAGLAGELSLLGALASQ-DLAKAHAKYGR 408


>gi|51599128|gb|AAU08214.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Hevea
           brasiliensis]
          Length = 575

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 188/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ 
Sbjct: 226 VGYVQIPVGIAGPLLLNGR----EYSVPMATTEGCLVASTNRGCK-AIYLSGGATSVLLK 280

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E       +A V  ++S+F R   +   IAG  L++
Sbjct: 281 DGMTRAPVVRFASATRAAELKFFLEDPDNFDTLAVVFNKSSRFARLQGIKCSIAGKNLYI 340

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R  ++TGDA G NMV+K    V++++ S +S +    +SGN CSDKK  A+N I GRGK+
Sbjct: 341 RFSYSTGDAMGMNMVSKGVQNVLEFLQSDFSDMDVIGISGNFCSDKKPAAVNWIEGRGKS 400

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH  N++ A ++ATG
Sbjct: 401 VVCEAIIKEEVVKKVLKTNVASLVELNMLKNLAGSAVAGALGGFNAHAGNIVSAIFIATG 460

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 461 QDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 520

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +   G N+R LAAI A +VL GELSL++A    G+L+++H++  R
Sbjct: 521 NKESPGSNSRLLAAIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 565


>gi|67483357|gb|AAY68034.1| 3-hydroxy-methylglutaryl coenzyme A reductase [Tilia miqueliana]
          Length = 585

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 124/349 (35%), Positives = 186/349 (53%), Gaps = 18/349 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRAT 62
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG    H+S     G  + 
Sbjct: 236 VGYVQIPVGIAGPLLLNGR----EYTVPMATTEGTLVASTNRGCKAIHLS----GGATSV 287

Query: 63  LIDERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           L+ + MTR+  + F T      L    E       +A V  ++S+F R   +   IAG  
Sbjct: 288 LLKDGMTRAPVVRFSTAKRAADLKFYLEDPENFETLAVVFNRSSRFARLQGIKCAIAGKN 347

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           L+LR   +TGDA G NMV+K    V+D++ + +S +    +SGN CSDKK  A+N I GR
Sbjct: 348 LYLRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFSDMDVIGISGNFCSDKKPAAVNWIEGR 407

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ V E  I   + +K L+T  E ++ LN  KNL G+ +AG +   NA+  N++ A Y+
Sbjct: 408 GKSVVCEAIIKDDVVRKVLKTGVESLVELNMLKNLTGSAMAGALGGFNAYAGNIVSAVYI 467

Query: 241 ATGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           ATGQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG 
Sbjct: 468 ATGQDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGV 527

Query: 299 --IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               +   G+N+R LA I A  VL GELSL++A    G+L+ +H++  R
Sbjct: 528 KGASKESPGENSRMLATIVAGAVLAGELSLMSALA-AGQLINSHMKYNR 575


>gi|320170186|gb|EFW47085.1| hydroxymethylglutaryl-coenzyme A reductase [Capsaspora owczarzaki
            ATCC 30864]
          Length = 1125

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 188/354 (53%), Gaps = 19/354 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            I +P+  +GP+ + G     +  VP+AT E  L  S  RG   ++    G+ + L+++ M
Sbjct: 729  IPIPVGTVGPLLLDGV----EYTVPMATTEGCLLASTHRGCK-ALHMAGGVSSALLNDGM 783

Query: 69   TRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR       +   A    Q +   +  A+     + TS+F R   +H  IAG L+++R+ 
Sbjct: 784  TRGPVVRATSVHEAADLKQWLDSPEGFADFKSAFDSTSRFARLQNVHIAIAGRLVYIRVR 843

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
              TGDA G NM++K  +  +  +   +  +   S+SGN C+DKK  AIN I GRGK+ V 
Sbjct: 844  TTTGDAMGMNMISKGTEKALARLQEHYPTIEVVSLSGNYCTDKKPAAINWIQGRGKSVVC 903

Query: 187  EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
            E  I+  I  K L+TS   ++ LN  KNLIG+ +AG I   NAH AN++ A Y+ATGQD 
Sbjct: 904  EAVISGDIVTKILKTSIPALVDLNMSKNLIGSAMAGSIGGFNAHAANIVTAIYIATGQDP 963

Query: 247  ANIVEGSQGLTYAKL---------HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
            A  VE S  +T  +              L  +C++P++ +G +G G  +PA    L+ LG
Sbjct: 964  AQNVESSNCMTLMERCKHLPLRINGGKDLLMTCSMPSIEVGTIGGGTQLPAQSACLSMLG 1023

Query: 298  CIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                 +T  G NA++LA +  A+V+ GELSL++A    G L+++H+   R   N
Sbjct: 1024 VKGAHQTNPGQNAQQLARVICASVMAGELSLMSALAA-GHLVKSHMTHNRSSQN 1076


>gi|326505776|dbj|BAJ91127.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 557

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 186/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 205 VGYVQLPVGIAGPLLLDGQ----RFYVPMATTEGCLVASTNRGCK-AIAESGGATSVVLR 259

Query: 66  ERMTRSIF--FETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+    F T      L A  E       ++ V  ++S+F R   +   +AG  L++
Sbjct: 260 DAMTRAPVARFPTARRAAELKAFLEDPANFDTLSVVFNRSSRFGRLQGVQCAMAGRNLYM 319

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NM++K    V+D++   +  +   S+SGN CSDKK  A+N I GRGK+
Sbjct: 320 RFSCSTGDAMGMNMISKGVQNVLDYLQDDFPDMDVISISGNFCSDKKPAAVNWIEGRGKS 379

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   I +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 380 VVCEAVIKEEIVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 439

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 440 QDPAQNVESSQCITMLEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGA 499

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A  VL GELSLL+A    G+L+++H++  R
Sbjct: 500 NRESPGSNARLLATVVAGGVLAGELSLLSALAA-GQLVKSHMKYNR 544


>gi|90081800|dbj|BAE90181.1| unnamed protein product [Macaca fascicularis]
          Length = 404

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 188/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 47  IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 101

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 102 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 161

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 162 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 221

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ + +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 222 VVCEAVIPANVVREVLKTTTDAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 281

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 282 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 341

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 342 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 391


>gi|18313160|ref|NP_559827.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase)
           [Pyrobaculum aerophilum str. IM2]
 gi|18160673|gb|AAL64009.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase)
           [Pyrobaculum aerophilum str. IM2]
          Length = 398

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 132/341 (38%), Positives = 192/341 (56%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ + G+       VPLAT E  L  SV RGA   +    G R  ++ 
Sbjct: 59  IGAVQIPVGVAGPLLVRGDYANGYFYVPLATTEGALVASVNRGAKF-VTESGGARVKVLK 117

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + M R+  F   +   A+  ++ +T    E+ +V E T++F +   +   I GN ++LRL
Sbjct: 118 DGMARAPLFRVPSLIDAVELVEWVTGHFEELKKVAESTTRFGKLKDIQHFIVGNYVWLRL 177

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F+TGDA G NMVT A++AV  +I   +      ++SGN+C DKKA A+N I+GRGK  V
Sbjct: 178 VFSTGDAMGMNMVTIASEAVAKFIQENFPKAKLIALSGNMCVDKKANAVNFILGRGKTVV 237

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I + I ++ L  +PE +  +N +KNLIG+ LA      NAHFAN++ A ++ATGQD
Sbjct: 238 AEAVIKKEILER-LGITPEDVHNVNVRKNLIGSALAHSY-GFNAHFANIIAAIFIATGQD 295

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G+T  +  +D LY S  +P+L +G VG G  +P  +  L  LG        
Sbjct: 296 VAQVVESSMGITSTEAREDGLYISVFLPSLEVGTVGGGTGLPTQREALELLGVAGSGNPP 355

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA + A I AA VL GEL+LL A     EL  AH +L R
Sbjct: 356 GVNALKFAEIIAAAVLAGELNLLIALAR-NELASAHKKLGR 395


>gi|254212133|gb|ACT65734.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Salvia
           miltiorrhiza]
          Length = 550

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 121/344 (35%), Positives = 192/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D V+  VP+AT E  L  S  RG   +++   G  + +  + 
Sbjct: 199 MPVGYVQIPVGIAGPLLLDGVEYSVPMATTEGCLVASTNRGCK-AIMASGGASSAVHRDG 257

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F +    + L    E  L    ++ V   +S+F R  ++   IAG  L++R 
Sbjct: 258 MTRAPVVRFGSAKRAVELKLFLEDPLNFESLSLVFNSSSRFGRLQKIKCAIAGKNLYMRF 317

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++++Q+  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 318 TCSTGDAMGMNMVSKGVQNVLDFLVNQFPDMDVLGISGNYCSDKKPAAVNWIEGRGKSVV 377

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   +  K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 378 CEAVIKEEVVHKVLKTNVAALVELNMLKNLTGSAIAGALGGFNAHASNIVSAVYIATGQD 437

Query: 246 AANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
            A  VE S  +T  +  +    L+ S ++P++ +G VG G  + +    L  LG     K
Sbjct: 438 PAQNVESSHCITMMEAVNGGKDLHVSVSMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 497

Query: 304 --TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA I AA+VL GELSL++A    G+L+++H++  R
Sbjct: 498 EVPGANSRLLATIVAASVLAGELSLMSA-IAAGQLVKSHMKYNR 540


>gi|288225912|gb|ADC44451.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Salvia
           miltiorrhiza]
          Length = 550

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 121/344 (35%), Positives = 192/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D V+  VP+AT E  L  S  RG   +++   G  + +  + 
Sbjct: 199 MPVGYVQIPVGIAGPLLLDGVEYSVPMATTEGCLVASTNRGCK-AIMASGGASSAVHRDG 257

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F +    + L    E  L    ++ V   +S+F R  ++   IAG  L++R 
Sbjct: 258 MTRAPVVRFGSAKRAVELKLFLEDPLNFESLSLVFNSSSRFGRLQKIKCAIAGKNLYMRF 317

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++++Q+  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 318 TCSTGDAMGMNMVSKGVQNVLDFLVNQFPDMDVLGISGNYCSDKKPAAVNWIEGRGKSVV 377

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   +  K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 378 CEAVIKEEVVHKVLKTNVAALVELNMLKNLTGSAIAGALGGFNAHASNIVSAVYIATGQD 437

Query: 246 AANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
            A  VE S  +T  +  +    L+ S ++P++ +G VG G  + +    L  LG     K
Sbjct: 438 PAQNVESSHCITMMEAVNGGKDLHVSVSMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 497

Query: 304 --TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA I AA+VL GELSL++A    G+L+++H++  R
Sbjct: 498 EVPGANSRLLATIVAASVLAGELSLMSA-IAAGQLVKSHMKYNR 540


>gi|296194320|ref|XP_002744901.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase
           [Callithrix jacchus]
          Length = 888

 Score =  186 bits (471), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 188/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E     A I    + TS+F R  +LH+ IAG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETPEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G+L+++H+   R  +N
Sbjct: 826 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGQLVKSHMIHNRSKIN 875


>gi|7245353|pdb|1DQ8|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg And Coa
 gi|7245354|pdb|1DQ8|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg And Coa
 gi|7245355|pdb|1DQ8|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg And Coa
 gi|7245356|pdb|1DQ8|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg And Coa
 gi|7245357|pdb|1DQ9|A Chain A, Complex Of Catalytic Portion Of Human Hmg-Coa Reductase
           With Hmg-Coa
 gi|7245358|pdb|1DQ9|B Chain B, Complex Of Catalytic Portion Of Human Hmg-Coa Reductase
           With Hmg-Coa
 gi|7245359|pdb|1DQ9|C Chain C, Complex Of Catalytic Portion Of Human Hmg-Coa Reductase
           With Hmg-Coa
 gi|7245360|pdb|1DQ9|D Chain D, Complex Of Catalytic Portion Of Human Hmg-Coa Reductase
           With Hmg-Coa
 gi|7245361|pdb|1DQA|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg, Coa, And Nadp+
 gi|7245362|pdb|1DQA|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg, Coa, And Nadp+
 gi|7245363|pdb|1DQA|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg, Coa, And Nadp+
 gi|7245364|pdb|1DQA|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Hmg, Coa, And Nadp+
 gi|14277848|pdb|1HW8|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Compactin (Also Known As Mevastatin)
 gi|14277849|pdb|1HW8|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Compactin (Also Known As Mevastatin)
 gi|14277850|pdb|1HW8|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Compactin (Also Known As Mevastatin)
 gi|14277851|pdb|1HW8|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Compactin (Also Known As Mevastatin)
 gi|14277852|pdb|1HW9|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Simvastatin
 gi|14277853|pdb|1HW9|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Simvastatin
 gi|14277854|pdb|1HW9|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Simvastatin
 gi|14277855|pdb|1HW9|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Simvastatin
 gi|14277856|pdb|1HWI|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Fluvastatin
 gi|14277857|pdb|1HWI|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Fluvastatin
 gi|14277858|pdb|1HWI|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Fluvastatin
 gi|14277859|pdb|1HWI|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Fluvastatin
 gi|14277860|pdb|1HWJ|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Cerivastatin
 gi|14277861|pdb|1HWJ|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Cerivastatin
 gi|14277862|pdb|1HWJ|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Cerivastatin
 gi|14277863|pdb|1HWJ|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Cerivastatin
 gi|14277864|pdb|1HWK|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Atorvastatin
 gi|14277865|pdb|1HWK|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Atorvastatin
 gi|14277866|pdb|1HWK|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Atorvastatin
 gi|14277867|pdb|1HWK|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Atorvastatin
 gi|14277868|pdb|1HWL|A Chain A, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Rosuvastatin (Formally Known As Zd4522)
 gi|14277869|pdb|1HWL|B Chain B, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Rosuvastatin (Formally Known As Zd4522)
 gi|14277870|pdb|1HWL|C Chain C, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Rosuvastatin (Formally Known As Zd4522)
 gi|14277871|pdb|1HWL|D Chain D, Complex Of The Catalytic Portion Of Human Hmg-Coa
           Reductase With Rosuvastatin (Formally Known As Zd4522)
          Length = 467

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 189/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ +     + + +VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 110 IGYMPIPVGVAGPLCLD----EKEFQVPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 164

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 165 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 224

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 225 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 284

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 285 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 344

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 345 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 404

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 405 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 454


>gi|332821137|ref|XP_001148405.2| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase isoform
           4 [Pan troglodytes]
          Length = 908

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 188/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 551 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 605

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 606 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 665

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 666 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 725

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 726 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 785

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 786 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 845

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 846 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 895


>gi|11132838|sp|O64967|HMDH2_GOSHI RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 2;
           Short=HMG-CoA reductase 2
 gi|2935300|gb|AAC05089.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Gossypium
           hirsutum]
          Length = 628

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 125/349 (35%), Positives = 186/349 (53%), Gaps = 18/349 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRAT 62
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG    H+S     G  + 
Sbjct: 279 VGYVQIPVGIAGPLLLNGR----EYSVPMATTEGCLVASTNRGCKAIHLS----GGATSI 330

Query: 63  LIDERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           L+ + MTR+  + F T      L    E       +A V  ++S+F R   +   IAG  
Sbjct: 331 LLKDGMTRAPVVRFSTAKRAAELKFYLEDPENFDTLAVVFNRSSRFGRLQSIKCAIAGKN 390

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           L+LR   +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GR
Sbjct: 391 LYLRFTCSTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGR 450

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ V E  I   + +K L+TS E ++ LN  KNL G+ +AG +   NAH +N++ A Y+
Sbjct: 451 GKSVVCEAIIEGDVVRKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYI 510

Query: 241 ATGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           ATGQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG 
Sbjct: 511 ATGQDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGV 570

Query: 299 IEERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               K   G N+R LA I    VL GELSL++A    G+L+++H++  R
Sbjct: 571 KGASKDVAGANSRMLATIVTGAVLAGELSLMSALAA-GQLVKSHMKYNR 618


>gi|114599627|ref|XP_001148324.1| PREDICTED: 3-hydroxy-3-methylglutaryl-Coenzyme A reductase isoform
           3 [Pan troglodytes]
          Length = 888

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 188/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 826 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 875


>gi|224061567|ref|XP_002300544.1| predicted protein [Populus trichocarpa]
 gi|222847802|gb|EEE85349.1| predicted protein [Populus trichocarpa]
          Length = 577

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 186/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ 
Sbjct: 228 VGFVQIPVGIAGPLLLNGT----EYMVPMATTEGCLVASTNRGCK-AIYASGGASSMLLK 282

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F T      L    E       ++    ++S+F R   +   +AG  L++
Sbjct: 283 DAMTRAPVVRFGTAKRAAELKFFVEDPANFDTLSVAFNRSSRFGRLQNIKCAVAGKNLYM 342

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+
Sbjct: 343 RFSCSTGDAMGMNMVSKGVQNVLDYVQTDFPDMDIIGISGNFCSDKKPAAVNWIEGRGKS 402

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATG
Sbjct: 403 VVCEAIIKEEVVQKVLKTNIDTLVELNMLKNLAGSAMAGALGGFNAHASNIVSAVYIATG 462

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 463 QDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 522

Query: 302 RK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            K   G N+R LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 523 SKDSPGSNSRLLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 567


>gi|152149428|pdb|2Q1L|A Chain A, Design And Synthesis Of Pyrrole-Based, Hepatoselective
           Hmg- Coa Reductase Inhibitors
 gi|152149429|pdb|2Q1L|B Chain B, Design And Synthesis Of Pyrrole-Based, Hepatoselective
           Hmg- Coa Reductase Inhibitors
 gi|152149430|pdb|2Q1L|C Chain C, Design And Synthesis Of Pyrrole-Based, Hepatoselective
           Hmg- Coa Reductase Inhibitors
 gi|152149431|pdb|2Q1L|D Chain D, Design And Synthesis Of Pyrrole-Based, Hepatoselective
           Hmg- Coa Reductase Inhibitors
 gi|152149452|pdb|2Q6B|A Chain A, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 gi|152149453|pdb|2Q6B|B Chain B, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 gi|152149454|pdb|2Q6B|C Chain C, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 gi|152149455|pdb|2Q6B|D Chain D, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 gi|152149456|pdb|2Q6C|A Chain A, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 gi|152149457|pdb|2Q6C|B Chain B, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 gi|152149458|pdb|2Q6C|C Chain C, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 gi|152149459|pdb|2Q6C|D Chain D, Design And Synthesis Of Novel, Conformationally Restricted
           Hmg-Coa Reductase Inhibitors
 gi|166235471|pdb|3BGL|A Chain A, Hepatoselectivity Of Statins: Design And Synthesis Of 4-
           Sulfamoyl Pyrroles As Hmg-Coa Reductase Inhibitors
 gi|166235472|pdb|3BGL|B Chain B, Hepatoselectivity Of Statins: Design And Synthesis Of 4-
           Sulfamoyl Pyrroles As Hmg-Coa Reductase Inhibitors
 gi|166235473|pdb|3BGL|C Chain C, Hepatoselectivity Of Statins: Design And Synthesis Of 4-
           Sulfamoyl Pyrroles As Hmg-Coa Reductase Inhibitors
 gi|166235474|pdb|3BGL|D Chain D, Hepatoselectivity Of Statins: Design And Synthesis Of 4-
           Sulfamoyl Pyrroles As Hmg-Coa Reductase Inhibitors
 gi|186972788|pdb|2R4F|A Chain A, Substituted Pyrazoles As Hepatselective Hmg-Coa Reductase
           Inhibitors
 gi|186972789|pdb|2R4F|B Chain B, Substituted Pyrazoles As Hepatselective Hmg-Coa Reductase
           Inhibitors
 gi|186972790|pdb|2R4F|C Chain C, Substituted Pyrazoles As Hepatselective Hmg-Coa Reductase
           Inhibitors
 gi|186972791|pdb|2R4F|D Chain D, Substituted Pyrazoles As Hepatselective Hmg-Coa Reductase
           Inhibitors
 gi|190613624|pdb|3CCT|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613625|pdb|3CCT|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613626|pdb|3CCT|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613627|pdb|3CCT|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613628|pdb|3CCW|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613629|pdb|3CCW|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613630|pdb|3CCW|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613631|pdb|3CCW|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613632|pdb|3CCZ|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613633|pdb|3CCZ|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613634|pdb|3CCZ|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613635|pdb|3CCZ|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613636|pdb|3CD0|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613637|pdb|3CD0|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613638|pdb|3CD0|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613639|pdb|3CD0|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613640|pdb|3CD5|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613641|pdb|3CD5|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613642|pdb|3CD5|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613643|pdb|3CD5|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613644|pdb|3CD7|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613645|pdb|3CD7|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613646|pdb|3CD7|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613647|pdb|3CD7|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613648|pdb|3CDA|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613649|pdb|3CDA|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613650|pdb|3CDA|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613651|pdb|3CDA|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613652|pdb|3CDB|A Chain A, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613653|pdb|3CDB|B Chain B, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613654|pdb|3CDB|C Chain C, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
 gi|190613655|pdb|3CDB|D Chain D, Thermodynamic And Structure Guided Design Of Statin
           Hmg-Coa Reductase Inhibitors
          Length = 441

 Score =  186 bits (471), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 189/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ +     + + +VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 97  IGYMPIPVGVAGPLCLD----EKEFQVPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 151

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 152 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 211

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 212 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 271

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 272 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 331

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 332 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 391

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 392 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 441


>gi|187884600|gb|ACD37361.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Salvia
           miltiorrhiza]
          Length = 565

 Score =  185 bits (470), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 186/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    L+ 
Sbjct: 216 VGYVQIPVGIAGPLLLNGC----EYSVPMATTEGCLVASTNRGCK-AIYASGGATCVLLR 270

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E  L    ++ V  ++S+F R   +   IAG  L++
Sbjct: 271 DAMTRAPVVRFSSAKRATELKFFLEDPLNFDTLSVVFNKSSRFARLQNVQCAIAGKNLYI 330

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK +A+N I GRGK+
Sbjct: 331 RFSCSTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNYCSDKKPSAVNWIEGRGKS 390

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   +  K L+T+   ++ LN  KNL G+ +AG +   NAH AN++ A ++ATG
Sbjct: 391 VVCEAVITADVVSKVLKTTVPSLVELNMLKNLTGSAIAGALGGFNAHAANIVSAIFIATG 450

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 451 QDPAQNIESSHCITMMEAINDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 510

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +   G NAR LA I A  VL GELSL++A  + G+L+++H++  R
Sbjct: 511 NKESPGSNARLLATIVAGAVLAGELSLMSA-ISAGQLVKSHMKYNR 555


>gi|304312867|ref|YP_003812465.1| Similar to hydroxymethylglutaryl-CoA reductase (NADPH) [gamma
           proteobacterium HdN1]
 gi|301798600|emb|CBL46830.1| Similar to hydroxymethylglutaryl-CoA reductase (NADPH) [gamma
           proteobacterium HdN1]
          Length = 398

 Score =  185 bits (470), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 118/321 (36%), Positives = 169/321 (52%), Gaps = 9/321 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ + G   Q +  +P+AT E  L  S  RG  ++     G+  T+ID+ M R
Sbjct: 67  VPLGLAGPVLVNGEHAQGEFYIPMATTEGTLVASYSRGMRLTREA-GGVTVTVIDDAMQR 125

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  ENA  A    + I+     I  V EQT+   +   +     G + +LR  + TG
Sbjct: 126 APVFAFENARFARDFGEWISENFPHIKAVAEQTTSAGKLRNIEQYALGKMRWLRFNYTTG 185

Query: 131 DASGHNMVTKAADAVMDWILSQW-SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEIT 189
           DA+G NMV+KA      WIL Q    L + S++ N  +DKK + +N +  RGK  VAEIT
Sbjct: 186 DAAGQNMVSKATRHACMWILDQSIPGLEHFSLAANFDTDKKHSFLNSLHTRGKRVVAEIT 245

Query: 190 INRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANI 249
           +  A+ +  + T+ E +       N+ G  LAG + +  AHFAN L A ++A GQD ANI
Sbjct: 246 LPAALLKDVMHTTGEALFKQRQLSNM-GAMLAGSVNNG-AHFANGLAAMFIACGQDVANI 303

Query: 250 VEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNA 308
            E S G  + +L  +   YFS TIP+LI+   G G  +P  +  L  LGC  +    D A
Sbjct: 304 AESSAGFVHGELKPNGDYYFSATIPSLIIATYGGGTGLPTQRECLDLLGCYGQ----DKA 359

Query: 309 RRLAAICAATVLCGELSLLAA 329
            + A I AA VLCGELSL +A
Sbjct: 360 LKFAEIAAAVVLCGELSLSSA 380


>gi|881303|gb|AAA68966.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Artemisia annua]
          Length = 560

 Score =  185 bits (470), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 189/345 (54%), Gaps = 16/345 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  A L+ + M
Sbjct: 212 VQVPVGVAGPLLLNGG----EFMVPMATTEGCLVASTNRGCK-AICLSGGATAILLKDGM 266

Query: 69  TRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+       AE A  L    E  +    ++ V  ++S+F R   +   IAG  L++R  
Sbjct: 267 TRAPVVRFATAERASQLKFYLEDGVNFDTLSVVFNKSSRFARLQNIQCSIAGKNLYIRFT 326

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V 
Sbjct: 327 CSTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVC 386

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH AN++ A ++ATGQD 
Sbjct: 387 EAVITEEVVRKVLKTTVPALVELNMLKNLTGSAIAGSLGGFNAHAANIVSAVFIATGQDP 446

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG----CIE 300
           A  +E S  +T  +  ++   L+ S T+P++ +G VG G  + +    L  LG    CIE
Sbjct: 447 AQNIESSHCITMMEAVNNGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGACIE 506

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               G NA+ LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 507 S--PGSNAQLLARIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 548


>gi|197097748|ref|NP_001126511.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pongo abelii]
 gi|83305798|sp|Q5R6N3|HMDH_PONAB RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|55731745|emb|CAH92577.1| hypothetical protein [Pongo abelii]
          Length = 888

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 188/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLRKLHTSIAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 AVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 826 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 875


>gi|254579184|ref|XP_002495578.1| ZYRO0B14696p [Zygosaccharomyces rouxii]
 gi|238938468|emb|CAR26645.1| ZYRO0B14696p [Zygosaccharomyces rouxii]
          Length = 1064

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 128/348 (36%), Positives = 184/348 (52%), Gaps = 14/348 (4%)

Query: 11   MPMRWIGPMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            MP+    P+ + G ++ D V   +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 692  MPL----PVGVIGPLVIDNVSYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 746

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   I F +     A     +    +A++ +    TS+F R   + + +AG+LLF+R  
Sbjct: 747  TRGPCIRFPSLARSGACKIWLDSEEGQAKVKKAFNSTSRFARLQHVQTALAGDLLFVRFR 806

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  I ++  W  +   SVSGN C+DKKA AIN I GRGK+ 
Sbjct: 807  TTTGDAMGMNMISKGVEFSLQQIANEFGWEDMEIVSVSGNYCTDKKAAAINWIEGRGKSV 866

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   I +K L++    ++ LN  KNL+G+ +AG I   NAH AN++ A +LA GQ
Sbjct: 867  VAEATIPGDIVRKVLKSDVSALVELNIAKNLVGSAMAGSIGGFNAHAANLVTAVFLALGQ 926

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VEGS  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 927  DPAQSVEGSSCMTLMKEIDGDLRISVSMPSIEVGTIGGGTILEPQGAMLDLLGVRGPHPT 986

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNG 350
              G NAR+LA I A  V+ GELSL AA    G L+++H+   R   N 
Sbjct: 987  EPGSNARQLARIVACAVMAGELSLCAALA-AGHLVQSHMTHNRGKTNA 1033


>gi|881917|gb|AAA68965.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Artemisia annua]
          Length = 566

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 189/345 (54%), Gaps = 16/345 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  A L+ + M
Sbjct: 218 VQVPVGVAGPLLLNGG----EFMVPMATTEGCLVASTNRGCK-AICLSGGATAILLKDGM 272

Query: 69  TRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+       AE A  L    E  +    ++ V  ++S+F R   +   IAG  L++R  
Sbjct: 273 TRAPVVRFATAERASQLKFYLEDGVNFDTLSVVFNKSSRFARLQNIQCSIAGKNLYIRFT 332

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V 
Sbjct: 333 CSTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVC 392

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH AN++ A ++ATGQD 
Sbjct: 393 EAVITEEVVRKVLKTTVPALVELNMLKNLTGSAIAGSLGGFNAHAANIVSAVFIATGQDP 452

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG----CIE 300
           A  +E S  +T  +  ++   L+ S T+P++ +G VG G  + +    L  LG    CIE
Sbjct: 453 AQNIESSHCITMMEAVNNGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGACIE 512

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               G NA+ LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 513 S--PGSNAQLLARIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 554


>gi|224177805|gb|ACN38874.1| 3-hydroxy-3-methylglutaryl CoA reductase [Linum usitatissimum]
          Length = 318

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 178/320 (55%), Gaps = 14/320 (4%)

Query: 32  VPLATYEYPLWHSVKRGA---HISMLCPDGIRATLIDERMTRS--IFFETENAEMALTAL 86
           VP+AT E  L  S  RG    H+S     G  + L+ + MTR+  + F T      L   
Sbjct: 2   VPMATTEGCLVASTNRGCKAIHLS----GGASSVLLKDGMTRAPVVRFATAKRAAYLKMY 57

Query: 87  QEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVM 146
            E  L    ++ V  ++S+F +   +   IAG  L+LR   +TGDA G NMV+K    V+
Sbjct: 58  LEDPLNFESLSLVFNKSSRFAKLQSVKCSIAGKNLYLRFCCSTGDAMGMNMVSKGVQNVL 117

Query: 147 DWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKI 206
           D++ + +S +    +SGN CSDKK  A+N I GRGK+ V E  I   + +K L+TS E +
Sbjct: 118 DFLQNDFSDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIKGEVVKKVLKTSVESL 177

Query: 207 ILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDD-- 264
           + LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD A  +E S  +T  +  +D  
Sbjct: 178 VELNMLKNLTGSAMAGALGGFNAHASNIVSAVYIATGQDPAQNIESSHCITMMEAVNDGL 237

Query: 265 SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGDNARRLAAICAATVLCG 322
            L+ S T+P++ +G VG G  + +    L  LG     +   G NAR LA I A +VL G
Sbjct: 238 DLHVSVTMPSIEVGTVGGGTQLASQAACLNLLGVKGASKETPGANARLLATIVAGSVLAG 297

Query: 323 ELSLLAAQTNPGELMEAHLR 342
           ELSL++A    G+L+++H++
Sbjct: 298 ELSLMSALA-AGQLVKSHMK 316


>gi|326431401|gb|EGD76971.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Salpingoeca sp.
           ATCC 50818]
          Length = 590

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 176/320 (55%), Gaps = 8/320 (2%)

Query: 31  KVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMA--LTALQE 88
           +VP+AT E  L  S  RG   ++   DG  + ++   MTR+      +   A  + A  E
Sbjct: 164 RVPMATTEGALLASTNRGCR-AITMSDGATSVILKNGMTRAPLVRVPSVAYAAEMKAWIE 222

Query: 89  ITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDW 148
               K  +      T++F R   +  +IAG  +++R     GDA G NMVTK     +  
Sbjct: 223 SPENKQALTNAFNSTTRFGRLQDIDVRIAGRNVYVRFACHCGDAMGMNMVTKGTVEALAL 282

Query: 149 ILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIIL 208
           +   +      ++SGN+CSDKKA AIN + GRG++ V E  + + + +  L T+ + +I 
Sbjct: 283 LNEHFPEAQMIALSGNVCSDKKAAAINWVEGRGRSVVCETILKKNVVENLLHTTVDDMIF 342

Query: 209 LNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYF 268
           +N  KNLIG+ +AG +   NAH AN++ A ++ATG D A ++E SQ +T  +   + L+ 
Sbjct: 343 VNQNKNLIGSAVAGSLGGFNAHAANIVAALFIATGNDPAQVIESSQCITVLEKEGEDLHM 402

Query: 269 SCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGDNARRLAAICAATVLCGELSL 326
           S ++P++ +G VG G ++PA    L  LGC       TG NA  LA + A++VL GE+SL
Sbjct: 403 SVSMPSIEIGTVGGGTSLPAQAAALKMLGCQGANREATGANADTLAHVVASSVLAGEISL 462

Query: 327 LAA-QTNPGELMEAHLRLER 345
           +AA  TN  +L++AH+ L R
Sbjct: 463 IAALATN--DLLKAHIDLNR 480


>gi|313236055|emb|CBY11381.1| unnamed protein product [Oikopleura dioica]
          Length = 625

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 117/321 (36%), Positives = 185/321 (57%), Gaps = 10/321 (3%)

Query: 18  PMKITGNVIQDKVKVP--LATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ I G ++ D ++    LAT E  L  SV RG  +  +   G + ++  + M+R+    
Sbjct: 268 PLGIVGPILVDGIECSPLLATTEGALLASVNRGCKVIKIS-GGAKTSIFRDEMSRAPCIS 326

Query: 76  TENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDAS 133
             +A  AL   Q  E       I    + T++F + L++    AG LLFLR   +TGDA 
Sbjct: 327 FPSAAAALECFQWLEDPYNFTIIKDAFQSTTRFGKLLKVTPYPAGRLLFLRFSASTGDAM 386

Query: 134 GHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRA 193
           G NMV+K  +  +D +L  +      S+SGN C+DKK +A+N I GRGK  +AE++I   
Sbjct: 387 GMNMVSKGTNKAVDTLLQLFPSARIESISGNACTDKKPSAMNWINGRGKTIIAEVSIPEK 446

Query: 194 ICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGS 253
           +     + + +++  LN +KNLIG+ +AG I   NAH AN++ A ++A+GQDAA +VEGS
Sbjct: 447 VLTANFKCTAKQLADLNVKKNLIGSNVAGSIGGFNAHAANIVAACFIASGQDAAQVVEGS 506

Query: 254 QGLT-YAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTAL-GCIEERKTGDNA 308
           Q +T + +   DS   L+ S T+P+L +  +G G N+   ++ LT++ G       GD +
Sbjct: 507 QTMTLFEERVLDSETFLHASVTMPSLEVAAMGGGTNLEPQRSILTSMIGQEAGLNPGDKS 566

Query: 309 RRLAAICAATVLCGELSLLAA 329
           RRLA++ A+TVL GELSL+++
Sbjct: 567 RRLASVIASTVLAGELSLMSS 587


>gi|147920521|ref|YP_685685.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [uncultured
           methanogenic archaeon RC-I]
 gi|110621081|emb|CAJ36359.1| 3-hydroxy-3-methylglutaryl-coenzyme a reductase (hmg-coa reductase)
           [uncultured methanogenic archaeon RC-I]
          Length = 408

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/363 (34%), Positives = 191/363 (52%), Gaps = 45/363 (12%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP++I G   Q    +PLAT E  L  SV RG  +  L   G+   +  
Sbjct: 68  IGAVQVPVGVAGPIRINGEYAQGNFYIPLATTEGALVASVNRGCSVCTLA-GGVNTVVFQ 126

Query: 66  ERMTRSIFFETEN---AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           + MTR+     ++   A+  + AL+   L  AEI  V+  T++    L++   + G  +F
Sbjct: 127 DEMTRAPVMTVQSLAQAKEIMAALKTPELM-AEIRAVVATTTRHGELLRVDPYVVGKSVF 185

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           LR  + T DA G NMVT A++AVM+++  ++    + +VS N+C+DKK  AIN   GRG+
Sbjct: 186 LRFAYDTKDAMGMNMVTIASEAVMNFLEKKFPGTRHVTVSSNMCTDKKPAAINVTEGRGR 245

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
             VAEITI + I    L+ +PE+I  ++ +KN +G+  A      N+H AN++ A Y+A 
Sbjct: 246 TTVAEITIPKDIVASKLKATPERICYVHYRKNFLGSARAVSF-GFNSHVANVVAAMYIAC 304

Query: 243 GQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNL-------------------ILGCVGN 282
           GQD A++VEGS  +T A+L ++  L FS ++P+L                   +LG  G 
Sbjct: 305 GQDPAHVVEGSNAITSAELTENGDLQFSVSMPSLPLGTVGGGTGLCTQAECLNLLGVRGG 364

Query: 283 GKNIPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLR 342
           G N P                 G NAR+LA I A+  L GELSL+ AQ +  +L  AH +
Sbjct: 365 G-NPP-----------------GSNARKLAEIVASASLAGELSLIGAQAS-HDLARAHAK 405

Query: 343 LER 345
             R
Sbjct: 406 YGR 408


>gi|66826269|ref|XP_646489.1| hmg CoA reductase A [Dictyostelium discoideum AX4]
 gi|462287|sp|P34135|HMDH1_DICDI RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 1;
           Short=HMG-CoA reductase 1
 gi|304594|gb|AAA33214.1| hydroxymethylglutaryl CoA reductase [Dictyostelium discoideum]
 gi|60473984|gb|EAL71921.1| hmg CoA reductase A [Dictyostelium discoideum AX4]
          Length = 552

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 195/348 (56%), Gaps = 14/348 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+++ G +    V +P+AT E  L  S  RG   ++    G + T+    M
Sbjct: 212 VPIPVGTAGPIQLNGQL----VTIPMATTEGCLVASTHRGCK-AITESGGAKCTITSRGM 266

Query: 69  TRSI---FFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           TR+    F +   A   ++ + +    +A +  V + TS+F R   +   IAG  +++R 
Sbjct: 267 TRAPVVRFSDIVKASEFVSWINDTDNYQA-LKAVFDSTSRFARLSAIKCTIAGRSVYIRF 325

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           +  TGDA G NMV+K  +AV++ +   +  +   S+SGN+C+DKK ++IN   GRG++ V
Sbjct: 326 KCDTGDAMGMNMVSKGVEAVLEHLKIIFDDMTLLSISGNMCTDKKPSSINWTEGRGRSVV 385

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + Q+ L+T+ + ++ LN  KNLIG+ +AG I   NAH +N++ A +LATGQD
Sbjct: 386 CEAMITGDVVQRVLKTNVQALVDLNIAKNLIGSAMAGSIGGFNAHASNIVTAIFLATGQD 445

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   LY + T+P++ +G VG G ++PA    L  +G      
Sbjct: 446 CAQNVESSNCITQMEACNDGQDLYITVTMPSIEVGTVGGGTSLPAQSACLDIIGVKGSSS 505

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
            K G NA +LA   A+ V+ GELSL++A +  G LM++HL+  R   N
Sbjct: 506 SKPGANADQLAKTIASAVMAGELSLMSALS-AGHLMKSHLQYNRAKTN 552


>gi|313358182|gb|ADR51242.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Coffea arabica]
          Length = 604

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 118/344 (34%), Positives = 190/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   +++   G  + L+ + 
Sbjct: 253 MPVGYVQLPVGIAGPLLLDGREYMVPMATTEGCLVASTNRGCK-AIMASGGATSMLLRDG 311

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  +    ++ V  ++S+F R   +   IAG  L++R 
Sbjct: 312 MTRAPVVRFATAKRAAELKFFVEEPMNFETLSVVFNKSSRFARLQSIQCAIAGKNLYMRF 371

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +    +SGN C+DKK  A+N I GRGK+ V
Sbjct: 372 SCSTGDAMGMNMVSKGVQNVLDYLQTDFPDMDVIGLSGNFCADKKPAAVNWIEGRGKSVV 431

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   I +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 432 CEAIIKEEIVKKVLKTEVAALVELNMLKNLTGSAMAGSLGGFNAHASNIVSAVYIATGQD 491

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKN--NLTALGCIEE 301
            A  VE S  +T  +  +D   L+ S ++P++ +G VG G  + +     NL  +    +
Sbjct: 492 PAQNVESSHCITMMEAVNDGKDLHVSVSMPSIEVGTVGGGTKLASQSACLNLLRVKGANK 551

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            + G NAR LA + A +VL GELSL++A  + G+L+ +H++  R
Sbjct: 552 EEAGANARLLATVVAGSVLAGELSLMSA-ISAGQLVSSHMKYNR 594


>gi|89074240|ref|ZP_01160730.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Photobacterium sp.
           SKA34]
 gi|89049944|gb|EAR55478.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Photobacterium sp.
           SKA34]
          Length = 421

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 122/342 (35%), Positives = 190/342 (55%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + S+ +P+   GP+K+ G     +  VPLAT E  L  S  RGA + +    G  A L++
Sbjct: 86  IGSVKLPLGVAGPLKVNGLFASGEYFVPLATTEAALVASYHRGA-LLISEAGGASAILLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  ++   A   +  +T +      + E T+++ +   ++  + GN ++L  
Sbjct: 145 EGVTRAPGFAFDSLVQASKFITWVTTQYDTFKTIAESTTRYGKLSDINLSMEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT + +AV ++IL+        + +  N+  DKKATA      RGK  
Sbjct: 205 EYLTGDASGQNMVTISTNAVFEYILANTPIKPVEAFLDCNLSGDKKATAQTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++R + +KYL T+PEK++    +   +G  L+G I   NAH+AN L A+Y+A GQ
Sbjct: 265 TAEVHLSRELVKKYLHTTPEKMVDFG-KMTTVGGALSGTI-GVNAHYANALAAFYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E S G+T  +L   D L  S T+PNL++G VG G ++P+ K  L  LG     +
Sbjct: 323 DAACVAESSVGITRMELNQQDGLCVSVTLPNLMIGTVGGGTHLPSQKACLELLGLYGSGQ 382

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +    + LA +CAA  L GELS++ A  + G   +AH RL R
Sbjct: 383 S----QALAEVCAALCLAGELSIIGAFCS-GHFAKAHHRLAR 419


>gi|27366573|ref|NP_762100.1| hydroxymethylglutaryl-CoA reductase [Vibrio vulnificus CMCP6]
 gi|27358139|gb|AAO07090.1|AE016808_110 Hydroxymethylglutaryl-CoA reductase [Vibrio vulnificus CMCP6]
          Length = 419

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V ++ +P+   GP+++ G    D   +PLAT E  L  S  RGA++ +    G  A L++
Sbjct: 86  VGTVKVPVGLAGPLRVNGLFASDDYLIPLATTEAALVASYSRGANL-ITAAGGATAMLVN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   N   A   +  +T       ++ E T+       ++  + GN ++L  
Sbjct: 145 EGVTRTPVFAFTNLVSAGQFVAWVTTHYERFKQIAESTTSHGTLSDININMEGNHVYLMF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSY-LHYGSVSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A +AV   IL      +    + GN+  DKKA +      RGK  
Sbjct: 205 EYQTGDASGQNMVTIATNAVFQSILETCPIDIKEAFLDGNLSGDKKANSKTLTSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           +AE+T++R + +KYL T+PEK++    Q    G  L+GGI   NAH+AN L A YLA GQ
Sbjct: 265 IAEVTLSREMVEKYLHTTPEKMVKFG-QMTTTGAALSGGI-GVNAHYANALTALYLACGQ 322

Query: 245 DAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L  D  LY S T+PNL++G VG G  +P+ K  L  LG   +  
Sbjct: 323 DAACVAESAIGITRMELTADGHLYASVTLPNLMVGTVGGGTGLPSQKACLDILGLYGQ-- 380

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              NAR LA +CAA  L GELS++ A    G    AH +L R
Sbjct: 381 --GNARALAEVCAALCLAGELSIVGAFA-AGHFSRAHHKLAR 419


>gi|145591032|ref|YP_001153034.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Pyrobaculum
           arsenaticum DSM 13514]
 gi|145282800|gb|ABP50382.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pyrobaculum
           arsenaticum DSM 13514]
          Length = 398

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/341 (36%), Positives = 189/341 (55%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ + G+       VPLAT E  L  SV RGA + +    G RA ++ 
Sbjct: 59  IGAVQIPVGVAGPLLVRGDYANGYFYVPLATTEGALVASVNRGAKL-VTESGGARAKVLK 117

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + M R+  F+  +   A+  +  +     E+ +  E T++  R  ++   + GN ++LR+
Sbjct: 118 DGMARAPLFKLPSLVDAVEFVNWVMQHFEEVKKAAESTTRHGRLKEIQPFVVGNYVWLRM 177

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F+TGDA G NM T AADA   +I  ++      ++SGN+C DKK  ++N ++GRGK  V
Sbjct: 178 VFSTGDAMGMNMATIAADAAARYIQEEFPKARLVALSGNMCVDKKPNSVNFLLGRGKTVV 237

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I R   +K L T+PE +  +N  KNL+G+ LA      NAHFAN++ A ++ATGQD
Sbjct: 238 AEALIRREQLEK-LGTTPEAVHEVNISKNLVGSALAHSY-GFNAHFANIITAVFIATGQD 295

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A +VE S G+T  +  ++ LY S  +P+L +G VG G  +P  +  L  LG        
Sbjct: 296 VAQVVESSMGITTTEPREEGLYISVFLPSLEVGTVGGGTGLPTQREALELLGVAGPGNPP 355

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA + A I AA VL GEL+LL A     EL  AH +L R
Sbjct: 356 GTNALKFAEIIAAAVLAGELNLLVALAR-NELASAHKKLGR 395


>gi|255546682|ref|XP_002514400.1| hmg-CoA reductase, putative [Ricinus communis]
 gi|223546497|gb|EEF47996.1| hmg-CoA reductase, putative [Ricinus communis]
          Length = 586

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/347 (36%), Positives = 189/347 (54%), Gaps = 17/347 (4%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG    H+S     G  + L+
Sbjct: 233 MPIGYVQIPVGIAGPLLLDGKEYSVPMATTEGCLVASTNRGCKAIHLS----GGATSVLL 288

Query: 65  DERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            + MTR+  + F T      L    E       I+    ++S+F R   +   IAG  L+
Sbjct: 289 RDGMTRAPVVRFGTAKRAAQLKLYLEDPSNFDVISSAFNKSSRFGRLQNIKCAIAGKNLY 348

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           LR   +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK
Sbjct: 349 LRFCCSTGDAMGMNMVSKGVQNVLDFLQNHFPDMDVIGISGNFCSDKKPAAVNWIEGRGK 408

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + V E  I   + +K L+TS E ++ LN  KNL G+ +AG +   NAH +N++ A Y+AT
Sbjct: 409 SVVCEAIIKGNMVKKVLKTSVEALVELNMLKNLTGSAMAGALGGFNAHASNIVTAVYIAT 468

Query: 243 GQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           GQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG   
Sbjct: 469 GQDPAQNVESSHCITMMEAVNDGQDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKG 528

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +   G N+R LA+I A +VL GELSL+AA    G+L+ +H++  R
Sbjct: 529 ASKETPGANSRLLASIVAGSVLAGELSLMAALA-AGQLVRSHMKYNR 574


>gi|320158461|ref|YP_004190839.1| hydroxymethylglutaryl-CoA reductase [Vibrio vulnificus MO6-24/O]
 gi|319933773|gb|ADV88636.1| hydroxymethylglutaryl-CoA reductase [Vibrio vulnificus MO6-24/O]
          Length = 419

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V ++ +P+   GP+++ G    D   +PLAT E  L  S  RGA++ +    G  A L++
Sbjct: 86  VGTVKVPVGLAGPLRVNGLFASDDYLIPLATTEAALVASYSRGANL-ITAAGGATAMLVN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   N   A   +  +T       ++ E T+       ++  + GN ++L  
Sbjct: 145 EGVTRTPVFAFTNLVSAGQFVAWVTTHYERFKQIAESTTSHGTLSDININMEGNHVYLMF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSY-LHYGSVSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A +AV   IL      +    + GN+  DKKA +      RGK  
Sbjct: 205 EYQTGDASGQNMVTIATNAVFQSILETCPIDIKEAFLDGNLSGDKKANSKTLTSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           +AE+T++R + +KYL T+PEK++    Q    G  L+GGI   NAH+AN L A YLA GQ
Sbjct: 265 IAEVTLSREMVEKYLHTTPEKMVKFG-QMTTTGAALSGGI-GVNAHYANALTALYLACGQ 322

Query: 245 DAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L  D  LY S T+PNL++G VG G  +P+ K  L  LG   +  
Sbjct: 323 DAACVAESAIGITRMELTADGHLYASVTLPNLMVGTVGGGTGLPSQKACLDILGLYGQ-- 380

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              NAR LA +CAA  L GELS++ A    G    AH +L R
Sbjct: 381 --GNARALAEVCAALCLAGELSIVGAFA-AGHFSRAHHKLAR 419


>gi|109077611|ref|XP_001104607.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase isoform
           5 [Macaca mulatta]
          Length = 888

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 188/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ + +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTDAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 826 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 875


>gi|37676285|ref|NP_936681.1| hydroxymethylglutaryl-CoA reductase [Vibrio vulnificus YJ016]
 gi|37200826|dbj|BAC96651.1| hydroxymethylglutaryl-CoA reductase [Vibrio vulnificus YJ016]
          Length = 419

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 128/342 (37%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V ++ +P+   GP+++ G    D   +PLAT E  L  S  RGA++ +    G  A L++
Sbjct: 86  VGTVKVPVGLAGPLRVNGLFASDDYLIPLATTEAALVASYSRGANL-ITAAGGATAMLVN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   N   A   +  +T       ++ E T+       ++  + GN ++L  
Sbjct: 145 EGVTRTPVFAFTNLVSAGQFVAWVTTHYERFKQIAESTTSHGTLSDININMEGNHVYLMF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSY-LHYGSVSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A +AV   IL      +    + GN+  DKKA +      RGK  
Sbjct: 205 EYQTGDASGQNMVTIATNAVFQSILETSPIDIKEAFLDGNLSGDKKANSKTLTSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           +AE+T++R + +KYL T+PEK++    Q    G  L+GGI   NAH+AN L A YLA GQ
Sbjct: 265 IAEVTLSREMVEKYLHTTPEKMVKFG-QMTTTGAALSGGI-GVNAHYANALTALYLACGQ 322

Query: 245 DAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L  D  LY S T+PNL++G VG G  +P+ K  L  LG   +  
Sbjct: 323 DAACVAESAIGITRMELTADGHLYASVTLPNLMVGTVGGGTGLPSQKACLDILGLYGQ-- 380

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              NAR LA +CAA  L GELS++ A    G    AH +L R
Sbjct: 381 --GNARALAEVCAALCLAGELSIVGAFA-AGHFSRAHHKLAR 419


>gi|123335|sp|P29057|HMDH1_HEVBR RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 1;
           Short=HMG-CoA reductase 1
 gi|16417954|gb|AAL18929.1|AF429388_1 hydroxymethylglutaryl coenzyme A reductase [Hevea brasiliensis]
 gi|18833|emb|CAA38467.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
 gi|18835|emb|CAA38469.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
 gi|34223773|gb|AAQ63055.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hevea
           brasiliensis]
          Length = 575

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 187/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ 
Sbjct: 226 VGYVQIPVGIAGPLLLNGR----EYSVPMATTEGCLVASTNRGCK-AIYLSGGATSVLLK 280

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E       +A V  ++S+F R   +   IAG  L++
Sbjct: 281 DGMTRAPVVRFASATRAAELKFFLEDPDNFDTLAVVFNKSSRFARLQGIKCSIAGKNLYI 340

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V++++ S +S +    +SGN CSDKK  A+N I GRGK+
Sbjct: 341 RFSCSTGDAMGMNMVSKGVQNVLEFLQSDFSDMDVIGISGNFCSDKKPAAVNWIEGRGKS 400

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH  N++ A ++ATG
Sbjct: 401 VVCEAIIKEEVVKKVLKTNVASLVELNMLKNLAGSAVAGALGGFNAHAGNIVSAIFIATG 460

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 461 QDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 520

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +   G N+R LAAI A +VL GELSL++A    G+L+++H++  R
Sbjct: 521 NKESPGSNSRLLAAIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 565


>gi|115477250|ref|NP_001062221.1| Os08g0512700 [Oryza sativa Japonica Group]
 gi|113624190|dbj|BAF24135.1| Os08g0512700 [Oryza sativa Japonica Group]
          Length = 419

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 186/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 70  VGYVQLPVGIAGPLLLDGQ----RFYVPMATTEGCLVASTNRGCK-AIAESGGAVSVVLR 124

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+       A  A  L A  E ++    ++ V  ++S+F R   +   +AG  L++
Sbjct: 125 DGMTRAPVARLPTARRAAELKAFLEDSVNFNTLSMVFNRSSRFARLQGVQCAMAGRNLYM 184

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK  A+N I GRGK+
Sbjct: 185 RFSCCTGDAMGMNMVSKGVQNVLDYLQDDFPDMDVISISGNFCSDKKPAAVNWIEGRGKS 244

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 245 VVCEAVIKEDVVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 304

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 305 QDPAQNVESSHCITMLEAVNDGRDLHISVTMPSIEVGTVGGGTQLASQAACLDLLGVKGA 364

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A  VL GELSLL+A    G+L+++H++  R
Sbjct: 365 NRESPGSNARLLATVVAGGVLAGELSLLSALA-AGQLVKSHMKYNR 409


>gi|242082237|ref|XP_002445887.1| hypothetical protein SORBIDRAFT_07g027480 [Sorghum bicolor]
 gi|241942237|gb|EES15382.1| hypothetical protein SORBIDRAFT_07g027480 [Sorghum bicolor]
          Length = 576

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 187/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 227 VGYVQVPVGIAGPLLLDGQ----RFYVPMATTEGCLVASTNRGCK-AIAESGGATSVVLR 281

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+       A  A  L A  E       ++ V  ++S+F R   +   +AG  L++
Sbjct: 282 DGMTRAPVARLPTARRAAELKAFLEDPANFDTLSLVFNRSSRFARLQGVQCAMAGRNLYM 341

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK  A+N I GRGK+
Sbjct: 342 RFSCSTGDAMGMNMVSKGVQNVLDFLQDDFPDMDVISISGNFCSDKKPAAVNWIEGRGKS 401

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LNT KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 402 VVCEAVIKEDVVKKVLKTNVQSLVELNTIKNLAGSAIAGALGGFNAHASNIVTAIFIATG 461

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 462 QDPAQNVESSHCITMLEPINDGKDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGA 521

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +   G NAR LA + A  VL GELSLL+A    G+L+++H++  R
Sbjct: 522 NQDSPGSNARLLATVVAGGVLAGELSLLSALAA-GQLVKSHMKYNR 566


>gi|297294551|ref|XP_002804463.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Macaca
           mulatta]
          Length = 908

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 188/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 551 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 605

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 606 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 665

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 666 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 725

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ + +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 726 VVCEAVIPAKVVREVLKTTTDAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 785

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 786 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 845

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 846 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 895


>gi|257781218|gb|ACV65036.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax
           quinquefolius]
          Length = 589

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 118/344 (34%), Positives = 191/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ ++ +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 238 MPVGYVQIPVGIAGPLLLNETEYSVPMATTEGCLVASTNRGCK-AIYASGGATSVLLRDG 296

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F +      L    E  +    +A V  ++S+F R   +   IAG  L++R 
Sbjct: 297 MTRAPVVRFGSAKRAAELKFFLEDPMNFETLALVFNKSSRFGRLQGIKCAIAGKNLYMRF 356

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 357 TCSTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVMGISGNYCSDKKPAAVNWIEGRGKSVV 416

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 417 CEAIIKEEVVKKVLKTNVAALVELNMLKNLAGSAVAGALGGFNAHASNIVSAVYIATGQD 476

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 477 PAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 536

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA+I A +VL GELSL++A    G+L+++H++  R
Sbjct: 537 ESPGSNSRLLASIVAGSVLAGELSLMSALA-AGQLVKSHMKFNR 579


>gi|144952796|gb|ABP04052.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Corylus avellana]
          Length = 567

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 127/348 (36%), Positives = 190/348 (54%), Gaps = 19/348 (5%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG    H+S     G  A L+
Sbjct: 216 MPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIHLS----GGATAVLL 271

Query: 65  DERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            + MTR+  + F T      L    E       ++ V  ++S+F R   +   IAG  L+
Sbjct: 272 KDGMTRAPVVRFATAQRAAELKFFLEDPKNFDTLSMVFNRSSRFARLQTIKCAIAGKNLY 331

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R   +TGDA G NM++K    ++D++   +S +    +SGN CSDKK  A+N I GRGK
Sbjct: 332 IRFCCSTGDAMGMNMISKGVQNILDFLQKDFSDMDVIGLSGNFCSDKKPAAVNWIEGRGK 391

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + V E  I+  + +K L+T+   ++ LN  KNL G+ LAG     NAH +N++ A Y+AT
Sbjct: 392 SVVCEALISGDVVRKVLKTNVAALVELNMLKNLAGSALAGAPGGFNAHASNIVTAIYIAT 451

Query: 243 GQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNI---PAIKNNLTALG 297
           GQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  +   PA  N L   G
Sbjct: 452 GQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQPACLNLLGVKG 511

Query: 298 CIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              E + G NAR LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 512 ANRE-EPGSNARLLATIVAGSVLAGELSLMSALAA-GQLVRSHMKYNR 557


>gi|5059025|gb|AAD38873.1|AF110382_1 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Oryza sativa]
          Length = 560

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 186/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 211 VGYVQLPVGIAGPLLLDGQ----RFYVPMATTEGCLVASTNRGCK-AIAESGGAVSVVLR 265

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+       A  A  L A  E ++    ++ V  ++S+F R   +   +AG  L++
Sbjct: 266 DGMTRAPVARLPTARRAAELKAFLEDSVNFNTLSMVFNRSSRFARLQGVQCAMAGRNLYM 325

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK  A+N I GRGK+
Sbjct: 326 RFSCCTGDAMGMNMVSKGEQNVLDYLQDDFPDMDVISISGNFCSDKKPAAVNWIEGRGKS 385

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 386 VVCEAVIKEDVVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 445

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 446 QDPAQNVESSHCITMLEAVNDGRDLHISVTMPSIEVGTVGGGTQLASQAACLDLLGVKGA 505

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A  VL GELSLL+A    G+L+++H++  R
Sbjct: 506 NRESPGSNARLLATVVAGGVLAGELSLLSA-LRAGQLVKSHMKYNR 550


>gi|45383193|ref|NP_989816.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Gallus gallus]
 gi|38229052|dbj|BAD01519.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Gallus gallus]
          Length = 875

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 191/344 (55%), Gaps = 17/344 (4%)

Query: 18  PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ + G +  D  + +VP+AT E  L  S  RG   ++    G R+ ++ + MTR     
Sbjct: 524 PVGVAGPLYLDNKEFQVPMATTEGCLVASTNRGCR-AICLGGGARSRILADGMTRGPVVR 582

Query: 76  TENAEMALTALQEITLKKAEIARVIEQ----TSQFTRFLQLHSQIAGNLLFLRLEFATGD 131
             +A  A  A  +  L+  E  +++++    TS+F R  +L   +AG  L++R +  TGD
Sbjct: 583 LPSACQA--AEVKAWLESPEGFKIVKEAFDSTSRFARLQKLLISLAGRNLYIRFQSKTGD 640

Query: 132 ASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITIN 191
           A G NM +K  +  +  +  ++  L   ++SGN C+DKK  AIN I GRGK+ V E  I 
Sbjct: 641 AMGMNMTSKGTEKALARLNEEFPDLQVIAISGNYCTDKKPAAINWIEGRGKSVVCEAVIP 700

Query: 192 RAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVE 251
             + ++ L+T+ E I+ +N  KNL+G+ +AG I   NAH AN++ A Y+A GQDAA  V 
Sbjct: 701 AKVVKEVLKTTTEDIVEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVG 760

Query: 252 GSQGLT----YAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTG 305
            S  +T    Y    +D LY SCT+P++ +G VG G N+   +  L  LG     +   G
Sbjct: 761 SSNCITLMEAYCSTSED-LYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGASQDNPG 819

Query: 306 DNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
           +NAR+LA I  ATV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 820 ENARQLAKIVCATVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 862


>gi|94730390|sp|Q9XHL5|HMDH3_ORYSJ RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 3;
           Short=HMG-CoA reductase 3
 gi|42408805|dbj|BAD10066.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 [Oryza sativa
           Japonica Group]
          Length = 561

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 186/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 212 VGYVQLPVGIAGPLLLDGQ----RFYVPMATTEGCLVASTNRGCK-AIAESGGAVSVVLR 266

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+       A  A  L A  E ++    ++ V  ++S+F R   +   +AG  L++
Sbjct: 267 DGMTRAPVARLPTARRAAELKAFLEDSVNFNTLSMVFNRSSRFARLQGVQCAMAGRNLYM 326

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK  A+N I GRGK+
Sbjct: 327 RFSCCTGDAMGMNMVSKGVQNVLDYLQDDFPDMDVISISGNFCSDKKPAAVNWIEGRGKS 386

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 387 VVCEAVIKEDVVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 446

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 447 QDPAQNVESSHCITMLEAVNDGRDLHISVTMPSIEVGTVGGGTQLASQAACLDLLGVKGA 506

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A  VL GELSLL+A    G+L+++H++  R
Sbjct: 507 NRESPGSNARLLATVVAGGVLAGELSLLSALA-AGQLVKSHMKYNR 551


>gi|2495262|sp|Q29512|HMDH_RABIT RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
          Length = 888

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 186/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+  +GP+ + G   Q    VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 531 IGYMPIPVGVVGPLCLDGKEFQ----VPMATTEGCLVASTNRGCR-AICLGGGASSRVLA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E     A I    + TS+F R  +LH  +AG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETPEGFAVIKEAFDSTSRFARLQKLHISMAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +   +  +   +VSGN C+DKK  A+N I GRGK 
Sbjct: 646 RFQSRTGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAVNWIEGRGKT 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN + A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIDVNINKNLVGSAMAGSIGGYNAHAANYVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPPNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 826 ACKDSPGENARQLARIVCGTVMAGELSLMAALAA-GHLVKSHMIHNRSKIN 875


>gi|332233857|ref|XP_003266121.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase isoform
           1 [Nomascus leucogenys]
          Length = 888

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 187/351 (53%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +     I    + TS+F R  +LH+ IAG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETSEGFTVIKEAFDSTSRFARLQKLHTSIAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 826 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 875


>gi|321259666|ref|XP_003194553.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Cryptococcus gattii
            WM276]
 gi|317461025|gb|ADV22766.1| Hydroxymethylglutaryl-CoA reductase (NADPH), putative [Cryptococcus
            gattii WM276]
          Length = 1288

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/346 (35%), Positives = 183/346 (52%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GP+ I G ++     +P+AT E  L  S  RG   ++    G+   L  
Sbjct: 914  VGYLPIPVGIAGPLNIDGQLLH----IPMATTEGTLVASTSRGCK-ALNVGGGVTTVLTH 968

Query: 66   ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR    +  N   A  A   I      A +    E TS+F +   L   +AG  L++
Sbjct: 969  DAMTRGPAIDFPNIVQASQARLWIDSPDGYATLKTAFESTSRFAKLQTLECALAGRTLYV 1028

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
            R    TGDA G NM++K  +  ++ +   +  +H  ++SGN C+DKK  AIN I GRGK+
Sbjct: 1029 RFATQTGDAMGMNMISKGVEKALEVLRDHFPDMHVLALSGNYCTDKKPAAINWIEGRGKS 1088

Query: 184  FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
             VAE  +   + +  L+T+ + +  LN +KNLIG+ +AG I   NAH AN+L A YLA G
Sbjct: 1089 VVAEAVVPGHVVKSVLKTTVKDLCNLNIKKNLIGSAMAGSIGGFNAHAANILTAMYLACG 1148

Query: 244  QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            QD A  VE S  +T  +  +D   L  SC++P++ +G VG G  +   +  L  LG    
Sbjct: 1149 QDPAQNVESSNCMTLMEPINDGEDLLISCSMPSVEVGTVGGGTILSPQRAMLDMLGVAGA 1208

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  G NA+RLA I  A V+ GELSL++A    G L++AH++  R
Sbjct: 1209 HATTPGANAQRLARIIVAAVMAGELSLMSALAA-GHLIQAHMKHNR 1253


>gi|222640854|gb|EEE68986.1| hypothetical protein OsJ_27912 [Oryza sativa Japonica Group]
          Length = 608

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 186/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 213 VGYVQLPVGIAGPLLLDGQ----RFYVPMATTEGCLVASTNRGCK-AIAESGGAVSVVLR 267

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+       A  A  L A  E ++    ++ V  ++S+F R   +   +AG  L++
Sbjct: 268 DGMTRAPVARLPTARRAAELKAFLEDSVNFNTLSMVFNRSSRFARLQGVQCAMAGRNLYM 327

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK  A+N I GRGK+
Sbjct: 328 RFSCCTGDAMGMNMVSKGVQNVLDYLQDDFPDMDVISISGNFCSDKKPAAVNWIEGRGKS 387

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 388 VVCEAVIKEDVVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 447

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 448 QDPAQNVESSHCITMLEAVNDGRDLHISVTMPSIEVGTVGGGTQLASQAACLDLLGVKGA 507

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A  VL GELSLL+A    G+L+++H++  R
Sbjct: 508 NRESPGSNARLLATVVAGGVLAGELSLLSALA-AGQLVKSHMKYNR 552


>gi|218201443|gb|EEC83870.1| hypothetical protein OsI_29857 [Oryza sativa Indica Group]
          Length = 536

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 186/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 187 VGYVQLPVGIAGPLLLDGQ----RFYVPMATTEGCLVASTNRGCK-AIAESGGAVSVVLR 241

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+       A  A  L A  E ++    ++ V  ++S+F R   +   +AG  L++
Sbjct: 242 DGMTRAPVARLPTARRAAELKAFLEDSVNFNTLSMVFNRSSRFARLQGVQCAMAGRNLYM 301

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK  A+N I GRGK+
Sbjct: 302 RFSCCTGDAMGMNMVSKGVQNVLDYLQDDFPDMDVISISGNFCSDKKPAAVNWIEGRGKS 361

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 362 VVCEAVIKEDVVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 421

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 422 QDPAQNVESSHCITMLEAVNDGRDLHISVTMPSIEVGTVGGGTQLASQAACLDLLGVKGA 481

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A  VL GELSLL+A    G+L+++H++  R
Sbjct: 482 NRESPGSNARLLATVVAGGVLAGELSLLSALA-AGQLVKSHMKYNR 526


>gi|170112212|ref|XP_001887308.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164637634|gb|EDR01917.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 978

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 186/350 (53%), Gaps = 12/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  I +P+   GP+ + G +      +P+AT E  L  S  RG   ++    G+   ++ 
Sbjct: 628 VGYIPIPLGIAGPLNVDGTLY----PIPMATAEGTLVASTSRGCK-ALNAGGGVTTVVVQ 682

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR    +  N  MA  A   I  ++    I    E TS+F +   L + +AG  LF+
Sbjct: 683 DAMTRGPAIDFPNIVMASEAKAWIASEEGYNAIKTAFESTSRFAKLKSLKTAMAGRTLFV 742

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   ATGDA G NM++K  +  ++ +   +  +   ++SGN C+DKK  AIN I GRGK+
Sbjct: 743 RFATATGDAMGMNMISKGTEKGLEVMQKHFPEMVVLALSGNYCTDKKPAAINWIEGRGKS 802

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            VAE  I   + +  L+T+ E +  LNT+KNL+G+ +AG I   NAH AN+L A +LATG
Sbjct: 803 VVAEAVIPGKVVKTVLKTTVEALCNLNTKKNLVGSAMAGSIGGFNAHAANILTAMFLATG 862

Query: 244 QDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           QD A  VE S  +T  +  +  + L  + T+P++ +G VG G  +   +  L  LG    
Sbjct: 863 QDPAQNVESSNCMTLMEPVNKGEDLLMTITMPSIEVGTVGGGTVLAPQQGVLALLGMKGA 922

Query: 302 RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             T  G NA+ LA + AA V+ GELSLL+A    G L+ AH+   R   N
Sbjct: 923 HPTAPGQNAQALARLIAAAVMAGELSLLSALAA-GHLIRAHMAHNRSQTN 971


>gi|158259245|dbj|BAF85581.1| unnamed protein product [Homo sapiens]
          Length = 888

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 185/341 (54%), Gaps = 11/341 (3%)

Query: 18  PMKITGNVIQDK--VKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ + G +  D+   +VP+AT E  L  S  RG     L   G  + ++ + MTR     
Sbjct: 537 PVGVAGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGL-GGGASSRVLADGMTRGPVVR 595

Query: 76  TENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDAS 133
              A     + A  E +   A I    + TS+F R  +LH+ IAG  L++R +  +GDA 
Sbjct: 596 LPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAM 655

Query: 134 GHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRA 193
           G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+ V E  I   
Sbjct: 656 GMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAK 715

Query: 194 ICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGS 253
           + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A GQDAA  V  S
Sbjct: 716 VVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSS 775

Query: 254 QGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNA 308
             +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG     K   G+NA
Sbjct: 776 NCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENA 835

Query: 309 RRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
           R+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 836 RQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 875


>gi|4557643|ref|NP_000850.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase isoform 1 [Homo
           sapiens]
 gi|123343|sp|P04035|HMDH_HUMAN RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|306865|gb|AAA52679.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Homo sapiens]
 gi|10644584|gb|AAG21343.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Homo sapiens]
 gi|32165622|gb|AAP72015.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Homo sapiens]
 gi|119616160|gb|EAW95754.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase, isoform CRA_a
           [Homo sapiens]
 gi|119616161|gb|EAW95755.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase, isoform CRA_a
           [Homo sapiens]
 gi|261858110|dbj|BAI45577.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [synthetic
           construct]
          Length = 888

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 185/341 (54%), Gaps = 11/341 (3%)

Query: 18  PMKITGNVIQDK--VKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ + G +  D+   +VP+AT E  L  S  RG     L   G  + ++ + MTR     
Sbjct: 537 PVGVAGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGL-GGGASSRVLADGMTRGPVVR 595

Query: 76  TENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDAS 133
              A     + A  E +   A I    + TS+F R  +LH+ IAG  L++R +  +GDA 
Sbjct: 596 LPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAM 655

Query: 134 GHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRA 193
           G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+ V E  I   
Sbjct: 656 GMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAK 715

Query: 194 ICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGS 253
           + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A GQDAA  V  S
Sbjct: 716 VVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSS 775

Query: 254 QGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNA 308
             +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG     K   G+NA
Sbjct: 776 NCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENA 835

Query: 309 RRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
           R+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 836 RQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 875


>gi|134112598|ref|XP_774842.1| hypothetical protein CNBF0070 [Cryptococcus neoformans var.
            neoformans B-3501A]
 gi|50257490|gb|EAL20195.1| hypothetical protein CNBF0070 [Cryptococcus neoformans var.
            neoformans B-3501A]
          Length = 1283

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 122/343 (35%), Positives = 182/343 (53%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G ++     +P+AT E  L  S  RG   ++    G+   L  + M
Sbjct: 917  LPLPVGIAGPLNIDGQLLH----IPMATTEGTLVASTSRGCK-ALNAGGGVTTVLTHDAM 971

Query: 69   TRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR    +  N   A  A   I      A +    E TS+F +   L   +AG  L++R  
Sbjct: 972  TRGPAIDFPNIVQAAQARLWIDSPDGYATLKTAFESTSRFAKLQTLECALAGRTLYVRFA 1031

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
              TGDA G NM++K  +  ++ +   +  +H  ++SGN C+DKK  AIN I GRGK+ VA
Sbjct: 1032 TQTGDAMGMNMISKGVEKALEVLRGHFPDMHVLALSGNYCTDKKPAAINWIEGRGKSVVA 1091

Query: 187  EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
            E  +   + +  L+T+ + +  LN +KNLIG+ +AG I   NAH AN+L A YLA GQD 
Sbjct: 1092 EAVVPGHVVKTVLKTTVKDLCNLNIKKNLIGSAMAGSIGGFNAHAANILTAMYLACGQDP 1151

Query: 247  ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            A  VE S  +T  +  +D   L  SC++P++ +G VG G  +   +  L  LG      T
Sbjct: 1152 AQNVESSNCMTLMEPINDGEDLLISCSMPSVEVGTVGGGTILSPQRAMLDMLGVAGAHAT 1211

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NA+RLA I  A V+ GELSL++A    G L++AH++  R
Sbjct: 1212 SPGANAQRLARIIVAAVMAGELSLMSALAA-GHLIQAHMKHNR 1253


>gi|221041396|dbj|BAH12375.1| unnamed protein product [Homo sapiens]
          Length = 819

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 185/341 (54%), Gaps = 11/341 (3%)

Query: 18  PMKITGNVIQDK--VKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ + G +  D+   +VP+AT E  L  S  RG     L   G  + ++ + MTR     
Sbjct: 468 PVGVAGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGL-GGGASSRVLADGMTRGPVVR 526

Query: 76  TENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDAS 133
              A     + A  E +   A I    + TS+F R  +LH+ IAG  L++R +  +GDA 
Sbjct: 527 LPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAM 586

Query: 134 GHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRA 193
           G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+ V E  I   
Sbjct: 587 GMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAK 646

Query: 194 ICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGS 253
           + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A GQDAA  V  S
Sbjct: 647 VVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSS 706

Query: 254 QGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNA 308
             +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG     K   G+NA
Sbjct: 707 NCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENA 766

Query: 309 RRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
           R+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 767 RQLARIVCGTVMAGELSLMAALAA-GHLVKSHMIHNRSKIN 806


>gi|157169108|gb|ABV25900.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Antirrhinum majus]
          Length = 586

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 121/348 (34%), Positives = 183/348 (52%), Gaps = 19/348 (5%)

Query: 11  MPMRWI-------GPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATL 63
           MP+ ++       GP+ + G     +  VP+AT E  L  S  RG      C  G  + L
Sbjct: 235 MPVGYVQILVGIAGPLLLDGX----EYSVPMATTEGLLCASTNRGCKAIYAC-GGATSVL 289

Query: 64  IDERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
           + + MTR+  + F T      L    E  L    ++ V   +S+F R   +   +AG  L
Sbjct: 290 LRDGMTRAPVVRFATAKRAADLKFFLEDPLNFDTLSLVFNSSSRFARLQTIKCAVAGKNL 349

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           ++R   +TGDA   +MV+K    VMD++ +++  +    +SGN CSDKK  A+N I GRG
Sbjct: 350 YIRFSSSTGDAMDTDMVSKGVQNVMDFLTNEFPDMDVIGISGNYCSDKKPAAVNWIEGRG 409

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  I   +  K L+TS   ++ LN  KNL G+ +AG +   NAH +N++ A ++A
Sbjct: 410 KSVVCEAIIKEEVVNKVLKTSVASLVELNMLKNLTGSAMAGALGGFNAHASNIVSAIFIA 469

Query: 242 TGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
           TGQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  +P+    L  LG  
Sbjct: 470 TGQDPAQNVESSHCITMMEAVNDGRDLHISVTMPSIEVGTVGGGTQLPSQSACLNLLGVK 529

Query: 300 EERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              K   G N+R LA I A  VL GELSL++A    G+L+ +H++  R
Sbjct: 530 GANKEAPGSNSRLLATIVAGAVLAGELSLMSALA-AGQLVNSHMKYNR 576


>gi|4140371|gb|AAD03789.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Morus alba]
          Length = 548

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 118/344 (34%), Positives = 191/344 (55%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D+ +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 197 MPVGYVQIPVGIAGPLLLDEFEYSVPMATTEGCLVASTNRGCK-AIYMSGGATSVLLRDG 255

Query: 68  MTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+      +A+ A  L    E  +    +A V  ++S+F R   +   IAG  +++R 
Sbjct: 256 MTRAPVVRFNSAKRASELKFFVEDPVNFDTLAVVFNRSSRFARLQGIQCAIAGKNVYMRF 315

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K     +D++ S +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 316 SCSTGDAMGMNMVSKGVQNALDYLQSDFPDMDIIGISGNFCSDKKPAAVNWIEGRGKSVV 375

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 376 CEAVIKEEVVKKVLKTNVDALVELNMLKNLAGSAVAGALGGYNAHASNIVSAVFIATGQD 435

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  +E S  +T  +  ++   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 436 PAQNIESSHCITMMEAVNNGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANK 495

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 496 ESAGSNARLLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 538


>gi|330446074|ref|ZP_08309726.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328490265|dbj|GAA04223.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 419

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 120/342 (35%), Positives = 190/342 (55%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+  +GP+K+ G     +  VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 86  IGTVKLPVGVVGPLKVNGLFASGEYLVPLATTEAALVASYHRGS-LLISAAGGASAILLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  E+   A   +  +T +      + E T+ + +   ++  + GN ++L  
Sbjct: 145 EGVTRAPGFAFESLVQASQFITWVTTQYDTFKTIAESTTCYGKLSDINLSMEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT + +AV ++IL+        + +  N+  DKKATA      RGK  
Sbjct: 205 EYLTGDASGQNMVTISTNAVFEYILANTPIKPVEAFLDCNLSGDKKATAQTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++R + +KYL T+PEK++    +   +G  L+G I   NAH+AN L A+Y+A GQ
Sbjct: 265 TAEVHLSRELVKKYLHTTPEKMVNFG-KMTTVGGALSGTI-GVNAHYANALAAFYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E S G+T  +L   D L  S T+PNL++G VG G ++P+ K  L  +G     +
Sbjct: 323 DAACVAESSVGITRMELNQQDGLCVSVTLPNLMVGTVGGGTHLPSQKACLELIGLYGSGQ 382

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +    + LA +CAA  L GELS++ A  + G   +AH RL R
Sbjct: 383 S----QALAEVCAALCLAGELSIIGAFCS-GHFAKAHHRLAR 419


>gi|58268588|ref|XP_571450.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Cryptococcus neoformans
            var. neoformans JEC21]
 gi|57227685|gb|AAW44143.1| hydroxymethylglutaryl-CoA reductase (NADPH), putative [Cryptococcus
            neoformans var. neoformans JEC21]
          Length = 1283

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 122/343 (35%), Positives = 182/343 (53%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G ++     +P+AT E  L  S  RG   ++    G+   L  + M
Sbjct: 917  LPLPVGIAGPLNIDGQLLH----IPMATTEGTLVASTSRGCK-ALNAGGGVTTVLTHDAM 971

Query: 69   TRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR    +  N   A  A   I      A +    E TS+F +   L   +AG  L++R  
Sbjct: 972  TRGPAIDFPNIVQAAQARLWIDSPDGYATLKTAFESTSRFAKLQTLECALAGRTLYVRFA 1031

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
              TGDA G NM++K  +  ++ +   +  +H  ++SGN C+DKK  AIN I GRGK+ VA
Sbjct: 1032 TQTGDAMGMNMISKGVEKALEVLRGHFPDMHVLALSGNYCTDKKPAAINWIEGRGKSVVA 1091

Query: 187  EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
            E  +   + +  L+T+ + +  LN +KNLIG+ +AG I   NAH AN+L A YLA GQD 
Sbjct: 1092 EAVVPGHVVKTVLKTTVKDLCNLNIKKNLIGSAMAGSIGGFNAHAANILTAMYLACGQDP 1151

Query: 247  ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            A  VE S  +T  +  +D   L  SC++P++ +G VG G  +   +  L  LG      T
Sbjct: 1152 AQNVESSNCMTLMEPINDGEDLLISCSMPSVEVGTVGGGTILSPQRAMLDMLGVAGAHAT 1211

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NA+RLA I  A V+ GELSL++A    G L++AH++  R
Sbjct: 1212 SPGANAQRLARIIVAAVMAGELSLMSALAA-GHLIQAHMKHNR 1253


>gi|462289|sp|Q03163|HMDH_CATRO RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|167488|gb|AAA33108.1| hydroxymethylglutaryl-CoA reductase [Catharanthus roseus]
 gi|445621|prf||1909368A hydroxy methylglutaryl CoA reductase
          Length = 601

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 121/344 (35%), Positives = 189/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  +P+AT E  L  S  RG   ++L   G  + L+ + 
Sbjct: 243 MPVGYVQLPVGIAGPLLLDGREYMLPMATTEGCLVASTNRGCK-AILASGGANSVLLRDG 301

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E T     I+ V  ++S+F +   +   IAG  L++R 
Sbjct: 302 MTRAPVVRFGTAKRAAELKFYMEDTQNFETISVVFNKSSRFAKLQSVQCAIAGKNLYIRF 361

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V++++ + +  +    +SGN C+DKK  A+N I GRGK+ V
Sbjct: 362 SCSTGDAMGMNMVSKGVQNVLEFLQTDYPDMDVLGISGNFCADKKPAAVNWIEGRGKSVV 421

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   I +  L+T    +I LN  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 422 CEAIIKEEIVKTVLKTEVAALIELNMVKNLAGSAIAGALGGFNAHASNIVSAIFIATGQD 481

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
            A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     K
Sbjct: 482 PAQNVESSQCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 541

Query: 304 --TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA I A +VL GELSL++A  + G+L+ +H++  R
Sbjct: 542 DSPGANSRLLATIVAGSVLAGELSLMSA-ISAGQLVRSHMKYNR 584


>gi|11132855|sp|O76819|HMDH_AGRIP RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|3341396|emb|CAA08775.1| 3-hydroxy-3-methylgluraryl coenzyme A reductase [Agrotis ipsilon]
          Length = 833

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 126/350 (36%), Positives = 184/350 (52%), Gaps = 13/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+ + GP+ + G        +P+AT E  L  S  RGA    +   G+ + + D
Sbjct: 476 IGYVGVPVGYAGPLVVDGK----PYMIPMATTEGALVASTNRGAKAIGI--RGVTSVVED 529

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
             MTR+   +  N   A    Q I  K   A I    + TS+F R  ++H  + G  L+L
Sbjct: 530 VGMTRAPAIKLPNVVRAHECRQWIDNKDNYAVIKEAFDSTSRFARLQEIHIGVDGATLYL 589

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K A+  +  + + +  +   S+SGN CSDKKA AIN + GRGK 
Sbjct: 590 RFRATTGDAMGMNMVSKGAENALKLLKNYFPDMEVISLSGNYCSDKKAAAINWVKGRGKR 649

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI     +   +T  + +   N  KNL G+ LAG I   NAH ANM+ A Y+ATG
Sbjct: 650 VVCETTITSDSLRTIFKTDAKTLARCNKIKNLSGSALAGSIGGNNAHAANMVTAIYIATG 709

Query: 244 QDAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
           QD A  V  S   T  ++   + + LY +CT+P+L +G VG G  +      L  LG   
Sbjct: 710 QDPAQNVTSSNCSTNMEVCGENGEDLYVTCTMPSLEVGTVGGGTILTGQGACLDILGVKG 769

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
              +  +N+ RLA++  ATVL GELSL+AA  N  +L+++H+R  R  +N
Sbjct: 770 AGARPAENSARLASLICATVLAGELSLMAALVN-SDLVKSHMRHNRSTVN 818


>gi|168021777|ref|XP_001763417.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162685210|gb|EDQ71606.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 561

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 121/350 (34%), Positives = 190/350 (54%), Gaps = 12/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L++
Sbjct: 199 VGYVQIPLGVAGPLLLNGV----EFTVPMATTEGCLVASTNRGCK-AIYQSGGATSKLLE 253

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E       I+ +  +TS+F R  +L  Q+AG  +++
Sbjct: 254 DGMTRAPVVRFPSVKRCADLKFFLEDPNNFDTISHMFNRTSRFARLKKLKCQLAGRNVYI 313

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NM++K    V+D++   +  +   SVSGN C+DKK TA+N + GRGK+
Sbjct: 314 RFTATTGDAMGMNMISKGVQNVLDYLQDVYPDMETISVSGNFCADKKPTAVNWVDGRGKS 373

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  +   +  K L+TS   ++ LN  KNL G+ LAG +   NAH +N++ A ++ATG
Sbjct: 374 VVCEAILKGEVIAKVLKTSVPALVELNMIKNLAGSALAGAVGGFNAHASNIVSAVFIATG 433

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 434 QDPAQNVESSQCITMMEAVNDGQDLHVSVTMPSIEVGTVGGGTILASQTACLNVLGVKGA 493

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                G NA+ LA + A TVL GE+SL+AA    G+L+++H++  R + N
Sbjct: 494 NAEYPGANAQTLARVVAGTVLAGEISLMAALA-AGQLVKSHMKYNRSNQN 542


>gi|224065641|ref|XP_002301898.1| predicted protein [Populus trichocarpa]
 gi|222843624|gb|EEE81171.1| predicted protein [Populus trichocarpa]
          Length = 588

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 188/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   +M    G  + L+ 
Sbjct: 239 VGYVQIPVGIAGPLLLNGM----EYMVPMATTEGCLVASTNRGCK-AMYASGGATSVLLA 293

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + FET      L    E       ++ V  ++S+F R   +   +AG  L++
Sbjct: 294 DGMTRAPVVRFETAKRASELKLFLEDPDNFDTLSIVFNRSSRFARLQGIKCSMAGKNLYM 353

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R + +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+
Sbjct: 354 RFKCSTGDAMGMNMVSKGVQNVLDFLQNDFHDMEVIGISGNFCSDKKPAAVNWIEGRGKS 413

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   I +K L+TS   ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 414 VVCEAIIREEIVKKVLKTSVASLVELNMLKNLAGSAVAGALGGFNAHASNIVSAIFIATG 473

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  +E S  +T  +  ++   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 474 QDPAQNIESSHCITMMEAVNNGKDLHISVTMPSIEVGTVGGGTQLVSQSACLNLLGVKGA 533

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +   G N+R LA I A +VL GELSL+AA    G+L+++H++  R
Sbjct: 534 SKESPGSNSRLLATIVAGSVLAGELSLMAAIAQ-GQLVKSHMKYNR 578


>gi|298675270|ref|YP_003727020.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanohalobium
           evestigatum Z-7303]
 gi|298288258|gb|ADI74224.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanohalobium
           evestigatum Z-7303]
          Length = 417

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 191/345 (55%), Gaps = 10/345 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+K+ G        +PLAT E  L  S+ RG  + +   DG    +  
Sbjct: 75  IGAVQIPLGVAGPLKVNGEYADGDYHIPLATTEGALVASINRGCSV-ITRSDGANVRIFQ 133

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFT---RFLQLHSQIAGNLLF 122
           + MTR+  F+ EN   A   ++ I  K   I  + ++ S  T     + +   + GN ++
Sbjct: 134 DVMTRAPAFKVENVARAQEFVEWIK-KPDTIKHMQDKISDITSHGELVDVDPYVLGNTVY 192

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           LR  + T DA G NMVT A + ++D I  ++      S+SGN+C+DKK  AIN I GRGK
Sbjct: 193 LRFSYDTKDAMGMNMVTIATNTLVDLIEDEFGADPI-SLSGNMCTDKKPAAINSIQGRGK 251

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
             VAE  I + + +  L+++PE++  +N +KNL+G+  AG +   NAH AN++ A  +A 
Sbjct: 252 TVVAETEIPKKVIEDRLKSTPEEMAEVNYRKNLLGSARAGSL-GYNAHAANVIAAMNIAC 310

Query: 243 GQDAANIVEGSQGLTYAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-E 300
           GQD A++VEGS  +T  ++     LY S T+P+L++G VG G  I   K+ L  LG    
Sbjct: 311 GQDTAHVVEGSNTITTMEVTKYGDLYCSVTLPSLLVGTVGGGTGIGTQKDCLDLLGVAGS 370

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               G NA++LA I A++VL GE+SL+ AQ   G L  AH  L R
Sbjct: 371 GHPPGSNAKKLAEIIASSVLAGEISLIGAQA-AGHLARAHAELGR 414


>gi|224091425|ref|XP_002187727.1| PREDICTED: 3-hydroxy-3-methylglutaryl-Coenzyme A reductase
           [Taeniopygia guttata]
          Length = 882

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 192/343 (55%), Gaps = 15/343 (4%)

Query: 18  PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ + G ++ D  + +VP+AT E  L  S  RG   ++    G  + ++ + MTR     
Sbjct: 531 PVGVAGPLVLDNKEFQVPMATTEGCLVASTNRGCR-AIYLGGGATSRILADGMTRGPVVR 589

Query: 76  TENAEMALTALQEITLKKAEIARVIEQ----TSQFTRFLQLHSQIAGNLLFLRLEFATGD 131
              A  A  A  ++ L+  E  +++++    TS+F R  +L   +AG  L++R +  TGD
Sbjct: 590 LPTACQA--AEVKVWLESPEGFKIMKEAFDSTSRFARLQKLLISLAGRNLYIRFQSGTGD 647

Query: 132 ASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITIN 191
           A G NM++K  +  +  +  ++  L   ++SGN C+DKK  AIN I GRGK+ V E  I 
Sbjct: 648 AMGMNMISKGTEKALARLNEEFPDLQVIAISGNYCTDKKPAAINWIEGRGKSVVCEAVIP 707

Query: 192 RAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVE 251
             + ++ L+T+ E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A GQDAA  V 
Sbjct: 708 AKVVREVLKTTTEDLVEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVG 767

Query: 252 GSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGD 306
            S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG     +   G+
Sbjct: 768 SSNCITLMERTGSTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGASQDNPGE 827

Query: 307 NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
           NAR+LA I  ATV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 828 NARQLAKIVCATVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 869


>gi|164604972|dbj|BAF98282.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
          Length = 575

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 186/343 (54%), Gaps = 12/343 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ 
Sbjct: 226 VGYVQIPVGIAGPLLLNGR----EYSVPMATTEGCLVASTNRGCK-AIYLSGGATSVLLK 280

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E       +A V  ++S+F R   +   IAG  L++
Sbjct: 281 DGMTRAPVVRFASATRAAELKFFLEDPDNFDTLAVVFNKSSRFARLQGIKCSIAGKNLYI 340

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V++++ S +S +    +SGN CSDKK  A+N I GRGK+
Sbjct: 341 RFSCSTGDAMGMNMVSKGVQNVLEFLQSDFSDMDVIGISGNFCSDKKPAAVNWIEGRGKS 400

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH  N++ A ++ATG
Sbjct: 401 VVCEAIIKEEVVKKVLKTNVASLVELNMLKNLAGSAVAGALGGFNAHAGNIVSAIFIATG 460

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 461 QDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 520

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLR 342
            +   G N+R LAAI A +VL GELSL++A    G+L+++H++
Sbjct: 521 NKESPGSNSRLLAAIVAGSVLAGELSLMSA-IAAGQLVKSHMK 562


>gi|123340|sp|P14891|HMDH1_ARATH RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 1;
           Short=HMG-CoA reductase 1; Short=HMGR1
 gi|6554470|gb|AAF16652.1|AC012394_1 hydroxy methylglutaryl CoA reductase (AA 1-592); 9510-7255
           [Arabidopsis thaliana]
 gi|12323986|gb|AAG51957.1|AC015450_18 3-hydroxy-3-methylglutaryl CoA reductase (AA 1-592); 32253-34508
           [Arabidopsis thaliana]
 gi|14326475|gb|AAK60283.1|AF385690_1 At1g76490/F15M4.1 [Arabidopsis thaliana]
 gi|16336|emb|CAA33139.1| unnamed protein product [Arabidopsis thaliana]
 gi|166750|gb|AAA76821.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis thaliana]
 gi|388556|gb|AAA32814.1| hydroxymethylglutaryl CoA reductase [Arabidopsis thaliana]
 gi|23397126|gb|AAN31847.1| putative 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis
           thaliana]
 gi|34365559|gb|AAQ65091.1| At1g76490/F15M4.1 [Arabidopsis thaliana]
          Length = 592

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 185/344 (53%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ +I  P+ I G ++ D  +  VP+AT E  L  S  RG   +M    G  +T++ + 
Sbjct: 235 MPVGYIQIPVGIAGPLLLDGYEYSVPMATTEGCLVASTNRGCK-AMFISGGATSTVLKDG 293

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F +      L    E       +A V  ++S+F R   +   IAG   ++R 
Sbjct: 294 MTRAPVVRFASARRASELKFFLENPENFDTLAVVFNRSSRFARLQSVKCTIAGKNAYVRF 353

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V++++   +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 354 CCSTGDAMGMNMVSKGVQNVLEYLTDDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 413

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   I  K L+TS   ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 414 CEAVIRGEIVNKVLKTSVAALVELNMLKNLAGSAVAGSLGGFNAHASNIVSAVFIATGQD 473

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE SQ +T  +  +D   ++ S T+P++ +G VG G  + +    L  LG      
Sbjct: 474 PAQNVESSQCITMMEAINDGKDIHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGAST 533

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NARRLA I A  VL GELSL++A    G+L+ +H++  R
Sbjct: 534 ESPGMNARRLATIVAGAVLAGELSLMSA-IAAGQLVRSHMKYNR 576


>gi|239996007|ref|ZP_04716531.1| Hydroxymethylglutaryl-coenzyme A reductase [Alteromonas macleodii
           ATCC 27126]
          Length = 388

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 116/337 (34%), Positives = 177/337 (52%), Gaps = 10/337 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+ + GPM + G   + +  VP+AT E  L  S  RG  ++     GI  T+ID+ M R
Sbjct: 58  VPIGFAGPMLVNGEHAKGEFYVPMATTEGTLTASYSRGMRLTREA-GGITTTVIDDAMQR 116

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F   NA  AL   + +      I +  + T+   +   +    A  L +LR  F  G
Sbjct: 117 APMFAFSNAREALEFGKWVEQNFEAIKQACDSTTSVGKLRDIEQYAASKLRWLRFNFTCG 176

Query: 131 DASGHNMVTKAADAVMDWILSQWS-YLHYGSVSGNICSDKKATAINGIMGRGKNFVAEIT 189
           DA+G NMV+KA  A  +WI + +S  + +  ++ N+ +DKK + +N +  RGK  VAEIT
Sbjct: 177 DAAGQNMVSKATKAGCEWIQANYSGPIEHFVLAANLDTDKKHSHLNSLHTRGKRVVAEIT 236

Query: 190 INRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANI 249
           + + +  + +   PE +       N+ G  +AG + +  AHFAN + A ++A GQD AN+
Sbjct: 237 LPKQLMTEIMHCPPEALFKQRQYSNM-GALMAGSVNNG-AHFANGITAMFIACGQDVANV 294

Query: 250 VEGSQGLTYAK-LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNA 308
            E S G TYA+ + +   YFS TIP+LI+   G G  +      L+ LGC E      + 
Sbjct: 295 AESSAGFTYAEIMPNGDYYFSVTIPSLIVATYGGGTGLATQNECLSVLGCTER----GSV 350

Query: 309 RRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            + A I AATVLCG+LSL +A     E + +H RL R
Sbjct: 351 NKFAEIVAATVLCGDLSLGSAVV-ADEWVSSHERLGR 386


>gi|95116556|gb|ABF56518.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Litchi chinensis]
          Length = 548

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 185/344 (53%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G    L+ + 
Sbjct: 197 MPVGYVQIPVGIAGPLLLDGFEYWVPMATTEGCLVASTNRGCK-AIYASGGAATVLLKDG 255

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E       +A V  ++S+F R   +   IAG  L+ R 
Sbjct: 256 MTRAPVVRFSTAKRAAELKFFLEDPNNFDTLAVVFNRSSRFARLQSIQCSIAGKNLYTRF 315

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 316 CCSTGDAMGMNMVSKGVQNVLDFLKNDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 375

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NA  AN++ A Y+ATGQD
Sbjct: 376 CEAIIKEEVVKKVLKTNVASLVELNMLKNLTGSAVAGALGGFNAQAANIVSAIYIATGQD 435

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 436 PAQNVESSHCITMMEAVNDRRDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 495

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA+I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 496 ESPGSNARLLASIVAGSVLAGELSLMSA-IAAGQLVRSHMKYNR 538


>gi|198436555|ref|XP_002131486.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-Coenzyme A
           reductase b [Ciona intestinalis]
          Length = 821

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 126/361 (34%), Positives = 193/361 (53%), Gaps = 30/361 (8%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  +++P+  +GP+K+          +P+AT E  L  S  RG  +  L   G+ A++  
Sbjct: 457 VGYVAVPLGLVGPLKLD----NQNYMIPMATTEGTLLASTNRGLKVLHL-SGGVTASIYG 511

Query: 66  ERMTRSIFFETENAEMALTA---LQE---ITLKKAEIARVIEQTSQFTRFLQLHSQIAGN 119
           + MTR+   E  +AE A      LQ+    TL + +     E TS+F +  +L   ++G 
Sbjct: 512 DGMTRAPVVEFPSAEQACRISNWLQDSYNFTLVRDKF----EATSRFAKLKRLTPAVSGR 567

Query: 120 LLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMG 179
           LLF+R    TGDA G NM++K  +  + W+  Q+  +   S+SGN C+DKK +A+N I G
Sbjct: 568 LLFIRFTATTGDAMGMNMLSKGVENALRWMCEQFPDMKVLSLSGNFCTDKKPSAVNWIQG 627

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
           RGK+ V E  I   + +  LRT+   +  LN  KN IG+ ++G I   NAH AN++ A +
Sbjct: 628 RGKSVVCEAVIPAKVVKDVLRTNIATLTHLNRCKNHIGSAMSGSIGGFNAHAANIVTAMF 687

Query: 240 LATGQDAANIVEGSQGLTY------AKLHDDS----LYFSCTIPNLILGCVGNGKNIPAI 289
           +ATGQD A  V  S  +T        ++ D +    L+ +CT+P+L +  VG G  +   
Sbjct: 688 IATGQDPAQNVVSSNCITTLEEISCPQIGDTTSHTALHITCTMPSLEVATVGGGTALEPQ 747

Query: 290 KNNLTALGC----IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           K  L  LG         K G NA +LA +   TVL GELSLL+A  + GEL+++H+R  R
Sbjct: 748 KACLNLLGVAGSSAPNTKPGTNACQLAKLICGTVLAGELSLLSALAS-GELVQSHMRHNR 806

Query: 346 M 346
           +
Sbjct: 807 L 807


>gi|331228007|ref|XP_003326671.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Puccinia graminis f.
            sp. tritici CRL 75-36-700-3]
 gi|309305661|gb|EFP82252.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Puccinia graminis f.
            sp. tritici CRL 75-36-700-3]
          Length = 1371

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 129/348 (37%), Positives = 189/348 (54%), Gaps = 14/348 (4%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GP++I G        +P+AT E  L  S  RG   ++    G+   +  
Sbjct: 948  VGYMPIPVGIAGPLRIDGTAF----PLPMATTEGALVASTSRGCK-ALNAGGGVTTVVTA 1002

Query: 66   ERMTRSIFFETENAEMALTALQEITLKKAEIA--RVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR    E  +  MA  A   +  ++  +A     + TS+F R + L + +AG  L++
Sbjct: 1003 DAMTRGPALEFPDLTMAAQAKAWVESEEGRVALKTAFDSTSRFARLISLKTALAGRTLYV 1062

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +A +  + S+  +  +   S+SGN C DKK +AIN I GRG
Sbjct: 1063 RFGTRTGDAMGMNMISKGTEAALRLMKSEAYFPQMKVVSLSGNYCIDKKPSAINWIEGRG 1122

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ VAE  +   I QK L+TS + I+ LN  KNL+G+ LAG I   NAH +N+L A YLA
Sbjct: 1123 KSIVAEAVVPGQIIQKILKTSVKDIVKLNITKNLVGSCLAGSIGGNNAHASNILTAIYLA 1182

Query: 242  TGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
            TGQD A  VE S  +T  +  +D   L  +CT+P++ +G +G G  +      L  LG  
Sbjct: 1183 TGQDPAQNVESSNCMTLMEAVNDEQDLLITCTMPSIEVGTIGGGTILGPQAAMLEMLGIR 1242

Query: 300  EERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                T  GDNAR+LA I  A V+ GELSL++A    G L+E+H+   R
Sbjct: 1243 GPHPTAPGDNARQLARIICAAVMAGELSLMSALAA-GHLVESHMTHNR 1289


>gi|52858428|gb|AAU89123.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Ginkgo biloba]
          Length = 571

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 123/349 (35%), Positives = 189/349 (54%), Gaps = 18/349 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRAT 62
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG    H+S     G  + 
Sbjct: 223 VGVVQIPVGVAGPLLLNGL----EYMVPMATTEGCLVASTNRGCKAIHMS----GGATSI 274

Query: 63  LIDERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           L+ + MTR+      +A+ A  L    E       ++ +  +TS+F R   +   IAG  
Sbjct: 275 LLRDGMTRAPLVRFASAKRAADLKFYLEHPNNAEALSHLFNRTSRFGRLQGIKCAIAGRN 334

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           +++R   +TGDA G NMV+K    V+D++ +++  +   SVSGN C+DKKATA+N I GR
Sbjct: 335 VYMRFSCSTGDAMGMNMVSKGVQNVLDYLQNEFPDMDVISVSGNFCADKKATAVNWIEGR 394

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ V E  I   +  K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A ++
Sbjct: 395 GKSVVCEAVIREEVVSKVLKTTVGALLELNMVKNLTGSAMAGAVGGFNAHSSNIVSAVFI 454

Query: 241 ATGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           ATGQD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG 
Sbjct: 455 ATGQDPAQNVESSQCITMMEAANDGKDLHVSVTMPSVQVGTVGGGTQLASQAACLNLLGV 514

Query: 299 --IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                   G NA+ LA I A  VL GELSL++A    G+L+ +H++  R
Sbjct: 515 KGANAESAGANAQCLAKIVAGAVLAGELSLMSALA-AGQLVNSHMKYNR 562


>gi|194745855|ref|XP_001955400.1| GF16258 [Drosophila ananassae]
 gi|190628437|gb|EDV43961.1| GF16258 [Drosophila ananassae]
          Length = 926

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 127/344 (36%), Positives = 184/344 (53%), Gaps = 14/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 567 VPIPVGYAGPLLLDG----ETYYVPMATTEGALVASTNRGCK--ALSVRGVRSVVEDVGM 620

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  + F +        A  E      ++    + TS+F R  + H  + G  L++R  
Sbjct: 621 TRAPCVRFPSVARAAEAKAWIENETNYQQVKTEFDSTSRFGRLKECHIAMDGPQLYIRFV 680

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK  V 
Sbjct: 681 ATTGDAMGMNMVSKGAEMALRRIKRQFPDMQIISLSGNFCCDKKPAAINWIKGRGKRVVT 740

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E TI+ A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LATGQD 
Sbjct: 741 ECTISAATLRSVLKTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQDP 800

Query: 247 ANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
           A  V  S   T  +    ++D LY +CT+P+L +G VG G  +P     L  LG      
Sbjct: 801 AQNVTSSNCSTAMECWVENNDDLYMTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGAHA 860

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            + GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 861 TRPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 903


>gi|227539153|ref|ZP_03969202.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227240835|gb|EEI90850.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 336

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 181/344 (52%), Gaps = 24/344 (6%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P   IGP++ITG        VPLAT E  L  S  RG     +   GI +  + E + R
Sbjct: 4   VPTGVIGPLRITGFAANADFYVPLATSEGALVASYHRGTRACFMA-GGITSICLQEGVQR 62

Query: 71  SIFFETEN-AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFAT 129
           S  F+ EN  E+ L  +  +  ++ ++  + +QTS++ R   +  QI GN L +  E+ T
Sbjct: 63  SPLFKFENVGELGLF-VSWLLPQEEKLKEITKQTSRYARLANMQIQIEGNHLIVTFEYQT 121

Query: 130 GDASGHNMVTKAADAVMDWILSQ-------WSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           GDA+G NMVT   DA+  +++S        W       V GN   DKKATA++    RGK
Sbjct: 122 GDAAGQNMVTICTDAICQYLVSHSPVKPKLW------FVEGNYSGDKKATALSFTNVRGK 175

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
              AEI +   I ++ L+TSPE ++    + + +G   +G I  A+ H+AN L A +LAT
Sbjct: 176 KVTAEIVLPETIVRQVLKTSPE-LMAEYWRSSTMGIIQSGAI-GAHGHYANGLAALFLAT 233

Query: 243 GQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           GQD A + E + G+T  +L+ D SLY S T+PNL++G VG G ++   +  L  + C   
Sbjct: 234 GQDVACVAEAATGITRMELNKDGSLYASVTLPNLMVGTVGGGTHLSTQRECLEMMDCY-- 291

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                 AR+ A IC   VL GELS +AA  + G    AH +  R
Sbjct: 292 --GAGQARKFAEICGGLVLAGELS-IAAALSAGHFTSAHQKFGR 332


>gi|20093793|ref|NP_613640.1| hydroxymethylglutaryl-CoA reductase [Methanopyrus kandleri AV19]
 gi|19886706|gb|AAM01570.1| Hydroxymethylglutaryl-CoA reductase [Methanopyrus kandleri AV19]
          Length = 410

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 126/360 (35%), Positives = 188/360 (52%), Gaps = 41/360 (11%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ + G   + +  VPLAT E  L  SV RG   ++    G    ++ 
Sbjct: 72  IGAVQVPVGIAGPLLVHGEYAEGEYYVPLATTEGALVASVNRGCS-TITDSGGAHVRIVR 130

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F+  +A  AL   + +     +I  V E T++    L +   + G  +FLR 
Sbjct: 131 DGMTRAPVFKLPSARKALEFCEWVRKHFDDIKEVAESTTRHGELLDIQEFVVGRHVFLRF 190

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           EF T DA G NMVT A +  ++WI  ++      S SGN+C DKK + +N ++GRG+  V
Sbjct: 191 EFDTKDAMGMNMVTIATEEAVNWIEEKYPDAKCVSASGNVCVDKKPSWLNNVLGRGRTVV 250

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE+ + R I ++ L+T+PE +  +N +KNL+G+  AG I   NAH AN++ A ++ATGQD
Sbjct: 251 AEVEVPRDIVEEKLKTTPEAMAEVNYRKNLVGSAAAGNI-GFNAHHANIVAAIFIATGQD 309

Query: 246 AANIVEGSQGLTYAKLHDD-SLYFSCTIPNL-------------------ILGCVGNGKN 285
            A+ V+GS G T  ++ +D  LY S TIP+L                   ILG  G G N
Sbjct: 310 EAHAVDGSTGYTTMEVTEDGDLYASVTIPSLNVGTVGGGTGVETQRECLEILGVAGGG-N 368

Query: 286 IPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            P +                 NA+  A + AA VL GELSL+AA    G L +AH  L R
Sbjct: 369 PPGV-----------------NAKEFAEVVAAAVLAGELSLVAALA-AGHLGKAHRLLGR 410


>gi|300710689|ref|YP_003736503.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Halalkalicoccus
           jeotgali B3]
 gi|299124372|gb|ADJ14711.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Halalkalicoccus
           jeotgali B3]
          Length = 409

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 128/333 (38%), Positives = 174/333 (52%), Gaps = 14/333 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVK--------VPLATYEYPLWHSVKRGAHISMLCPD 57
           +    +PM  +GP+ I  N   D           +PLAT E  L  SV RG  + +    
Sbjct: 67  IGGAQLPMGVVGPVPI--NTDGDSAGGAAGGEHYLPLATTEGALVASVNRGCSV-IRTAG 123

Query: 58  GIRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIA 117
           G  A +    MTR+  F       A   ++ +     ++    E T+     L +   + 
Sbjct: 124 GANARVTKSGMTRAPVFRVAGIAEAAEIVEWVQGSIEKLCEKAEGTTNHGELLDITPYVV 183

Query: 118 GNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGI 177
           G+ +FLR  F + DA G NMVT A  A  D I  + +     ++SGN+CSDKK  AIN I
Sbjct: 184 GDNVFLRFRFDSKDAMGMNMVTIATQAACDLI-EEETTASLVALSGNLCSDKKPAAINAI 242

Query: 178 MGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA 237
            GRG++  A++TI R + ++ L T+PE I   NT+KNLIG+  AG +   NAH AN + A
Sbjct: 243 EGRGRSVTADVTIPREVVEERLHTTPEAIAEANTRKNLIGSAKAGSL-GFNAHAANTIAA 301

Query: 238 YYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
            +LATGQDAA +VEGS  +T A++ DDSLY S +I +L +G VG G  +P     L  LG
Sbjct: 302 AFLATGQDAAQVVEGSNAITTAEVKDDSLYASLSIASLEVGTVGGGTKLPTQAEALDVLG 361

Query: 298 CI-EERKTGDNARRLAAICAATVLCGELSLLAA 329
                   G NA  LA I A   L GELSLLAA
Sbjct: 362 LSGGGDPPGSNADALAEIIATGALAGELSLLAA 394


>gi|167997509|ref|XP_001751461.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162697442|gb|EDQ83778.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 578

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 123/346 (35%), Positives = 185/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G+    +  VP+AT E  L  S  RG   ++    G  + L+ 
Sbjct: 216 VGYVQLPVGVAGPLLLNGH----EFTVPMATTEGCLVASTNRGCK-AIHQSGGATSILLQ 270

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E       IA +  +TS+F R   L  Q+AG  +++
Sbjct: 271 DGMTRAPVVRFPSVKRCADLKFFLEDPNNFDTIAHMFNRTSRFARLKHLKCQLAGRNVYI 330

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NM++K    V+D++   +  +   SVSGN C+DKK TA+N I GRGK+
Sbjct: 331 RFTAMTGDAMGMNMISKGVQNVLDYLQDVYPDMEVISVSGNFCADKKPTAVNWIDGRGKS 390

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  +   + +K L+TS   ++ LN  KNL G+ LAG +   NAH AN++ A Y+A G
Sbjct: 391 VVCEAILKGDVVRKVLKTSVSALVELNMVKNLAGSALAGAVGGFNAHAANIVSAVYIACG 450

Query: 244 QDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  +    L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 451 QDPAQNVESSQCITMMEAVNGGQDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 510

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NA+ LA I A TVL GE+SL+AA    G+L+ +H++  R
Sbjct: 511 NVESPGANAQTLARIVAGTVLAGEISLMAALA-AGQLVRSHMKYNR 555


>gi|149726537|ref|XP_001504728.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-coenzyme A
           reductase [Equus caballus]
          Length = 888

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 186/353 (52%), Gaps = 17/353 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRILA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E       I    + TS+F R  +LH+ +AG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETPEGFTVIKEAFDSTSRFARLQKLHTSVAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPDMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPARVVREVLKTTTEAMVEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG--- 297
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 298 -CIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
            C E    G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 826 ACKE--NPGENARQLARIVCGTVMAGELSLMAALA-AGHLVRSHMIHNRSKVN 875


>gi|79382641|ref|NP_177775.2| HMG1 (HYDROXY METHYLGLUTARYL COA REDUCTASE 1);
           hydroxymethylglutaryl-CoA reductase [Arabidopsis
           thaliana]
 gi|40218407|gb|AAR83122.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase isoform 1L
           [Arabidopsis thaliana]
 gi|332197728|gb|AEE35849.1| hydroxy methylglutaryl CoA reductase 1 [Arabidopsis thaliana]
          Length = 642

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 185/344 (53%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ +I  P+ I G ++ D  +  VP+AT E  L  S  RG   +M    G  +T++ + 
Sbjct: 285 MPVGYIQIPVGIAGPLLLDGYEYSVPMATTEGCLVASTNRGCK-AMFISGGATSTVLKDG 343

Query: 68  MTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+      +A  A  L    E       +A V  ++S+F R   +   IAG   ++R 
Sbjct: 344 MTRAPVVRFASARRASELKFFLENPENFDTLAVVFNRSSRFARLQSVKCTIAGKNAYVRF 403

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V++++   +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 404 CCSTGDAMGMNMVSKGVQNVLEYLTDDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 463

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   I  K L+TS   ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 464 CEAVIRGEIVNKVLKTSVAALVELNMLKNLAGSAVAGSLGGFNAHASNIVSAVFIATGQD 523

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE SQ +T  +  +D   ++ S T+P++ +G VG G  + +    L  LG      
Sbjct: 524 PAQNVESSQCITMMEAINDGKDIHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGAST 583

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NARRLA I A  VL GELSL++A    G+L+ +H++  R
Sbjct: 584 ESPGMNARRLATIVAGAVLAGELSLMSAIAA-GQLVRSHMKYNR 626


>gi|55585878|gb|AAV54051.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Eucommia ulmoides]
          Length = 590

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 118/343 (34%), Positives = 188/343 (54%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ + M
Sbjct: 243 LQIPVGIAGPLLLNGC----EYSVPMATTEGCLVASTNRGCK-AIYASGGATSILLRDGM 297

Query: 69  TRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      +A+ A  L    E  L    ++ V  ++S+F R   +   IAG  L++R  
Sbjct: 298 TRAPVVRFPSAKRASELKFFLEDPLNFETLSMVFNKSSRFARLQGIQCSIAGKNLYMRFT 357

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    +++++ + +  +    +SGN CSDKK  A+N I GRGK+ V 
Sbjct: 358 CSTGDAMGMNMVSKGVQNILEFLQNDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVC 417

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I+  I +K L+T+   ++ LN  KNL G+ +AG +   NAH AN++ A ++ATGQD 
Sbjct: 418 EAIISEDIVRKVLKTTVPALVELNMLKNLAGSAVAGALGGFNAHAANIVSAVFIATGQDP 477

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     + 
Sbjct: 478 AQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANKE 537

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G N+R LAAI A +VL GELSL++A    G+L+ +H++  R
Sbjct: 538 SPGSNSRLLAAIVAGSVLAGELSLMSA-IAAGQLVNSHMKYNR 579


>gi|332017838|gb|EGI58498.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Acromyrmex
           echinatior]
          Length = 918

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 126/347 (36%), Positives = 191/347 (55%), Gaps = 14/347 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+  +GP+ I G +      VP+AT E  L  S  RG+   + C  G+   +  
Sbjct: 550 IGYVPVPVGIVGPLLIDGQLYH----VPMATTEGCLVASTNRGSRALLKC--GVITRVTA 603

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+   +  +   A  A+  I   +   E+    +QTS+F R  ++H +IAG  L L
Sbjct: 604 DGMTRAPVVQFPDIVRACEAMSWIEQPQNFEELKNSFDQTSRFARLKKIHPRIAGRDLHL 663

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NM++K  +  +  + + +  +   S+SGN+C+DKK  A+N I GRGK+
Sbjct: 664 RFVATTGDAMGMNMLSKGTERSLQTLQTYFPDMEIISLSGNLCTDKKPAAVNWIEGRGKS 723

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   +  + L+TS  +++ LN +KNL G+ LAG I   NAH AN++ A ++ATG
Sbjct: 724 VVCEAIIPADVVMRVLKTSVHELVELNNKKNLTGSALAGSIGGFNAHAANIVTAIFIATG 783

Query: 244 QDAANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QD A  V  S  LT  +   +    L  +CT+P++ +G VG G  +PA    L  LG   
Sbjct: 784 QDPAQNVSSSNCLTLMEPWGVDGKDLRITCTMPSIEVGTVGGGTGLPAQGACLAMLGIKG 843

Query: 301 ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  G NAR+L+ I  ATVL  ELSL+AA  + G+L+++HLR  R
Sbjct: 844 AHPTEPGQNARKLSRIVCATVLAAELSLMAALAS-GDLVKSHLRHNR 889


>gi|219853202|ref|YP_002467634.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanosphaerula
           palustris E1-9c]
 gi|219547461|gb|ACL17911.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanosphaerula
           palustris E1-9c]
          Length = 407

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 187/341 (54%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G     +  +PLAT E  L  SV RG   ++    G    +I 
Sbjct: 65  IGAVQIPVGVAGPLRVHGEYADGEYYLPLATTEGALVASVNRGCS-AITAAGGAEVRIIR 123

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F T++   A + +  +   +  I  V E T+   R +   + +AG  ++LRL
Sbjct: 124 DGMTRAPVFATDSVIHARSVVDWVEANQDRIRAVAESTTSHGRLIGTMTSVAGTSVYLRL 183

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           EF T DA G NM T A  AV   ++++ +     SVSGN+C+DKK  AIN ++GRGK  V
Sbjct: 184 EFDTKDAMGMNMATIAGTAV-STMVAEETGARLISVSGNLCTDKKPAAINVVLGRGKTVV 242

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A + +   +C+   +TS   I  +N +KNL+G+  AG +   NA  AN++ A ++A GQD
Sbjct: 243 AGVHLTEDLCRTIFKTSAAIISEVNMRKNLVGSARAGAL-GFNAQAANVIAATFIACGQD 301

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-IEERKT 304
            A++VEGS  +T     +D +Y + TIP L +G VG G  +   +  L  LG        
Sbjct: 302 PAHVVEGSSCITTVDPVEDGIYVAVTIPALQVGTVGGGTGLATQRECLALLGANGGGEPA 361

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G +A++LA I AA VL GELSLL A    G L +AH +L R
Sbjct: 362 GSHAKKLAEIIAAGVLAGELSLLGA-LGAGHLAKAHQQLGR 401


>gi|73952227|ref|XP_860526.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-coenzyme A
           reductase (HMG-CoA reductase) isoform 8 [Canis
           familiaris]
          Length = 842

 Score =  182 bits (461), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 185/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 485 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRILA 539

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E       I    + TS+F R  +LH  +AG  L++
Sbjct: 540 DGMTRGPVVRLPRACDSAEVKAWLETPEGFTVIKEAFDSTSRFARLQKLHMSMAGRNLYI 599

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 600 RFQSRSGDAMGMNMISKGTEKALSKLHEHFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 659

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 660 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 719

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 720 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 779

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 780 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 829


>gi|11132778|sp|O24594|HMDH_MAIZE RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|1667389|emb|CAA70440.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Zea mays]
          Length = 579

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 118/346 (34%), Positives = 186/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  +P+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 219 VGYVQLPVGVAGPLLLDGR----RFYLPMATTEGCLVASTNRGCK-AIAESGGATSVVLR 273

Query: 66  ERMTRSIF--FETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+    F T      L A  E       ++ V  ++S+F R   +   +AG  L++
Sbjct: 274 DAMTRAPVARFPTARRAAELKAFLEDPANFDTLSVVFNRSSRFARLQGVQCAMAGRNLYM 333

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK +A+N I GRGK+
Sbjct: 334 RFSCSTGDAMGMNMVSKGVQNVLDFLQDDFHDMDVISISGNFCSDKKPSAVNWIEGRGKS 393

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T  + ++ LNT KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 394 VVCEAVIGEEVVKKVLKTDVQSLVELNTIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 453

Query: 244 QDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +    L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 454 QDPAQNVESSHCITMLEPVNAGRDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVRGA 513

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              + G NAR LA + A  VL GELSLL+A    G+L+++H++  R
Sbjct: 514 SRDRPGSNARLLATVVAGGVLAGELSLLSALAA-GQLVKSHMKYNR 558


>gi|157169110|gb|ABV25901.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Antirrhinum majus]
          Length = 548

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 185/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    L+ 
Sbjct: 199 VGYVQIPVGIAGPLLLNGG----EYSVPMATTEGCLVASTNRGCK-AIYVSGGATCVLLR 253

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+      +A+ A  L    E  L    ++ V  ++S+F R   +   IAG  L++
Sbjct: 254 DGMTRAPVVRFSSAKRATDLKFFLENPLNFDTLSLVFNKSSRFARLQSIQCAIAGKNLYI 313

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
               +TGDA G NMV+K    V+D++ S +  +     SGN CSDKK  A+N I GRGK+
Sbjct: 314 GFTCSTGDAMGMNMVSKGVQNVLDFLQSDFPDMDVIGCSGNFCSDKKPAAVNWIEGRGKS 373

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   +  K L+T+   ++ LN  KNL G+ +AG +   NAH AN++ A ++ATG
Sbjct: 374 VVCEAVITEDVVTKVLKTTVPALVELNMLKNLTGSAIAGALGGFNAHAANIVSAIFIATG 433

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 434 QDPAQNIESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQAACLNLLGVKGA 493

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +   G N+R LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 494 SKESPGANSRLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 538


>gi|150866245|ref|XP_001385774.2| 3-hydroxy-3-methyl-glutaryl coenzyme A reductase (HMG-CoA)
           [Scheffersomyces stipitis CBS 6054]
 gi|149387501|gb|ABN67745.2| 3-hydroxy-3-methyl-glutaryl coenzyme A reductase (HMG-CoA)
           [Scheffersomyces stipitis CBS 6054]
          Length = 1047

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 182/343 (53%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G++  L  + M
Sbjct: 660 MPIPVGVAGPLIIDGK----PYHIPMATTEGCLVASTMRGCK-AINAGGGVQTVLTRDGM 714

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR   + F +     A     +    ++ I +    TS+F R   + + +AG+LLF+R  
Sbjct: 715 TRGPCVSFPSLARAGAAKLWLDSEEGQSTIKKAFNSTSRFARLQHIQTAMAGDLLFIRFR 774

Query: 127 FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             TGDA G NM++K  +  + +++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 775 TTTGDAMGMNMISKGVEYSLKYMVEECGWEDMEIISVSGNYCTDKKPAAINWIEGRGKSI 834

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VAE  I   + +K L++  + ++ LN  KNLIG+ +AG +   NAH AN++ A +LA GQ
Sbjct: 835 VAEARIPSEVVKKVLKSDVDALVELNISKNLIGSAMAGSVGGFNAHAANLVTAVFLACGQ 894

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           D A  VE S  +T  K   D L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 895 DPAQNVESSNCITLMKRVGDDLQISVSMPSIEVGTIGGGTILEPQGAMLDLLGVRGPHPT 954

Query: 305 --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             GDNAR+LA I A  VL  ELSL +A    G L+++H++  R
Sbjct: 955 NPGDNARQLARIVACAVLAAELSLCSALA-AGHLVQSHMQHNR 996


>gi|296483807|gb|DAA25922.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Bos taurus]
          Length = 888

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 186/353 (52%), Gaps = 17/353 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 585

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR   + F        + A  E       I    + TS+F R  +LH  +AG  L++
Sbjct: 586 DGMTRGPVVRFPRACDSAEVKAWLETPEGFTVIKEAFDSTSRFARLQKLHMSVAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLQEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG--- 297
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 298 -CIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
            C +    G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 826 ACRD--NPGENARQLARIVCGTVMAGELSLMAALA-AGHLVRSHMIHNRSKIN 875


>gi|301763679|ref|XP_002917256.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like
           isoform 1 [Ailuropoda melanoleuca]
 gi|281339404|gb|EFB14988.1| hypothetical protein PANDA_005466 [Ailuropoda melanoleuca]
          Length = 888

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 186/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+++ G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLRLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRILA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E       +    + TS+F R  +LH  +AG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETPEGFTVMKEAFDSTSRFARLQKLHMSMAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 826 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 875


>gi|302678413|ref|XP_003028889.1| hypothetical protein SCHCODRAFT_78529 [Schizophyllum commune H4-8]
 gi|300102578|gb|EFI93986.1| hypothetical protein SCHCODRAFT_78529 [Schizophyllum commune H4-8]
          Length = 1046

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 183/350 (52%), Gaps = 12/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  I +P+   GP+KI G      V +P+AT E  L  S  RG   ++    G+   +  
Sbjct: 636 VGYIPIPLGIAGPLKIDGV----NVHIPMATAEGTLVASASRGCK-ALNAGGGVTTVVHK 690

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR    +  +   A  A Q I        I    E TS+F +   L + IAG  LF+
Sbjct: 691 DGMTRGPAIDFPSVVQAAQAKQWIDSADGYNAIKTAFESTSRFAKLKSLQTAIAGRTLFV 750

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NM++K  +  ++ +   +  +   ++SGN C+DKK  AIN I GRGK+
Sbjct: 751 RFATSTGDAMGMNMISKGTEKALEVLQQAFPEMVTLALSGNYCTDKKPAAINWIEGRGKS 810

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            VAE  +   + +  L+T+ + +  LN +KNLIG+ +AG I   NAH AN+L A +LA G
Sbjct: 811 VVAEAVVPGRVVKSVLKTTVDALCNLNVKKNLIGSAMAGSIGGFNAHAANILTAIFLACG 870

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           QD A  VE S  +T  +  +D   L  + T+P++ +G VG G  +   +  L  LG    
Sbjct: 871 QDPAQNVESSNCMTLMEPTNDGEDLLITVTMPSIEVGTVGGGTVLAPQQAILEMLGVKGA 930

Query: 302 RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             T  G NA+ LA I AA V+ GELSL++A    G L+ AH+   R  +N
Sbjct: 931 HPTSPGQNAQTLARIVAAAVMAGELSLMSALAA-GHLIRAHMTHNRSQVN 979


>gi|73952215|ref|XP_536323.2| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-coenzyme A
           reductase (HMG-CoA reductase) isoform 1 [Canis
           familiaris]
          Length = 888

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 185/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRILA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E       I    + TS+F R  +LH  +AG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETPEGFTVIKEAFDSTSRFARLQKLHMSMAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEHFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 826 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 875


>gi|224131936|ref|XP_002328144.1| predicted protein [Populus trichocarpa]
 gi|222837659|gb|EEE76024.1| predicted protein [Populus trichocarpa]
          Length = 594

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 189/346 (54%), Gaps = 15/346 (4%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG     +C  G  + L+ + 
Sbjct: 243 MPVGYVQIPVGIAGPLLLDGKEYSVPMATTEGCLVASTNRGCKAIHVC-GGATSVLLRDA 301

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E       ++    ++S+F R   +   +AG  L++R 
Sbjct: 302 MTRAPVVRFGTAKRAAQLKLYLEDPANFEAVSTAFNKSSRFGRLQNIKCALAGKNLYMRF 361

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 362 SCSTGDAMGMNMVSKGVQNVLDFVQNDFPDMDVLGISGNYCSDKKPAAVNWIEGRGKSVV 421

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 422 CEAIIKGDVVRKVLKTNVNTLVELNMLKNLTGSAMAGALGGFNAHASNIVSAIYIATGQD 481

Query: 246 AANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG----CI 299
            A  VE S  +T  +  +  + L+ S T+P++ +G VG G  + +    L  LG    C 
Sbjct: 482 PAQNVESSHCITMMEPLNGGEDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGACK 541

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           E    G NAR LA+I A +VL GELSL++A    G+L+++H++  R
Sbjct: 542 E--TPGANARLLASIVAGSVLAGELSLMSA-IAAGQLVQSHMQYNR 584


>gi|9817458|gb|AAD20975.2| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Ips paraconfusus]
          Length = 866

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 119/345 (34%), Positives = 183/345 (53%), Gaps = 12/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+ + GP+ + G     ++ VP+AT E  L  S  RG     L   G+ + ++ 
Sbjct: 505 IGYMPIPVGYAGPLVLDGK----EIYVPMATTEGCLVASTNRGCR--ALKEAGVTSRIVA 558

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR       +   A  A+Q I      I    + +S+F R  ++  +IAG LLF+R 
Sbjct: 559 DGMTRGPVVRFPSIIRASQAMQWIQDNFDGIKEQFDSSSRFARLQRVTMKIAGRLLFIRF 618

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NM++K  +  + ++   +  +   S+SGN C+DKK  A+N I GRGK+ V
Sbjct: 619 VATTGDAMGMNMLSKGTEYSLKFVQRAFEDMEILSLSGNFCTDKKPAAVNWIEGRGKSVV 678

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  +   I    L+T+   ++ +N  KN++G+ +AG I   NAH AN++ A +LATGQD
Sbjct: 679 CEAIVPAKIVANILKTNVHALVDVNNSKNMVGSAVAGSIGGFNAHAANIVTAIFLATGQD 738

Query: 246 AANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            A  V  S  +T  +      + LY SCT+P++ +G +G G  +P     L  LG     
Sbjct: 739 PAQNVGSSNCMTLMEPWGPTGEDLYISCTMPSIEIGTIGGGTILPPQGTCLEMLGVRGSN 798

Query: 303 --KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             + G NA +LA I  ATVL GELSL++A    G L+ +HLR  R
Sbjct: 799 IAEPGANASQLAKIVGATVLAGELSLMSALA-AGHLVRSHLRHNR 842


>gi|73952225|ref|XP_860496.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-coenzyme A
           reductase (HMG-CoA reductase) isoform 7 [Canis
           familiaris]
          Length = 853

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 185/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 496 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRILA 550

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E       I    + TS+F R  +LH  +AG  L++
Sbjct: 551 DGMTRGPVVRLPRACDSAEVKAWLETPEGFTVIKEAFDSTSRFARLQKLHMSMAGRNLYI 610

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 611 RFQSRSGDAMGMNMISKGTEKALSKLHEHFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 670

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 671 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 730

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 731 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 790

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 791 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 840


>gi|124010264|ref|ZP_01694917.1| hydroxymethylglutaryl-coenzyme A reductase [Microscilla marina ATCC
           23134]
 gi|123983649|gb|EAY24089.1| hydroxymethylglutaryl-coenzyme A reductase [Microscilla marina ATCC
           23134]
          Length = 424

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 177/338 (52%), Gaps = 12/338 (3%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ + G+  Q    VPLAT E  L  S  RG     L   GI +  + E + R
Sbjct: 95  VPVGLAGPLLVKGSEAQGDFFVPLATTEGALIASYNRGMKACRL-SGGITSVCLIEGVQR 153

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S FF+ +N       ++ +  +  +   ++E TS+F +   L + I GN + L  E+ TG
Sbjct: 154 SPFFKFDNLGTVGLFIKWVYQRMDKFTEIVESTSRFAKLNDLKANIEGNSVILTFEYLTG 213

Query: 131 DASGHNMVTKAADAVMDWILSQW--SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           DA+G NMVT   D +  +IL+ +  + L +  + GN   DKKAT ++ +  RGK   AEI
Sbjct: 214 DAAGQNMVTICTDKICKYILANFDITPLEW-YIEGNYSGDKKATTLSFVNVRGKKVTAEI 272

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
            I R +  K L+T+PEKI     Q + +G   +G I  A  H AN L A ++A GQD A 
Sbjct: 273 VIPRFVVDKVLKTTPEKIAQY-WQSSTLGVIQSGAI-GAQGHVANGLTALFIACGQDVAC 330

Query: 249 IVEGSQGLTYAKLH-DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307
           I E S GLT  + + D  LY S T+P+LI+G VG G ++   K  L  LGC    K    
Sbjct: 331 ISESSIGLTRMETNTDGDLYVSVTLPSLIVGTVGGGTSLATQKECLEMLGCAGANK---- 386

Query: 308 ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           A++ A IC A  L GE+S+ +A +       AH +L R
Sbjct: 387 AKKFAEICCAVALAGEISIASAMS-ADHFTNAHQKLGR 423


>gi|49176589|gb|AAT52222.1| hydroxymethylglutaryl-CoA reductase [Catharanthus roseus]
          Length = 601

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 187/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  +P+AT E  L  S  RG   ++L   G  + L+ + 
Sbjct: 243 MPVGYVQLPVGIAGPLLLDGREYMLPMATTEGCLVASTNRGCK-AILASGGANSVLLRDG 301

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E       I+ V  ++S+F +   +   IAG  L++R 
Sbjct: 302 MTRAPVVRFGTAKRAAELKFYMEDAQNFETISVVFNKSSRFAKLQSIQCAIAGKNLYIRF 361

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V++++ + +  +    +SGN C+DKK  A+N I GRGK+ V
Sbjct: 362 SCSTGDAMGMNMVSKGVQNVLEFLQTDYPDMDVLGISGNFCADKKPAAVNWIEGRGKSVV 421

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   I +  L+T    +I LN  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 422 CEAIIKEEIVKTVLKTEVAALIELNMVKNLAGSAIAGALGGFNAHASNIVSAIFIATGQD 481

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
            A  VE SQ +T  +  +D   L+ S T+P + +G VG G  + +    L  LG     K
Sbjct: 482 PAQNVESSQCITMMEAVNDGKDLHISVTMPAIEVGAVGGGTQLASQSACLNLLGVKGASK 541

Query: 304 --TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA I A +VL GELSL++A  + G+L+ +H++  R
Sbjct: 542 DSPGANSRLLATIVAGSVLAGELSLMSA-ISAGQLVRSHMKYNR 584


>gi|156937270|ref|YP_001435066.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Ignicoccus
           hospitalis KIN4/I]
 gi|156566254|gb|ABU81659.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Ignicoccus
           hospitalis KIN4/I]
          Length = 408

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/315 (33%), Positives = 167/315 (53%), Gaps = 3/315 (0%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+K+ G+  + +  VPLAT+E  L  SV RG     L   G    ++ 
Sbjct: 68  IGAVQIPLGIAGPIKVNGDYAKGEFYVPLATHEGALVASVNRGMKAVTLS-GGANVKVLK 126

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + M R+  F   +   A   ++ +     EI  V E T++  +  ++   + GN ++LR 
Sbjct: 127 DGMARAPVFRVPDVATAQELVEWVKEHFNEIKEVAESTTRHGKLKEIQPFVMGNNVWLRF 186

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + TGDA G NM T A +   ++I   +      ++SGN+C DKK   +N ++GRGK  V
Sbjct: 187 VYFTGDAMGMNMATIATEKACEYIEENFGRAQCVALSGNMCVDKKPAHLNVLLGRGKYVV 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I + + +  L+T    +  +N +KN  G+  AG   S NAHFAN++ A +LATGQD
Sbjct: 247 AEALIKKEVLEGVLKTDARSVHEVNERKNWAGSAFAGSF-SYNAHFANIIAAIFLATGQD 305

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
           AA IVE S G T+ ++  + LY S T+P+L +G VG G  +   +  L  LG        
Sbjct: 306 AAQIVESSMGFTWTEVRGEDLYISVTLPSLEVGTVGGGTRLQTQREALEILGVAGGGDPP 365

Query: 305 GDNARRLAAICAATV 319
           G NA + A I  A+V
Sbjct: 366 GTNALKFAEIVGASV 380


>gi|118722796|gb|ABL10110.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Cistus creticus]
          Length = 388

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 123/349 (35%), Positives = 186/349 (53%), Gaps = 18/349 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRAT 62
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG    H+S     G  + 
Sbjct: 33  VGYVQIPVGIAGPLLVNGR----EYSVPMATTEGCLVASTNRGCKAIHLS----GGATSI 84

Query: 63  LIDERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           L+ ++MTR+      +A  A  L    E       +A    ++S+F R  ++    AG  
Sbjct: 85  LLKDQMTRAPVLSFGSARRAADLMFYLESPANFETLAAEFNRSSRFGRLQKIKCATAGKN 144

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           L+ R   +TGDA G NMV+K    V+D++   +  ++   +SGN CSDKK  AIN I GR
Sbjct: 145 LYPRFSCSTGDAMGMNMVSKGVQNVLDFLRKDFPDMNVLGISGNFCSDKKPAAINWIEGR 204

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ V E TI   + +K L+TS   +  LN  KNL+G+ +AG +   NAH +N++ A +L
Sbjct: 205 GKSVVCEATIKGDVVRKVLKTSVSALTELNMLKNLVGSAMAGSLGGFNAHASNIVTAVFL 264

Query: 241 ATGQDAANIVEGSQGLTY--AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           ATG D A  VE S  +T   A  + + L+ S T+P++ +G +G G  +P+    L  LG 
Sbjct: 265 ATGLDPAQNVESSNCITMMEAVNNGEDLHVSVTMPSIEVGTIGGGTQLPSQSACLNLLGV 324

Query: 299 IEERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               K   G NA+ LA I A  VL GELSL++A    G+L+++H++  R
Sbjct: 325 KGSNKDLPGANAKLLATIVAGQVLAGELSLMSALA-AGQLVKSHMKYNR 372


>gi|242062728|ref|XP_002452653.1| hypothetical protein SORBIDRAFT_04g030030 [Sorghum bicolor]
 gi|241932484|gb|EES05629.1| hypothetical protein SORBIDRAFT_04g030030 [Sorghum bicolor]
          Length = 539

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 115/346 (33%), Positives = 194/346 (56%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G    ++  +P+AT E  L  SV RG   ++    G  ++L  
Sbjct: 190 VGYVQIPVGVAGPLLLDG----EQYHIPMATTEGCLVASVNRGCR-AIAASGGAVSSLFR 244

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + M+R+   +  + + A  L    E       +A V  ++S+F +   ++  +AG  +++
Sbjct: 245 DAMSRAPVVKLPSIKRAAELKEFAEALTNFETLAAVFNRSSRFGKLQGINCALAGRNVYI 304

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K  + V+ ++ + +  +   S+SGN CSDKK  A+N I G GK+
Sbjct: 305 RFTCSTGDAMGMNMVSKGVENVLGYLQTDFPDMDIISLSGNYCSDKKPAAVNWIEGCGKS 364

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
              E T+   + Q  L+T+ +K++ LN  KNL+G+ +AG +   NAH +N++ A ++ATG
Sbjct: 365 VACEATVKGGVVQSVLKTTVQKLVELNIVKNLVGSAVAGALGGFNAHASNIVTALFIATG 424

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           QD A  VE SQ LT  +  +D   L+ S T+P++ +G +G G  + +    L  LG    
Sbjct: 425 QDPAQNVESSQCLTMMEAVNDGCDLHISVTMPSIEVGTIGGGTCLTSQAACLNLLGVKGP 484

Query: 302 R--KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G+NA+ LA I A +VL GELSL+AA  + G+L+++H++  R
Sbjct: 485 NLDSPGENAKLLATIVAGSVLAGELSLMAALAS-GQLVKSHMKYNR 529


>gi|153791820|ref|NP_001093298.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Bombyx mori]
 gi|146424696|dbj|BAF62108.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Bombyx mori]
          Length = 839

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 126/350 (36%), Positives = 185/350 (52%), Gaps = 13/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  I +P+ + GP+ + G        +P+AT E  L  S  RGA    +   G+ + + D
Sbjct: 479 IGYIGVPVGYAGPLVVDGK----PYMIPMATTEGALVASTNRGA--KAIGSRGVTSVVED 532

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
             MTR+   +  N   A    Q I  K+  A +    + TS+F R  ++H  + G  L+L
Sbjct: 533 VGMTRAPAVKLPNVVRAHECRQWIDNKENYALLKEAFDSTSRFARLQEIHVGVDGATLYL 592

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K A+  +  + + +  +   S+SGN CSDKKA AIN I GRGK 
Sbjct: 593 RFRATTGDAMGMNMVSKGAENALKLLKTFFRDMEVISLSGNYCSDKKAAAINWIKGRGKR 652

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I+    +   +T  + +   N  KNL G+ LAG I   NAH ANM+ A ++ATG
Sbjct: 653 VVCETVISSENLRTIFKTDAKTLSRCNKIKNLSGSALAGSIGGNNAHAANMVTAIFIATG 712

Query: 244 QDAANIVEGSQGLTYAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
           QD A  V  S   T  + + ++   LY +CT+P+L +G VG G  +      L  LG   
Sbjct: 713 QDPAQNVTSSNCSTNMEAYGENGEDLYVTCTMPSLEVGTVGGGTVLTGQGACLEILGVKG 772

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
              +  +N+ RLA++  ATVL GELSL+AA  N  +L+++H+R  R  LN
Sbjct: 773 AGTRPAENSARLASLICATVLAGELSLMAALVN-SDLVKSHMRHNRSTLN 821


>gi|110669099|ref|YP_658910.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Haloquadratum walsbyi
           DSM 16790]
 gi|109626846|emb|CAJ53314.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Haloquadratum walsbyi
           DSM 16790]
          Length = 406

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 119/342 (34%), Positives = 180/342 (52%), Gaps = 7/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+   GP+ + G  +  K  +PLAT E  L  SV RG  + +    G  A ++ 
Sbjct: 69  IGTIDIPIGVAGPVIVNGGALTGKRYLPLATTEGALLASVNRGCTV-LSAAGGAVARVMK 127

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             M+R+  F  +N   A   ++ +      +    E+T+       +     G  ++LR 
Sbjct: 128 SGMSRAPVFRVDNVVTAKALVEWVRDNIDSLRDAAEETTNHGELESVTPYAVGRSVYLRF 187

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NM T A +A  + ++ + +     ++SGN+C+DKK  AIN + GRG+   
Sbjct: 188 RYDTKDAMGMNMATIATEAACE-VVEKETDAELIALSGNLCTDKKPAAINAVEGRGRTVT 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++TI R      L T+P  +  LNT+KNLIG+  AG +   NAH AN++ A ++ATGQD
Sbjct: 247 ADVTIPRETVVDRLHTTPSAVAELNTRKNLIGSAKAGSL-GFNAHVANVVAAMFIATGQD 305

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
            A +VEG+  +T A++ ++ LY S +I +L +G VG G  +PA    L  LG I    T 
Sbjct: 306 EAQVVEGANAITTAEVRENDLYMSVSIASLEVGTVGGGTTLPAQAEALDMLG-IRGGGTP 364

Query: 305 -GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G NA  LA   A   L GELSLL+A  +   L  AH  L R
Sbjct: 365 PGSNADGLAECIATGALAGELSLLSALASR-NLSTAHADLGR 405


>gi|313242597|emb|CBY34727.1| unnamed protein product [Oikopleura dioica]
          Length = 787

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 115/321 (35%), Positives = 184/321 (57%), Gaps = 10/321 (3%)

Query: 18  PMKITGNVIQDKVKVP--LATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ I G ++ D ++    LAT E  L  SV RG  +  +   G + ++  + M+R+    
Sbjct: 447 PLGIVGPILVDGIECSPLLATTEGALLASVNRGCKVIKIS-GGAKTSIFRDEMSRAPCIS 505

Query: 76  TENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDAS 133
             +A  AL   Q  E       I    + T++F + L++    AG LLFLR   +TGDA 
Sbjct: 506 FPSAAAALECFQWLEDPYNFTIIKDAFQSTTRFGKLLKVTPYPAGRLLFLRFSASTGDAM 565

Query: 134 GHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRA 193
           G NMV+K  +  +D +L  +      S+SGN C+DKK +A+N I GRGK  +AE++I   
Sbjct: 566 GMNMVSKGTNKAVDTLLQLFPSARIESISGNACTDKKPSAMNWINGRGKTIIAEVSIPEK 625

Query: 194 ICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGS 253
           +     + + +++  LN +KNLIG+ +AG I   NAH AN++ A ++A+GQDAA +VEGS
Sbjct: 626 VLTANFKCTAKQLADLNVKKNLIGSNVAGSIGGFNAHAANIVAACFIASGQDAAQVVEGS 685

Query: 254 QGLT-YAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTAL-GCIEERKTGDNA 308
           Q +T + +   DS   L+ S T+P+L +  +G G N+   ++ L ++ G       GD +
Sbjct: 686 QTMTLFEERVLDSETFLHASVTMPSLEVAAMGGGTNLEPQRSILASMIGQEAGLNPGDKS 745

Query: 309 RRLAAICAATVLCGELSLLAA 329
           RRLA++ ++TVL GELSL+++
Sbjct: 746 RRLASVISSTVLAGELSLMSS 766


>gi|117671294|gb|ABK56831.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Euphorbia pekinensis]
          Length = 583

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 188/347 (54%), Gaps = 17/347 (4%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG    H+S     G  + L+
Sbjct: 231 MPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIHLS----GGADSVLL 286

Query: 65  DERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            + MTR+  + F +      L    E       ++ V  ++S F + L +   +AG  L+
Sbjct: 287 KDGMTRAPVVRFTSVRRAAELKFFLESPENFDSLSVVFNRSSGFAKLLNIQCTLAGRNLY 346

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R    TGDA G NMV+K    V++++ S +  +    +SGN CSDKK  A+N I GRGK
Sbjct: 347 MRFTCFTGDAMGMNMVSKGVQNVLEFLQSDFPDMDVLGISGNYCSDKKPAAVNWIEGRGK 406

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
             V E  I   + +K L+TS   ++ LN  KNL G+ +AG +   NAH AN++ A ++AT
Sbjct: 407 WVVCEAIIKEEVVKKVLKTSVAALVELNMVKNLAGSAVAGSLGGFNAHAANIVSAVFIAT 466

Query: 243 GQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           GQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG   
Sbjct: 467 GQDPAQNVESSHCMTMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKG 526

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +   G NAR+LA I A +VL GELSL++A    G+L+++HL+  R
Sbjct: 527 ANKESPGANARQLATIVAGSVLAGELSLMSA-IAAGQLVKSHLKYNR 572


>gi|290970517|ref|XP_002668160.1| 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) reductase [Naegleria
           gruberi]
 gi|284081377|gb|EFC35416.1| 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) reductase [Naegleria
           gruberi]
          Length = 320

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 118/319 (36%), Positives = 179/319 (56%), Gaps = 8/319 (2%)

Query: 34  LATYEYPLWHSVKRGAH-ISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITLK 92
           +AT E  L  S  RG   +S     G+ + ++ + MTR    +  N +      Q I   
Sbjct: 1   MATVEGCLVASTHRGCKALSSSFEGGVNSVILSDGMTRGPVVQFANTKRCNELKQFIDNP 60

Query: 93  K--AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWIL 150
           +   E+ RV    S+F R L++   IAG   FLR +  TGDA G NM++KA    + ++ 
Sbjct: 61  ENFKELCRVFNSDSRFARLLEVKVGIAGRKAFLRFKCRTGDAMGMNMISKATQKALKFLK 120

Query: 151 SQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILL 209
           ++ +  +   S+SGN C+DKK +A+N I GRGK+ V + TI + + +  L+T+ ++I+ L
Sbjct: 121 NEHFQDMDILSLSGNYCTDKKPSAMNWIEGRGKSVVVDATIPKDVVKNVLKTTVDEIVSL 180

Query: 210 NTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDD-SLYF 268
           N  KNLIG+ +AG +   NAH AN++ A +LATGQDAA  VE S  +T  +  D+  LY 
Sbjct: 181 NISKNLIGSAMAGSVGGFNAHAANIVTAIFLATGQDAAQNVESSNCMTIMEKTDNGDLYV 240

Query: 269 SCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGDNARRLAAICAATVLCGELSL 326
           S T+P++ +G VG G ++ A K  L  +G     +   G NA+ LA   A+TV+ GELSL
Sbjct: 241 SVTMPSIEVGTVGGGTHLDAQKTCLKIIGVAGANQENPGQNAQTLAKCVASTVMAGELSL 300

Query: 327 LAAQTNPGELMEAHLRLER 345
           +AA      L+ AH+   R
Sbjct: 301 MAALA-ADHLVSAHIAHNR 318


>gi|313216245|emb|CBY37589.1| unnamed protein product [Oikopleura dioica]
          Length = 804

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 115/321 (35%), Positives = 184/321 (57%), Gaps = 10/321 (3%)

Query: 18  PMKITGNVIQDKVKVP--LATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ I G ++ D ++    LAT E  L  SV RG  +  +   G + ++  + M+R+    
Sbjct: 447 PLGIVGPILVDGIECSPLLATTEGALLASVNRGCKVIKIS-GGAKTSIFRDEMSRAPCIS 505

Query: 76  TENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDAS 133
             +A  AL   Q  E       I    + T++F + L++    AG LLFLR   +TGDA 
Sbjct: 506 FPSAAAALECFQWLEDPYNFTIIKDAFQSTTRFGKLLKVTPYPAGRLLFLRFSASTGDAM 565

Query: 134 GHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRA 193
           G NMV+K  +  +D +L  +      S+SGN C+DKK +A+N I GRGK  +AE++I   
Sbjct: 566 GMNMVSKGTNKAVDTLLQLFPSARIESISGNACTDKKPSAMNWINGRGKTIIAEVSIPEK 625

Query: 194 ICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGS 253
           +     + + +++  LN +KNLIG+ +AG I   NAH AN++ A ++A+GQDAA +VEGS
Sbjct: 626 VLTANFKCTAKQLADLNVKKNLIGSNIAGSIGGFNAHAANIVAACFIASGQDAAQVVEGS 685

Query: 254 QGLT-YAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTAL-GCIEERKTGDNA 308
           Q +T + +   DS   L+ S T+P+L +  +G G N+   ++ L ++ G       GD +
Sbjct: 686 QTMTLFEERVLDSETFLHASVTMPSLEVAAMGGGTNLEPQRSILASMIGQEAGLNPGDKS 745

Query: 309 RRLAAICAATVLCGELSLLAA 329
           +RLA++ A+TVL GELSL+++
Sbjct: 746 KRLASVIASTVLAGELSLMSS 766


>gi|148222950|ref|NP_001081280.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Xenopus laevis]
 gi|123347|sp|P20715|HMDH_XENLA RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|214237|gb|AAA49740.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Xenopus laevis]
          Length = 883

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 189/353 (53%), Gaps = 17/353 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ +     Q    VP+AT E  L  S  RG    ML   G ++ ++ 
Sbjct: 526 IGYMPIPVGVAGPLLLNNKEYQ----VPMATTEGCLVASTNRGCRAIML-GGGAKSRVLA 580

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVI----EQTSQFTRFLQLHSQIAGNLL 121
           + MTR        A  A  A  +  L  AE  +VI    + TS+F R  +L + +AG  L
Sbjct: 581 DGMTRGPVVRLPTACDA--AEVKAWLDSAEGFKVIKDAFDSTSRFARLGRLQNCVAGRNL 638

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           ++R +  TGDA G NM++K  +  +  +  ++  LH  +VSGN C+DKK  AIN I GRG
Sbjct: 639 YIRFQSKTGDAMGMNMISKVTEQALARLQEEFPDLHVLAVSGNYCTDKKPAAINWIEGRG 698

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  I   + ++ L++S E ++ +N  KN IG+ +AG I   NAH AN++ A Y+A
Sbjct: 699 KSVVCEAIIPAKVVREVLKSSTEALVEVNINKNFIGSAMAGSIGGYNAHAANIVTAIYIA 758

Query: 242 TGQDAANIVEGSQGLTYAKLHD---DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
            GQDAA  V  S  +T  +      + LY SCT+P++ +G VG G N+   +  L  LG 
Sbjct: 759 CGQDAAQNVGSSNCITIMEATGPTYEDLYISCTMPSIEIGTVGGGTNLAPQQACLQMLGV 818

Query: 299 --IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                   G NA +LA I  +TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 819 QGASTETPGKNACQLAQIVCSTVMAGELSLMAALAA-GHLVKSHMVHNRSKIN 870


>gi|118422503|gb|ABK88909.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Atractylodes
           lancea]
          Length = 583

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 190/347 (54%), Gaps = 15/347 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  I +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    L+ 
Sbjct: 235 VGYIQIPVGIAGPLLLNGA----EFSVPMATTEGCLVASTNRGCK-AIYMSGGATCMLLK 289

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLL 121
           + MTR+      +A+ A  A  ++ L+  E    +A V  ++S+F +   +   IAG   
Sbjct: 290 DGMTRAPVVRFGSAKRA--AELKLFLEDPENFDTLAVVFNKSSRFGKLQSIKCAIAGKNT 347

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           ++R   +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRG
Sbjct: 348 YIRFCCSTGDAMGMNMVSKGVQNVLDYLQTDFPDMDVMGISGNYCSDKKPAAVNWIEGRG 407

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+A
Sbjct: 408 KSVVCEAVIKEEVVRKVLKTNVASLVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIA 467

Query: 242 TGQDAANIVEGSQGLTYAKL--HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
           TGQD A  VE S  +T  +   +D  L+ S T+P++ +G VG G  + +    L  LG  
Sbjct: 468 TGQDPAQNVESSHCITMMEAINNDKDLHISVTMPSIEVGTVGGGTQLASQAACLNLLGVK 527

Query: 300 -EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              ++ G N+R LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 528 GASKEAGSNSRVLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 573


>gi|255539334|ref|XP_002510732.1| hmg-CoA reductase, putative [Ricinus communis]
 gi|223551433|gb|EEF52919.1| hmg-CoA reductase, putative [Ricinus communis]
          Length = 576

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 122/349 (34%), Positives = 192/349 (55%), Gaps = 21/349 (6%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG    H+S     G  + L+
Sbjct: 225 MPVGYVQIPVGIAGPLLLDGREYSVPMATTEGCLVASTNRGCKAIHLS----GGANSVLL 280

Query: 65  DERMTRSIFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNL 120
            + MTR+      +A  A  A  +  L+  E    ++ V  ++S+F +   +   IAG  
Sbjct: 281 KDGMTRAPVVRFGSA--ARAAELKFFLENPENFDTLSVVFNRSSRFAKLQAIQCAIAGKN 338

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           L++R   +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GR
Sbjct: 339 LYMRFSCSTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNFCSDKKPAAVNWIEGR 398

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH AN++ A ++
Sbjct: 399 GKSVVCEAIIKEEVVKKVLKTNVASLVELNVLKNLTGSAVAGALGGFNAHAANIVSAIFI 458

Query: 241 ATGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           ATGQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG 
Sbjct: 459 ATGQDPAQNVESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGV 518

Query: 299 --IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               +   G N+R LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 519 KGASKESPGSNSRLLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 566


>gi|143811402|sp|Q9Y7D2|HMDH_ASPTE RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
            Short=HMG-CoA reductase
          Length = 1048

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 126/346 (36%), Positives = 185/346 (53%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GPM I G  +     +P+AT E  L  S  RG   ++    G    L  
Sbjct: 701  VGYLPLPLGVAGPMVIDGQAL----FIPMATTEGVLVASASRGCK-AINAGGGATTMLKG 755

Query: 66   ERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR       +A+ A  A +  E  L    +A     TS+F R   L    AG  L++
Sbjct: 756  DGMTRGPCLRFPSAQRAAEAQRWVESPLGHEVLAAAFNATSRFARLQTLTVAQAGIYLYI 815

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +  ++ + ++  +  +H  ++SGN CSDKK+ AIN I GRG
Sbjct: 816  RFRTTTGDAMGMNMISKGVEKALEAMAAEGGFPDMHTVTLSGNFCSDKKSAAINWIGGRG 875

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ +AE TI     ++ L+T  + ++ LNT KNL+G+ +AG +   NAH +N++ A +LA
Sbjct: 876  KSVIAEATIPAETVRQVLKTDVDALVELNTAKNLVGSAMAGSLGGFNAHASNLVQAVFLA 935

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A  VE S  +T  K  D +L+ + ++P++ +G +G G  + A    L  LG    
Sbjct: 936  TGQDPAQNVESSSCITTMKNIDGNLHIAVSMPSMEVGTIGGGTILEAQGAMLDLLGVRGA 995

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  G NARRLA I AA VL GELS  AA    G L+ AH++  R
Sbjct: 996  HSTEPGANARRLARIVAAAVLAGELSTCAALAA-GHLVNAHMQHNR 1040


>gi|4959949|gb|AAD34556.1| hydroxymethylglutaryl-coenzyme A reductase [Aspergillus terreus]
          Length = 1068

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 126/346 (36%), Positives = 185/346 (53%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GPM I G  +     +P+AT E  L  S  RG   ++    G    L  
Sbjct: 675  VGYLPLPLGVAGPMVIDGQAL----FIPMATTEGVLVASASRGCK-AINAGGGATTMLKG 729

Query: 66   ERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR       +A+ A  A +  E  L    +A     TS+F R   L    AG  L++
Sbjct: 730  DGMTRGPCLRFPSAQRAAEAQRWVESPLGHEVLAAAFNATSRFARLQTLTVAQAGIYLYI 789

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +  ++ + ++  +  +H  ++SGN CSDKK+ AIN I GRG
Sbjct: 790  RFRTTTGDAMGMNMISKGVEKALEAMAAEGGFPDMHTVTLSGNFCSDKKSAAINWIGGRG 849

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ +AE TI     ++ L+T  + ++ LNT KNL+G+ +AG +   NAH +N++ A +LA
Sbjct: 850  KSVIAEATIPAETVRQVLKTDVDALVELNTAKNLVGSAMAGSLGGFNAHASNLVQAVFLA 909

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A  VE S  +T  K  D +L+ + ++P++ +G +G G  + A    L  LG    
Sbjct: 910  TGQDPAQNVESSSCITTMKNIDGNLHIAVSMPSMEVGTIGGGTILEAQGAMLDLLGVRGA 969

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  G NARRLA I AA VL GELS  AA    G L+ AH++  R
Sbjct: 970  HSTEPGANARRLARIVAAAVLAGELSTCAALAA-GHLVNAHMQHNR 1014


>gi|49257596|gb|AAH74197.1| Hmgcr protein [Xenopus laevis]
          Length = 883

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 189/353 (53%), Gaps = 17/353 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ +     Q    VP+AT E  L  S  RG    ML   G ++ ++ 
Sbjct: 526 IGYMPIPVGVAGPLLLNNKEYQ----VPMATTEGCLVASTNRGCRAIML-GGGAKSRVLA 580

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVI----EQTSQFTRFLQLHSQIAGNLL 121
           + MTR        A  A  A  +  L  AE  +VI    + TS+F R  +L + +AG  L
Sbjct: 581 DGMTRGPVVRLPTACDA--AEVKAWLDSAEGFKVIKDAFDSTSRFARLGRLQNCVAGRNL 638

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           ++R +  TGDA G NM++K  +  +  +  ++  LH  +VSGN C+DKK  AIN I GRG
Sbjct: 639 YIRFQSKTGDAMGMNMISKGTEQALARLQEEFPDLHVLAVSGNYCTDKKPAAINWIEGRG 698

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  I   + ++ L++S E ++ +N  KN IG+ +AG I   NAH AN++ A Y+A
Sbjct: 699 KSVVCEAIIPAKVVREVLKSSTEALVEVNINKNFIGSAMAGSIGGYNAHAANIVTAIYIA 758

Query: 242 TGQDAANIVEGSQGLTYAKLHD---DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
            GQDAA  V  S  +T  +      + LY SCT+P++ +G VG G N+   +  L  LG 
Sbjct: 759 CGQDAAQNVGSSNCITIMEATGPTYEDLYISCTMPSIEIGTVGGGTNLAPQQACLQMLGV 818

Query: 299 --IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                   G NA +LA I  +TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 819 QGASTETPGKNACQLAQIVCSTVMAGELSLMAALAA-GHLVKSHMVHNRSKIN 870


>gi|115385441|ref|XP_001209267.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aspergillus terreus
            NIH2624]
 gi|121733429|sp|Q0C8L9|HMDH_ASPTN RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
            Short=HMG-CoA reductase
 gi|114187714|gb|EAU29414.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aspergillus terreus
            NIH2624]
          Length = 1048

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 126/346 (36%), Positives = 185/346 (53%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GPM I G  +     +P+AT E  L  S  RG   ++    G    L  
Sbjct: 701  VGYLPLPLGVAGPMVIDGQAL----FIPMATTEGVLVASASRGCK-AINAGGGATTMLKG 755

Query: 66   ERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR       +A+ A  A +  E  L    +A     TS+F R   L    AG  L++
Sbjct: 756  DGMTRGPCLRFPSAQRAAEAQRWVESPLGHEVLAAAFNATSRFARLQTLTVAQAGIYLYI 815

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +  ++ + ++  +  +H  ++SGN CSDKK+ AIN I GRG
Sbjct: 816  RFRTTTGDAMGMNMISKGVEKALEAMAAEGGFPDMHTVTLSGNFCSDKKSAAINWIGGRG 875

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ +AE TI     ++ L+T  + ++ LNT KNL+G+ +AG +   NAH +N++ A +LA
Sbjct: 876  KSVIAEATIPAETVRQVLKTDVDALVELNTAKNLVGSAMAGSLGGFNAHASNLVQAVFLA 935

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A  VE S  +T  K  D +L+ + ++P++ +G +G G  + A    L  LG    
Sbjct: 936  TGQDPAQNVESSSCITTMKNIDGNLHIAVSMPSMEVGTIGGGTILEAQGAMLDLLGVRGA 995

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  G NARRLA I AA VL GELS  AA    G L+ AH++  R
Sbjct: 996  HATEPGANARRLARIVAAAVLAGELSTCAALAA-GHLVNAHMQHNR 1040


>gi|224115408|ref|XP_002317026.1| predicted protein [Populus trichocarpa]
 gi|222860091|gb|EEE97638.1| predicted protein [Populus trichocarpa]
          Length = 588

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/346 (33%), Positives = 184/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ 
Sbjct: 237 VGYVQIPVGVAGPLLLDGK----EYTVPMATTEGCLVASTNRGCK-AIYASGGASSVLLR 291

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F T      L    E       +  V  ++S+F R   +   IAG  L++
Sbjct: 292 DGMTRAPVVRFGTAKRAAELKFFTEDPANFDTLGVVFNRSSRFGRLQNIKCTIAGKNLYM 351

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+
Sbjct: 352 RFSCSTGDAMGMNMVSKGVQNVLDYLQTDFPDMEIIGISGNFCSDKKPAAVNWIEGRGKS 411

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  +   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATG
Sbjct: 412 VVCEAIMKEEVVRKVLKTNVATLVELNMLKNLTGSAMAGALGGFNAHASNIVTAVYIATG 471

Query: 244 QDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           QD A  VE S  +T  +  +    L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 472 QDPAQNVESSHCITMMEAVNGGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 531

Query: 302 RK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            K   G N+R L+ I A +VL GELSL++A    G+L+++H++  R
Sbjct: 532 SKDSPGSNSRLLSTIIAGSVLAGELSLMSA-IAAGQLIKSHMKYNR 576


>gi|15624082|gb|AAL03986.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Malus x domestica]
          Length = 588

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 183/346 (52%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG     L   G  + L+ 
Sbjct: 238 VGYVQIPVGIAGPLMLDGR----EFSVPMATTEGCLVASTNRGFKAINLS-GGATSVLLR 292

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E       ++ V  ++S+F R   +   IAG  L++
Sbjct: 293 DGMTRAPCVRFNSAKRAAELKFYLEEPKNYDTLSTVFNRSSRFGRLQTIKCAIAGKNLYM 352

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+
Sbjct: 353 RFTCSTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKS 412

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+   +  LN  KNL G+ +AG +   NAH +N++ A Y+ATG
Sbjct: 413 VVCEAVIKGDVVQKVLKTNVASLCELNMLKNLTGSAMAGALGGFNAHASNIVSAIYIATG 472

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 473 QDPAQNVESSHCITMMEPINDGQDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 532

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A +VL GELSL++A  + G+L+ +H++  R
Sbjct: 533 NREAPGSNARLLATVVAGSVLAGELSLMSA-ISAGQLVNSHMKYNR 577


>gi|85700242|gb|ABC74565.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Picrorhiza kurrooa]
          Length = 561

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/341 (34%), Positives = 185/341 (54%), Gaps = 12/341 (3%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    L+ + MTR
Sbjct: 217 IPVGIAGPLLLNGC----EYSVPMATTEGCLVASTNRGCK-AIYASGGATCVLLRDAMTR 271

Query: 71  S--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           +  + F +      L    E  L    ++ V  ++S+F R   +   IAG  L++R   +
Sbjct: 272 APVVRFSSVKRATDLKFFLEDPLNFDTLSVVFNKSSRFARLQSIQCGIAGKNLYIRFSCS 331

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V E 
Sbjct: 332 TGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEA 391

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
            I+  I  K L+T+   ++ LN  KNL G+ +AG +   NAH AN++ A ++ATGQD A 
Sbjct: 392 VISGDIVTKVLKTNVASLVELNMLKNLAGSAIAGALGGFNAHAANIVSAIFIATGQDPAQ 451

Query: 249 IVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKT 304
            +E S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     +   
Sbjct: 452 NIESSHCITMMEAVNDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKESP 511

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G N++ LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 512 GSNSQLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 551


>gi|213626231|gb|AAI70008.1| Unknown (protein for MGC:196735) [Xenopus laevis]
          Length = 883

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 127/354 (35%), Positives = 190/354 (53%), Gaps = 19/354 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ +     Q    VP+AT E  L  S  RG    ML   G ++ ++ 
Sbjct: 526 IGYMPIPVGVAGPLLLNNKEYQ----VPMATTEGCLVASTNRGCRAIML-GGGAKSRVLA 580

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVI----EQTSQFTRFLQLHSQIAGNLL 121
           + MTR        A  A  A  +  L  AE  +VI    + TS+F R  +L + +AG  L
Sbjct: 581 DGMTRGPVVRLPTACDA--AEVKAWLDSAEGFKVIKDAFDSTSRFARLGRLQNCVAGRNL 638

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           ++R +  TGDA G NM++K  +  +  +  ++  LH  +VSGN C+DKK  AIN I GRG
Sbjct: 639 YIRFQSKTGDAMGMNMISKGTEQALARLQEEFPDLHVLAVSGNYCTDKKPAAINWIEGRG 698

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  I   + ++ L++S E ++ +N  KN IG+ +AG I   NAH AN++ A Y+A
Sbjct: 699 KSVVCEAIIPAKVVREVLKSSTEALVEVNINKNFIGSAMAGSIGGYNAHAANIVTAIYIA 758

Query: 242 TGQDAANIVEGSQGLTY----AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
            GQDAA  V  S  +T        ++D LY SCT+P++ +G VG G N+   +  L  LG
Sbjct: 759 CGQDAAQNVGSSNCITIMVATGPTYED-LYISCTMPSIEIGTVGGGTNLAPQQACLQMLG 817

Query: 298 C--IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                    G NA +LA I  +TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 818 VQGASTETPGKNACQLAQIVCSTVMAGELSLMAALAA-GHLVKSHMVHNRSKIN 870


>gi|123341|sp|P00347|HMDH_CRIGR RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|49648|emb|CAA25189.1| HMG CoA reductase [Mesocricetus auratus]
 gi|387052|gb|AAA36989.1| 3-hydroxy-3-methylglutaryl coenzyme A [Mesocricetus auratus]
 gi|223946|prf||1005248A reductase,HMG CoA
          Length = 887

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 184/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 530 IGYMPIPVGVAGPLCLDGKEYQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 584

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E     A I    + TS+F R  +LH  +AG  L++
Sbjct: 585 DGMTRGPVVRLPRACDSAEVKAWLETPEGFAVIKDAFDSTSRFARLQKLHVTMAGRNLYI 644

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK 
Sbjct: 645 RFQSKTGDAMGMNMISKGTEKALLKLQEFFPEMQILAVSGNYCTDKKPAAINWIEGRGKT 704

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 705 VVCEAVIPAKVVREVLKTTTEAMIDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 764

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 765 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 824

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 825 ACKDNPGENARQLARIVCGTVMAGELSLMAALAA-GHLVRSHMVHNRSKIN 874


>gi|324505731|gb|ADY42458.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Ascaris suum]
          Length = 633

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 132/348 (37%), Positives = 189/348 (54%), Gaps = 15/348 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P    GP+ + G     +  +PLAT E  L  S  RG   ++    G    +  + M
Sbjct: 233 VPLPTGIAGPLIVNGR----RYFIPLATTEGALVASTNRGCR-ALTESGGAIVRVYKDAM 287

Query: 69  TRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+   + E+A  AL      E       + R  + TS + R  +L +   G LLF+R E
Sbjct: 288 TRAPVVQLESAVRALELKHWLENPTNFEGLKRTFDTTSNYARLQKLDADPIGRLLFIRFE 347

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV+K  + VM  +  ++  +   S+SGN C DKKA A+N I GRGK+ V+
Sbjct: 348 AKTGDAMGMNMVSKGVNMVMTTLKKEFPGMEVLSLSGNYCVDKKACALNWIKGRGKSVVS 407

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  +  ++ +  L+T  + +  L   K LIG+ +AG +   NAH AN++ A +LATGQDA
Sbjct: 408 EAVVPASVVRNVLKTDVDSMCRLAETKLLIGSSIAGTVGGWNAHAANVVAATFLATGQDA 467

Query: 247 ANIVEGSQGLTY---AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
           A +V  S  LT     KL D  LY SC +  L +G VG G  +PA ++ L  LGC   + 
Sbjct: 468 AQVVSSSMCLTSMEKTKLGD--LYVSCNMRCLEVGTVGGGTILPAQRSCLEVLGCAGADR 525

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
              G NA+RLA I  ATV+ GELSL+AAQ +  +L+++HLRL R   N
Sbjct: 526 ANPGGNAKRLAEIICATVMAGELSLMAAQCS-DDLIKSHLRLNRSTRN 572


>gi|297839521|ref|XP_002887642.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis lyrata subsp.
           lyrata]
 gi|297333483|gb|EFH63901.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis lyrata subsp.
           lyrata]
          Length = 635

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 185/344 (53%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ +I  P+ I G ++ D  +  VP+AT E  L  S  RG   +M    G  +T++ + 
Sbjct: 280 MPVGYIQIPVGIAGPLLLDGYEYSVPMATTEGCLVASTNRGCK-AMYISGGATSTVLKDG 338

Query: 68  MTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+      +A  A  L    E       +  V  ++S+F R   +   IAG   ++R 
Sbjct: 339 MTRAPVVRFASARRASELKFFLENPENFDTLTVVFNRSSRFARLQSVKCTIAGKNAYVRF 398

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V++++   +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 399 CCSTGDAMGMNMVSKGVQNVLEYLTDDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 458

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   I  K L+TS   ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 459 CEAVIKGEIVNKVLKTSVAALVELNMLKNLAGSAVAGSLGGFNAHASNIVSAVFIATGQD 518

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE SQ +T  +  +D   ++ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 519 PAQNVESSQCITMMEAINDGKDIHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 578

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+RRLA I A  VL GELSL++A    G+L+ +H++  R
Sbjct: 579 ESPGMNSRRLATIVAGAVLAGELSLMSA-IAAGQLVRSHMKYNR 621


>gi|40538852|ref|NP_037266.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Rattus norvegicus]
 gi|118573791|sp|P51639|HMDH_RAT RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|40352928|gb|AAH64654.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Rattus norvegicus]
 gi|149059113|gb|EDM10120.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Rattus norvegicus]
          Length = 887

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 185/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 530 IGYMPIPVGVAGPLCLDGKEYQ----VPMATTEGCLVASTNRGCRAISL-GGGASSRVLA 584

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + M+R        A     + +  E     A +    + TS+F R  +LH  +AG  L++
Sbjct: 585 DGMSRGPVVRLPRACDSAEVKSWLETPEGFAVVKEAFDSTSRFARLQKLHVTLAGRNLYI 644

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           RL+  TGDA G NM++K  +  +  +   +  L   +VSGN C+DKK  AIN I GRGK 
Sbjct: 645 RLQSKTGDAMGMNMISKGTEKALLKLQEFFPELQILAVSGNYCTDKKPAAINWIEGRGKT 704

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 705 VVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 764

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 765 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 824

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 825 ACKDNPGENARQLARIVCGTVMAGELSLMAALAA-GHLVRSHMVHNRSKIN 874


>gi|15421167|gb|AAK95406.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Malus x domestica]
          Length = 608

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 183/346 (52%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG     L   G  + L+ 
Sbjct: 258 VGYVQIPVGIAGPLMLHGR----EFSVPMATTEGCLVASTNRGFKAINLS-GGATSVLLR 312

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E       ++ V  ++S+F R   +   IAG  L++
Sbjct: 313 DGMTRAPCVRFNSAKRAAELKFYLEEPNNYDTLSTVFNRSSRFGRLQTIKCAIAGKNLYM 372

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+
Sbjct: 373 RFTCSTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKS 432

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+   +  LN  KNL G+ +AG +   NAH +N++ A Y+ATG
Sbjct: 433 VVCEAVIKGDVVQKVLKTNVASLCELNMLKNLTGSAMAGALGGFNAHASNIVSAIYIATG 492

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 493 QDPAQNVESSHCITMMEPINDGQDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 552

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A +VL GELSL++A  + G+LM +H++  R
Sbjct: 553 NREAPGSNARLLATVVAGSVLAGELSLMSA-ISAGQLMNSHMKYYR 597


>gi|123344|sp|P09610|HMDH_MESAU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|305355|gb|AAA37077.1| 3-hydroxy-3-methylglutaral coenzyme A reductase (EC 1.1.1.34)
           [Mesocricetus auratus]
          Length = 887

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 184/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 530 IGYMPIPVGVAGPLCLDGKEYQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 584

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E     A I    + TS+F R  +LH  +AG  L++
Sbjct: 585 DGMTRGPVVRLPRACDSAEVKAWLETPEGFAVIKDAFDSTSRFARLQKLHVTMAGRNLYI 644

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +   +  +   +VSGN C+DKK  A+N I GRGK 
Sbjct: 645 RFQSKTGDAMGMNMISKGTEKALVKLQEFFPEMQILAVSGNYCTDKKPAAVNWIEGRGKT 704

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 705 VVCEAVIPARVVREVLKTTTEAMIDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 764

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 765 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 824

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 825 ACKDNPGENARQLARIVCGTVMAGELSLMAALAA-GHLVRSHMVHNRSKIN 874


>gi|37604194|gb|AAH59873.1| Hmgcr protein [Mus musculus]
          Length = 497

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 183/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 140 IGYMPIPVGVAGPLCLDGKDYQ----VPMATTEGCLVASTNRGCRAISL-GGGASSRVLA 194

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     +    E     A I    + TS+F R  +LH  +AG  L++
Sbjct: 195 DGMTRGPVVRLPRACDSAEVKTWLETPEGFAVIKEAFDSTSRFARLQKLHVTMAGRNLYI 254

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK 
Sbjct: 255 RFQSRTGDAMGMNMISKGTEKALLKLQEFFPDMQILAVSGNYCTDKKPAAINWIEGRGKT 314

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 315 VVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 374

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 375 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 434

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 435 ACKDNPGENARQLARIVCGTVMAGELSLMAALAA-GHLVRSHMVHNRSKIN 484


>gi|147886290|gb|ABQ52378.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Malus x domestica]
          Length = 569

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 189/348 (54%), Gaps = 19/348 (5%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           MP+ ++  P  + G ++ D  +  VP+AT E  L  S  RG    H+S     G+  +++
Sbjct: 216 MPVGYVQIPAGVAGPLLIDDEEYTVPMATTEGCLVASTNRGCKAIHMS-----GVAGSVV 270

Query: 65  -DERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
             + MTR+  + F +      L    E  L    +A V  ++S+F +  ++   +AG  L
Sbjct: 271 LKDGMTRAPVVRFSSAVRAAELKFFVEDPLNFDSLAVVFNRSSRFAKLQRIQCSMAGKNL 330

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           ++R   +TGDA G NMV+K A  V+D +   +  +    +SGN CSDKK  A+N I GRG
Sbjct: 331 YMRFTCSTGDAMGMNMVSKGAQNVLDLLQIDFPDMDVIGISGNFCSDKKPAAVNWIEGRG 390

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+A
Sbjct: 391 KSVVCEAVIKEEVVRKVLKTNVAALVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIA 450

Query: 242 TGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC- 298
           TGQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG  
Sbjct: 451 TGQDPAQNVESSHCITMMEAINDGKDLHVSVTMPSIEVGTVGGGTQLASQAACLNLLGVK 510

Query: 299 -IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                  G N+R+LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 511 GASRDSPGSNSRKLATIVAGSVLAGELSLMSA-IAAGQLVNSHMKYNR 557


>gi|224083368|ref|XP_002306999.1| predicted protein [Populus trichocarpa]
 gi|222856448|gb|EEE93995.1| predicted protein [Populus trichocarpa]
          Length = 563

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 185/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L  
Sbjct: 214 VGYVQIPVGIAGPLSLNGM----EFMVPMATTEGCLVASTNRGCK-AIYASGGASSVLYA 268

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + FET      L    E       ++ V  ++S+F R   +   +AG  L++
Sbjct: 269 DGMTRAPVVRFETAKRASELKFFLEDPDNFDTLSIVFNRSSRFGRLQGIQCAMAGKNLYI 328

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R + +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+
Sbjct: 329 RFKCSTGDAMGMNMVSKGVQNVLDFLQADFPDMEVIGLSGNYCSDKKPAAVNWIGGRGKS 388

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   I +K L+TS   ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 389 VVCEAIIKEEIVKKVLKTSVASLVELNMLKNLAGSAIAGALGGFNAHASNIVSAVFIATG 448

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 449 QDPAQNVESSNCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 508

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G N+  LA I A +VL GELSL+AA    G+L+++H++  R
Sbjct: 509 SREAAGSNSVLLANIVAGSVLAGELSLMAAIAQ-GQLVKSHMKYNR 553


>gi|190610817|gb|ACE80254.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Pyrus pyrifolia]
          Length = 569

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 189/348 (54%), Gaps = 19/348 (5%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           MP+ ++  P  + G ++ D  +  VP+AT E  L  S  RG    H+S     G+  +++
Sbjct: 216 MPVGYVQIPAGVAGPLLIDDEEYTVPMATTEGCLVASTNRGCKAIHMS-----GVAGSVV 270

Query: 65  -DERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
             + MTR+  + F +      L    E  L    +A V  ++S+F +  ++   +AG  L
Sbjct: 271 LKDGMTRAPVVRFSSAVRAAELKFFVEDPLNFDSLAVVFNRSSRFAKLQRIQCSMAGKNL 330

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           ++R   +TGDA G NMV+K A  V+D +   +  +    +SGN CSDKK  A+N I GRG
Sbjct: 331 YMRFTCSTGDAMGMNMVSKGAQNVLDLLQIDFPDMDVIGISGNFCSDKKPAAVNWIEGRG 390

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+A
Sbjct: 391 KSVVCEAVIKEEVVRKVLKTNVAALVELNMLKNLTGSAMAGALGGFNAHASNIVAAIYIA 450

Query: 242 TGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC- 298
           TGQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG  
Sbjct: 451 TGQDPAQNVESSHCITMMEAINDGKDLHVSVTMPSIEVGTVGGGTQLASQAACLNLLGVK 510

Query: 299 -IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                  G N+R+LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 511 GASRDSPGSNSRKLATIVAGSVLAGELSLMSA-IAAGQLVNSHMKYNR 557


>gi|15824453|gb|AAL09351.1|AF304440_1 3-hydroxy-3-methylglutaryl coenzyme A reductase [Ips pini]
          Length = 866

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 119/345 (34%), Positives = 182/345 (52%), Gaps = 12/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+ + GP+ + G     +V VP+AT E  L  S  RG     L   G+ + ++ 
Sbjct: 505 IGYMPIPVGFAGPLVLDGK----EVYVPMATTEGCLVASTNRGCR--ALKEGGVTSRIVA 558

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR       +   A  A+Q I      I    + +S+F R  ++  +IAG LLF+R 
Sbjct: 559 DGMTRGPVVRFPSIIRASQAMQWIQDNFDGIKEQFDSSSRFARLQRVTMKIAGRLLFIRF 618

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NM++K  +  + ++   +  +   S+SGN C+DKK  A+N I GRGK+ V
Sbjct: 619 VATTGDAMGMNMLSKGTEYSLKFVQRAFEDMEILSLSGNFCTDKKPAAVNWIEGRGKSVV 678

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  +   I    L+T+   ++ +N  KN++G+ +AG I   NAH AN++ A +LATGQD
Sbjct: 679 CEAIVPAKIVANILKTNVHALVDVNNSKNMVGSAVAGSIGGFNAHAANIVTAIFLATGQD 738

Query: 246 AANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IE 300
            A  V     +T  +      + LY SCT+P++ +G +G G  +P     L  LG     
Sbjct: 739 PAQNVGSCNCMTLMEPWGPTGEDLYISCTMPSIEIGTIGGGTILPPQGTCLEMLGVRGSN 798

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             + G NA +LA I  ATVL GELSL++A    G L+ +HLR  R
Sbjct: 799 TAEPGANASQLAKIVGATVLAGELSLMSALA-AGHLVRSHLRHNR 842


>gi|294656585|ref|XP_458872.2| DEHA2D09372p [Debaryomyces hansenii CBS767]
 gi|199431582|emb|CAG87024.2| DEHA2D09372p [Debaryomyces hansenii]
          Length = 1043

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 181/343 (52%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G+ + L  + M
Sbjct: 666  MPLPVGVAGPLIIDGK----PYHIPMATTEGCLVASTMRGCK-AINAGGGVESVLTQDGM 720

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F + +   A     +    +  I +    TS+F R   + + +AG LLF+R  
Sbjct: 721  TRGPCVSFPSLSRAGACKLWLDSEEGQKTIKKAFNSTSRFARLQHIQTALAGTLLFIRFR 780

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  + ++  +  WS +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 781  TTTGDAMGMNMISKGVEYSLKYMSEECDWSDMEVISVSGNYCTDKKPAAINWIEGRGKSV 840

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I  ++ QK L++  + ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 841  VAEARIPASVVQKVLKSDVDALVELNISKNLVGSAMAGSVGGFNAHAANLVTAVFLACGQ 900

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K     L  S ++P + +G +G G  +      L  LG      T
Sbjct: 901  DPAQNVESSNCITLMKNVGGDLQISVSMPCIEVGTIGGGTILEPQGAMLDLLGVRGPHPT 960

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNAR+LA I A+ VL  ELSL +A    G L+++H++  R
Sbjct: 961  NPGDNARQLARIVASAVLAAELSLCSALA-AGHLVQSHMQHNR 1002


>gi|21104|emb|CAA48611.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Raphanus sativus]
          Length = 573

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 184/344 (53%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ +I  P+ I G ++ D  +  VP+AT E  L  S  RG   +M    G  +T++ + 
Sbjct: 220 MPVGYIQIPVGIAGPLLLDGYEYSVPMATTEGCLVASTNRGCK-AMYVSGGATSTVLKDG 278

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F +      L    E       +A V  ++S+F R   +   +AG   ++R 
Sbjct: 279 MTRAPVVRFASARRASELKFFLESPENFETLAVVFNRSSRFARLQSVMCTLAGKNAYVRF 338

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V++++   +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 339 SCSTGDAMGMNMVSKGVQNVLEFLTEDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 398

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I      K L+TS   ++ LN  KNL G+ +AG +   N H +N++ A +LATGQD
Sbjct: 399 CEAVIRGETVNKVLKTSVASLVELNMLKNLTGSAIAGSLGGFNRHASNIVSAVFLATGQD 458

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE SQ +T  +  +D   ++ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 459 PAQNVESSQCITMMEAINDGKDIHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 518

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+RRLA I A  VL GELSL++A    G+L+ +H++  R
Sbjct: 519 ESPGMNSRRLATIVAGAVLAGELSLMSA-IAAGQLVRSHMKYNR 561


>gi|332140220|ref|YP_004425958.1| Hydroxymethylglutaryl-coenzyme A reductase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327550242|gb|AEA96960.1| Hydroxymethylglutaryl-coenzyme A reductase [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 388

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 114/337 (33%), Positives = 174/337 (51%), Gaps = 10/337 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+ + GPM + G   + +  VP+AT E  L  S  RG  ++     GI  T+ID+ M R
Sbjct: 58  VPIGFAGPMLVNGEHAKGEFYVPMATTEGTLTASYSRGMRLTREA-GGITTTVIDDAMQR 116

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F   NA  AL   + +      I R  + T+   +   +    A  L +LR  F  G
Sbjct: 117 APMFAFSNAREALAFGKWVEQNFEAIKRACDSTTSVGKLRDIEQYAASKLRWLRFNFTCG 176

Query: 131 DASGHNMVTKAADAVMDWILSQW-SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEIT 189
           DA+G NMV+KA  A  +WI + +   + +  ++ N+ +DKK + +N +  RGK  VAE+T
Sbjct: 177 DAAGQNMVSKATKAGCEWIQANYPGAIEHFVLAANLDTDKKHSHLNSLHTRGKRVVAEVT 236

Query: 190 INRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANI 249
           + + +    +   PE +       N+ G  +AG + +  AHFAN + A ++A GQD AN+
Sbjct: 237 LPKQLMTDIMHCPPEALFKQRQYSNM-GALMAGSVNNG-AHFANGITAMFIACGQDVANV 294

Query: 250 VEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNA 308
            E S G TYA++  +   YFS TIP+LI+   G G  +      L  LGC +      + 
Sbjct: 295 AESSAGFTYAEITPNGDYYFSVTIPSLIVATYGGGTGLATQNECLRVLGCTQR----GSV 350

Query: 309 RRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            + A I AATVLCG+LSL +A     E + +H RL R
Sbjct: 351 NKFAEIVAATVLCGDLSLGSAVV-ADEWVSSHERLGR 386


>gi|20091891|ref|NP_617966.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Methanosarcina
           acetivorans C2A]
 gi|19917087|gb|AAM06446.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Methanosarcina
           acetivorans C2A]
          Length = 430

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 124/346 (35%), Positives = 194/346 (56%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   G +K+ G     +  +PLAT E  L  SV RG  + +    G    + +
Sbjct: 88  IGAVQIPLGTAGLLKVNGEYADAEYYIPLATTEGALVASVNRGCSV-ITKSGGANVRVFE 146

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEI----ARVIEQTSQFTRFLQLHSQIAGNLL 121
           + MTR+  F+ E+ + A    + +  K+ EI      V E+T++F + + +   + G  +
Sbjct: 147 DEMTRAPVFKLESLDRAKKFYEWV--KRPEIFEQMKEVAEKTTRFGKLVSVKPFVTGTYV 204

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           +LR  + T DA G NMVT A DAVM  I  ++   H  ++S N+C+DKK  +I+ I+GRG
Sbjct: 205 YLRFSYDTKDAMGMNMVTIATDAVMHLIEDEFG-AHPITLSSNMCTDKKPASISTILGRG 263

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K  VAE+TI   I ++ L+ +PE +  +N  KNL+G+  AG +   NAH AN++ A YLA
Sbjct: 264 KTVVAEVTIPEEIVKETLKCTPESMFEVNYSKNLLGSARAGAM-GFNAHAANVIAALYLA 322

Query: 242 TGQDAANIVEGSQGLTYAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
            GQDAA++VEGS  +T  +L     ++ S T+P L +G VG G  +   ++ L  LG   
Sbjct: 323 CGQDAAHVVEGSTAITSMELTKYGEIHCSVTLPALPVGTVGGGTGLGTQRDCLNILGVAG 382

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              + G N+ + A I A+ VL GE+SL+ AQ   G L  AH +L R
Sbjct: 383 AGDEPGINSLKFAEIVASAVLAGEISLIGAQA-AGHLARAHAQLGR 427


>gi|328851038|gb|EGG00197.1| hypothetical protein MELLADRAFT_39863 [Melampsora larici-populina
           98AG31]
          Length = 996

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 118/344 (34%), Positives = 187/344 (54%), Gaps = 14/344 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V    +P+   GP++I G        +P+AT E  L  S  RG   ++    G+   +  
Sbjct: 604 VGYTPIPIGIAGPLRIDGKAF----PIPMATTEGALVASTSRGCK-ALNASGGVTTVITA 658

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR    E  + + A  A + I   +   ++    + TS+F R + L + +AG  LF+
Sbjct: 659 DAMTRGPALEFPSLKEACQAKEWIDSIEGSRKLKEAFDSTSRFARLVSLKAALAGRTLFV 718

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRG 181
           R    TGDA G NM++K  +  +  + S+  +  +   S+SGN C+DKK +A+N I GRG
Sbjct: 719 RFGTQTGDAMGMNMISKGTEKALALMGSEEFFPMMRVISLSGNYCTDKKPSAMNWIEGRG 778

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V+E  +   + +K L+T+ ++I+ LN  KNL+G+ +AG I   NAH +N+L A YLA
Sbjct: 779 KSVVSEAIVKGEVMEKVLKTTVQEIVKLNVTKNLVGSSMAGSIGGMNAHASNILTAIYLA 838

Query: 242 TGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
           TGQD A  VE S  +T  +  ++   L  +CT+P++ +G +G G  +      L  LG  
Sbjct: 839 TGQDPAQNVESSNCMTLMEPINNGRDLLITCTMPSIEVGTIGGGTILAPQGAMLEMLGIK 898

Query: 300 EERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHL 341
               T  GDNAR LA I   +V+ GELSL++A    G L+++H+
Sbjct: 899 GSHSTTPGDNARMLARIVCGSVMAGELSLMSALAA-GHLVKSHM 941


>gi|323336168|gb|EGA77439.1| Hmg1p [Saccharomyces cerevisiae Vin13]
          Length = 855

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 178/343 (51%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 490 MPLPVGVIGPLVIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 544

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 545 TRGPVVRFPTLKRSGACKIWLDSEEGQNAIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 604

Query: 127 FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 605 TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 664

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VAE TI   + +K L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 665 VAEATIPGDVVRKVLKSDVSALVELNIAKNLVGSAMAGSVGGFNAHAANLVTAVFLALGQ 724

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 725 DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHAT 784

Query: 305 --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NAR+LA I A  VL GELSL AA    G L+++H+   R
Sbjct: 785 APGTNARQLARIVACAVLAGELSLCAALA-AGHLVQSHMTHNR 826


>gi|172072667|ref|NP_001116460.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Sus scrofa]
 gi|118573790|sp|Q1W675|HMDH_PIG RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|90655084|gb|ABD96089.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Sus scrofa]
 gi|107770465|gb|ABF83891.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Sus scrofa]
 gi|198417718|gb|ACH87968.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Sus scrofa]
          Length = 885

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 184/349 (52%), Gaps = 11/349 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 530 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRILA 584

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MT  + F        + A  E     A I    + TS+F R  +L   +AG  L++R 
Sbjct: 585 DGMTPVVRFPRACDSAEVKAWLETPEGFAVIKEAFDSTSRFARLQKLQMSVAGRNLYIRF 644

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  A+N I GRGK+ V
Sbjct: 645 QSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAVNWIEGRGKSVV 704

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + ++ L+T+ E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A GQD
Sbjct: 705 CEAVIPAKVVREVLKTTTEAMVEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQD 764

Query: 246 AANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           AA  V  S  +T  +     ++ LY SCT+P++ +G VG G ++   +  L  LG     
Sbjct: 765 AAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTSLLPQQACLQMLGVQGAC 824

Query: 303 K--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
           K   G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 825 KDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVRSHMIHNRSKIN 872


>gi|50303597|ref|XP_451740.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49640872|emb|CAH02133.1| KLLA0B04642p [Kluyveromyces lactis]
          Length = 1072

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 186/347 (53%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   +M    G++  L  + M
Sbjct: 688  MPLPVGVIGPLMIDGVYYH----IPMATTEGCLVASAMRGCK-AMNAGGGVQTVLTKDGM 742

Query: 69   TRS--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F +    +A     +I L   E    + +    TS+F R   + + +AG+LLF
Sbjct: 743  TRGPCVRFPS----LARAGACKIWLDSEEGQNRVKKAFNSTSRFARLQHIQTALAGDLLF 798

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGR 180
            +R    TGDA G NM++K  +  +  ++ +  W+ +   SVSGN C DKK  AIN I GR
Sbjct: 799  IRFRTTTGDAMGMNMISKGVEFSLKQMVEEFGWNDMEIVSVSGNFCMDKKPAAINWIEGR 858

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE TI   + +K L++  + ++ LN  KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 859  GKSVVAEATIPGDVVRKVLKSDVKALVDLNISKNLIGSAMAGSVGGFNAHASNLVSAVFL 918

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            A GQD A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG   
Sbjct: 919  ALGQDPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTILEPQGAMLDLLGVRG 978

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  G+NAR+LA I A+ V+ GELSL +A    G L+++H+   R
Sbjct: 979  PHPTQPGNNARQLAKIVASAVMAGELSLCSALA-AGHLVQSHMVHNR 1024


>gi|300770651|ref|ZP_07080530.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300763127|gb|EFK59944.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 451

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 178/343 (51%), Gaps = 22/343 (6%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P   IGP++I G+       VPLAT E  L  S  RGA  +     GI +  + E + R
Sbjct: 119 VPTGVIGPLRIIGSAANADFYVPLATSEGALLASYHRGAR-ACFVAGGITSICLIEGVQR 177

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S  F+ EN       +  +  ++ ++  + +QTS+F R   +  QI GN L +  E+ TG
Sbjct: 178 SPLFKFENVGELGLFVSWLLPQEEKLKEITKQTSRFARLTCIQIQIEGNHLIVTFEYQTG 237

Query: 131 DASGHNMVTKAADAVMDWILSQ-------WSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           DA+G NMVT   D +  ++++        W       V GN   DKKATA++    RGK 
Sbjct: 238 DAAGQNMVTICTDTICQYLIAHSPVKPKLW------FVEGNYSGDKKATALSFTNVRGKK 291

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
             AEI +   I Q+ L+T+PE ++    + + +G   +G I  A+ H+AN L A +LATG
Sbjct: 292 VTAEIVLPETIVQQVLKTTPE-LMAEYWRSSTMGIIQSGAI-GAHGHYANGLAALFLATG 349

Query: 244 QDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           QD A + E + G+T  +L+ D SLY S T+PNL++G VG G ++   +  L  + C    
Sbjct: 350 QDVACVAEAATGITRMELNKDGSLYASVTLPNLMVGTVGGGTHLSTQRECLEIMDCY--- 406

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                AR+ A IC   VL GELS +AA  + G    AH +  R
Sbjct: 407 -GAGQARKFAEICGGLVLAGELS-IAAALSAGHFTSAHQKFGR 447


>gi|195331389|ref|XP_002032385.1| GM26526 [Drosophila sechellia]
 gi|194121328|gb|EDW43371.1| GM26526 [Drosophila sechellia]
          Length = 944

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 130/346 (37%), Positives = 184/346 (53%), Gaps = 18/346 (5%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 585 VPIPVGYAGPLLLDG----ETYYVPMATTEGALVASTNRGCK--ALSVRGVRSVVEDVGM 638

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVI----EQTSQFTRFLQLHSQIAGNLLFLR 124
           TR+      +   A  A   I  +  E  RV+    + TS+F R    H  + G  L++R
Sbjct: 639 TRAPCVRFPSVARAAEAKSWI--ENDENYRVVKTEFDSTSRFGRLKDCHIAMDGPQLYIR 696

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
               TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK  
Sbjct: 697 FVAITGDAMGMNMVSKGAEMALRRIQLQFPDMQIISLSGNFCCDKKPAAINWIKGRGKRV 756

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           V E TI+ A  +  LRT  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LATGQ
Sbjct: 757 VTECTISAATLRSVLRTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQ 816

Query: 245 DAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           D A  V  S   T  +    + + LY +CT+P+L +G VG G  +P     L  LG    
Sbjct: 817 DPAQNVTSSNCSTAMECWAENSEDLYMTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGA 876

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              + GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 877 HPTRPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 921


>gi|156842182|ref|XP_001644460.1| hypothetical protein Kpol_520p23 [Vanderwaltozyma polyspora DSM
            70294]
 gi|156115103|gb|EDO16602.1| hypothetical protein Kpol_520p23 [Vanderwaltozyma polyspora DSM
            70294]
          Length = 1050

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 123/346 (35%), Positives = 182/346 (52%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G+   +  
Sbjct: 688  IGYMPLPVGIIGPLIIDG----VSYHIPMATTEGCLVASAMRGCK-AINAGGGVSTVITK 742

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   + F T     +     +    + +I +    TS+F R   + + +AG+LLF+
Sbjct: 743  DGMTRGPCVRFPTLQRAGSCKIWLDSEEGQNKIKKAFNSTSRFARLQHIQTALAGDLLFI 802

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +  +  + ++  W  +   SVSGN C+DKK  AIN I GRG
Sbjct: 803  RFRTTTGDAMGMNMISKGVEFSLHQMTNEYGWGDMEIVSVSGNYCTDKKPAAINWIEGRG 862

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ VAE TI   +  K L++    ++ LN  KNLIG+ +AG +   NAH AN++ A YLA
Sbjct: 863  KSVVAEATIPGDVVNKVLKSDVNALVELNIAKNLIGSAMAGSVGGFNAHAANLVTAVYLA 922

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
             GQD A  VE S  +T  K  +  L  S ++P++ +G +G G  +      L  LG    
Sbjct: 923  LGQDPAQNVESSNCITLMKAINGDLRISVSMPSIEVGTIGGGTVLGPQSAMLDLLGVRGP 982

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  G NAR+LA I A+TVL GELSL AA    G L+++H+   R
Sbjct: 983  HSTEPGTNARQLAKIVASTVLAGELSLCAALA-AGHLVQSHMVHNR 1027


>gi|195145432|ref|XP_002013697.1| GL23258 [Drosophila persimilis]
 gi|194102640|gb|EDW24683.1| GL23258 [Drosophila persimilis]
          Length = 918

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 185/345 (53%), Gaps = 16/345 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 559 VPIPVGYAGPLILDG----ESYYVPMATTEGALVASTNRGCK--ALSVTGVRSVVEDVGM 612

Query: 69  TRSI---FFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           TR+    F     A  A   ++E T  K  I    + TS+F R    H  + G  L++R 
Sbjct: 613 TRAPCVRFPSVARASEAKLWIEEETNYKL-IKLEFDSTSRFGRLKDCHIAMDGPQLYIRF 671

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK  V
Sbjct: 672 VALTGDAMGMNMVSKGAEMALRRIKRQFPDMQIISLSGNFCCDKKPAAINWIKGRGKRVV 731

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E TI+ A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LATGQD
Sbjct: 732 TECTISAATLRSVLKTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQD 791

Query: 246 AANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            A  V  S   T  +    +++ LY +CT+P+L +G VG G  +P     L  LG     
Sbjct: 792 PAQNVTSSNCSTAMECWVENNEDLYMTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGAH 851

Query: 303 KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            T  GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 852 PTHPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 895


>gi|302881645|ref|XP_003039733.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256720600|gb|EEU34020.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 1276

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 130/351 (37%), Positives = 186/351 (52%), Gaps = 22/351 (6%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  
Sbjct: 762  IGYMPLPVGVAGPLVIDGQ----SYFIPMATTEGVLVASASRGCK-AINSGGGAITVLTA 816

Query: 66   ERMTRS--IFFET-ENAEMALTALQ----EITLKKAEIARVIEQTSQFTRFLQLHSQIAG 118
            + MTR   + FET E A  A   L     + T+KKA        TS+F R   + + +AG
Sbjct: 817  DGMTRGPCVAFETLERAGAAKLWLDSEAGQTTMKKA-----FNSTSRFARLQSMKTALAG 871

Query: 119  NLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAING 176
              LF+R +  TGDA G NM++K  +  +  + S   +  +   SVSGN C+DKK  A+N 
Sbjct: 872  TNLFIRFKTTTGDAMGMNMISKGVEHALSVMSSDGGFDDMQIISVSGNYCTDKKPAALNW 931

Query: 177  IMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLL 236
            I GRGK  VAE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH ANM+ 
Sbjct: 932  IDGRGKGVVAEAIIPGEVVRSVLKSDVDSLVELNVTKNLIGSAMAGSVGGFNAHAANMVA 991

Query: 237  AYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTAL 296
            A +LATGQD A +VE +  +T  K  + +L  S ++P+L +G +G G  +    + L  L
Sbjct: 992  AIFLATGQDPAQVVESANCITIMKNLNGALQISVSMPSLEVGTLGGGTILEPQGSMLDIL 1051

Query: 297  GCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G      T  GDNARRLA I AA VL GELSL +A    G L+ AH++  R
Sbjct: 1052 GVRGSHPTNPGDNARRLARIIAAAVLAGELSLCSALAA-GHLVRAHMQHNR 1101


>gi|125774757|ref|XP_001358630.1| GA10278 [Drosophila pseudoobscura pseudoobscura]
 gi|54638369|gb|EAL27771.1| GA10278 [Drosophila pseudoobscura pseudoobscura]
          Length = 920

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 185/345 (53%), Gaps = 16/345 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 561 VPIPVGYAGPLILDG----ESYYVPMATTEGALVASTNRGCK--ALSVTGVRSVVEDVGM 614

Query: 69  TRSI---FFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           TR+    F     A  A   ++E T  K  I    + TS+F R    H  + G  L++R 
Sbjct: 615 TRAPCVRFPSVARASEAKLWIEEETNYKL-IKLEFDSTSRFGRLKDCHIAMDGPQLYIRF 673

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK  V
Sbjct: 674 VALTGDAMGMNMVSKGAEMALRRIKRQFPDMQIISLSGNFCCDKKPAAINWIKGRGKRVV 733

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E TI+ A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LATGQD
Sbjct: 734 TECTISAATLRSVLKTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQD 793

Query: 246 AANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            A  V  S   T  +    +++ LY +CT+P+L +G VG G  +P     L  LG     
Sbjct: 794 PAQNVTSSNCSTAMECWVENNEDLYMTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGAH 853

Query: 303 KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            T  GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 854 PTHPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 897


>gi|224285512|gb|ACN40476.1| unknown [Picea sitchensis]
          Length = 580

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 189/347 (54%), Gaps = 17/347 (4%)

Query: 11  MPMRWIG-PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           +P+ ++  P+ + G ++ D ++  VP++T E  L  S  RG    H+S     G  + L+
Sbjct: 230 LPVGYVQIPVGVAGPLVLDGLEYMVPMSTTEGCLVASTNRGCKAIHMS----GGATSVLL 285

Query: 65  DERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            + MTR+  + F T      L    E       ++ +  +TS+F R   L   IAG  L+
Sbjct: 286 RDGMTRAPVVRFSTAKRAADLKYYIEDPNNSENLSVIFNRTSRFARLQGLQCGIAGRNLY 345

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R    TGDA G NMV+K    V+D++ +++  +   SVSGN C+DKK  A+N I GRGK
Sbjct: 346 IRFSCFTGDAMGMNMVSKGVQNVLDFLQNEFPDMDVISVSGNFCADKKPAAVNWIEGRGK 405

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + V E  I  A+ +K L+T    ++ LN  KNL G+ LAG +   NAH +N++ A ++AT
Sbjct: 406 SVVCEAVITEAVVRKVLKTDVPALLELNMLKNLTGSALAGAMGGFNAHASNIVSAIFIAT 465

Query: 243 GQDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           GQD A  VE S  +T  +  +    L+ S T+P + +G +G G  + +    L  LG   
Sbjct: 466 GQDPAQNVESSHCITMMEASNGGKDLHISVTMPCIEVGTIGGGTQLASQAACLNLLGVKG 525

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +  G N++RLA I A  VL GELSL++A    G+L+++H++  R
Sbjct: 526 ANVQSPGANSQRLARIVAGAVLAGELSLMSALA-AGQLVKSHMKYNR 571


>gi|302813664|ref|XP_002988517.1| hypothetical protein SELMODRAFT_272011 [Selaginella moellendorffii]
 gi|300143624|gb|EFJ10313.1| hypothetical protein SELMODRAFT_272011 [Selaginella moellendorffii]
          Length = 554

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 121/350 (34%), Positives = 189/350 (54%), Gaps = 12/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 189 VGYVQIPVGVAGPLLLDGL----EYTVPMATTEGCLVASTNRGCK-AIHQSGGAVSEILK 243

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + +TR+  + F +      L    E T     I+ V  +TS+F R   +   +AG   ++
Sbjct: 244 DGITRAPVVSFSSLKGAAELKFYLEDTNNFDTISTVFNRTSRFARLQSVKCLLAGRNAYI 303

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NM++K    V+D++   +  +   SVSGN+C+DKKAT++N I GRGK+
Sbjct: 304 RFCCSTGDAMGMNMISKGVQNVLDYLHDVFPDMCVISVSGNLCADKKATSVNWIEGRGKS 363

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   +  K L+TS   ++ LNT KNL+G+ LAG +   NAH +N++ A ++ATG
Sbjct: 364 VVCEAVIKGDVVSKVLKTSVSALVELNTLKNLVGSALAGAVGGFNAHASNIVSAVFIATG 423

Query: 244 QDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ LT  +  +    LY S T+P++ +G +G G  + +    L  LG    
Sbjct: 424 QDPAQNVESSQCLTLMEATNCGKDLYVSVTMPSVEVGTIGGGTQLASQSACLNLLGIKGS 483

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                G NA+ LA + A  VL GELSL++A    G+L+++H++  R   N
Sbjct: 484 NPDSPGLNAQTLARVVAGAVLAGELSLMSALA-AGQLVKSHMKYNRSSKN 532


>gi|50552167|ref|XP_503558.1| YALI0E04807p [Yarrowia lipolytica]
 gi|49649427|emb|CAG79139.1| YALI0E04807p [Yarrowia lipolytica]
          Length = 999

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 127/347 (36%), Positives = 184/347 (53%), Gaps = 20/347 (5%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GPM I G        +P+AT E  L  S  RG   ++    G+   L  + M
Sbjct: 636 MPLPVGVAGPMNIDGK----NYHIPMATTEGCLVASTMRGCK-AINAGGGVTTVLTQDGM 690

Query: 69  TRSIFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLFLR 124
           TR       + + A  A  +I L   E    + +    TS+F R   LHS +AGNLLF+R
Sbjct: 691 TRGPCVSFPSLKRAGAA--KIWLDSEEGLKSMRKAFNSTSRFARLQSLHSTLAGNLLFIR 748

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGK 182
               TGDA G NM++K  +  +  ++ ++ +  +   SVSGN C+DKK  AIN I GRGK
Sbjct: 749 FRTTTGDAMGMNMISKGVEHSLAVMVKEYGFPDMDIVSVSGNYCTDKKPAAINWIEGRGK 808

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + VAE TI   I +  L++  + ++ LN  KNLIG+ +AG +   NAH AN++ A YLAT
Sbjct: 809 SVVAEATIPAHIVKSVLKSEVDALVELNISKNLIGSAMAGSVGGFNAHAANLVTAIYLAT 868

Query: 243 GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC---- 298
           GQD A  VE S  +T     D +L  S ++P++ +G +G G  +      L  LG     
Sbjct: 869 GQDPAQNVESSNCITLMSNVDGNLLISVSMPSIEVGTIGGGTILEPQGAMLEMLGVRGPH 928

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           IE    G NA++LA I A+ VL  ELSL +A    G L+++H+   R
Sbjct: 929 IE--TPGANAQQLARIIASGVLAAELSLCSALAA-GHLVQSHMTHNR 972


>gi|11132836|sp|O64966|HMDH1_GOSHI RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 1;
           Short=HMG-CoA reductase 1
 gi|2935298|gb|AAC05088.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Gossypium
           hirsutum]
          Length = 585

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 182/344 (52%), Gaps = 18/344 (5%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRATLIDER 67
           +P+   GP+ + G     +  VP+AT E  L  S  RG    H+S     G  + L+ + 
Sbjct: 241 IPVGIAGPLLLNGR----EYSVPMATTEGCLVASTNRGCKAIHLS----GGATSVLLRDG 292

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E       +A V  ++S+F R   +   IAG  L+LR 
Sbjct: 293 MTRAPVVRFGTAKRAADLKLYLEDPENFETLACVFNRSSRFARLQSIKCAIAGKNLYLRF 352

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 353 SCFTGDAMGMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 412

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  IN  +  K L+TS E ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD
Sbjct: 413 CEAIINGDVVTKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAVYIATGQD 472

Query: 246 AANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  +    L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 473 PAQNVESSHCITMMEAVNGGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 532

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+  LA I A  VL GELSL++A    G+L+++H++  R
Sbjct: 533 ESPGANSILLATIVAGAVLAGELSLMSALA-AGQLVKSHMKYNR 575


>gi|168038115|ref|XP_001771547.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162677103|gb|EDQ63577.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 579

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 186/350 (53%), Gaps = 12/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ I G     +  VP+AT E  L  S  RG   ++    G  + L+ 
Sbjct: 219 VGYVQVPVGVAGPLLINGR----EFTVPMATTEGCLVASTNRGCK-AIHQSGGATSILLQ 273

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E       IA +  +TS+F R   L  Q+AG  +++
Sbjct: 274 DGMTRAPVVRFPSVKRCAELKFFLEDPNNFDTIAHMFNRTSRFGRLKHLKCQLAGRNVYI 333

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NM++K    V+D++      +   SVSGN C+DKK TA+N I GRGK+
Sbjct: 334 RFSALTGDAMGMNMISKGVQNVLDYLQDINPDMEVISVSGNFCADKKPTAVNWIDGRGKS 393

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  +   + +K L+TS   ++ LN  KNL G+ LAG +   NAH AN++ A Y+ATG
Sbjct: 394 VVCEAILKGDVVRKVLKTSVSALVELNMVKNLAGSALAGAVGGFNAHAANIVSAIYIATG 453

Query: 244 QDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  +    L+ S T+P++ +G +G G  + +    L  LG    
Sbjct: 454 QDPAQNVESSQCITMMEAVNGGQDLHVSVTMPSIEVGTIGGGTQLASQSACLNLLGVKGA 513

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                G NA+ LA + A  VL GE+SL++A    G+L+++H++  R + N
Sbjct: 514 NADSPGANAQGLARVVAGAVLAGEISLMSALA-AGQLVKSHMKYNRSNNN 562


>gi|149927998|ref|ZP_01916247.1| Hydroxymethylglutaryl-CoA reductase (NADPH) [Limnobacter sp.
           MED105]
 gi|149823294|gb|EDM82528.1| Hydroxymethylglutaryl-CoA reductase (NADPH) [Limnobacter sp.
           MED105]
          Length = 389

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 117/327 (35%), Positives = 171/327 (52%), Gaps = 11/327 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDG-IRATLI 64
           +  + MP+   GP+ I G   Q    VPLAT E  L  S  RG  + M+   G ++ T+ 
Sbjct: 54  IGVVQMPVGVAGPVLIHGEHAQGWFYVPLATTEGTLVASYSRG--MRMVSESGGVKVTVA 111

Query: 65  DERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLR 124
           +E M R+  FE E+A  A   L  +      +    E+T+ F +   + +     +++ R
Sbjct: 112 EEFMQRAPLFEFEDARAAKRFLNWLNENLQTVKAEAEKTTGFGKLEHIQTWQVARMVYTR 171

Query: 125 LEFATGDASGHNMVTKAADAVMDWIL-SQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
             + TGDA+G NM  KA  A   W+L +    + Y ++SG I +DKK + +N +  RGK 
Sbjct: 172 FNYTTGDAAGQNMCGKATHAACQWVLKNSPEAITYFALSGAIETDKKHSHMNLLHSRGKR 231

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            +AE TI R + Q+  RT+PE  I    Q++ IG  LAG   S   H AN + A ++ATG
Sbjct: 232 VIAEATIQREVLQRLARTTPE-TIFKQRQRSAIGAQLAGSAYSG-PHSANGIAALFIATG 289

Query: 244 QDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           QD AN+VE   G+ +  +  D  LYFS T+P++I    G G  +      L  LGC    
Sbjct: 290 QDEANVVESHTGMVFMDITADGDLYFSVTLPSVICATKGGGTGLSTQAECLRMLGC---- 345

Query: 303 KTGDNARRLAAICAATVLCGELSLLAA 329
           +    AR+LA I  ATVL G+LSLL+A
Sbjct: 346 EGSGKARKLAEIVGATVLAGDLSLLSA 372


>gi|148976739|ref|ZP_01813411.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrionales
           bacterium SWAT-3]
 gi|145963852|gb|EDK29111.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrionales
           bacterium SWAT-3]
          Length = 420

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 122/342 (35%), Positives = 180/342 (52%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V ++ +P+   GP+++ G   Q    VPLAT E  L  S  RG+ +   C  G  A L++
Sbjct: 86  VGTVKVPVGISGPLRVNGLFAQGDYLVPLATTEAALVASYNRGSKLISAC-GGASAMLLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  +    A   +     +  +   + E T+   +   ++  I GN ++L  
Sbjct: 145 EGVTRTPGFAFQGLVEAGQFVAWAVTQYEKFKTLAESTTSHGKLTDININIEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSY-LHYGSVSGNICSDKKATAINGIMGRGKNF 184
           EF TGDASG NMVT A +AV ++I+        +  + GN+  DKKA        RGK  
Sbjct: 205 EFLTGDASGQNMVTIATNAVFEYIIEHAPVKPDHAFLDGNLSGDKKANTQTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ I   +  KYL T+PEK++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 TAEVNIPAELVAKYLHTTPEKMVQFG-QMTTVGGALSGTI-GINAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L+ +  LY S T+PNL++G VG G ++P+ K  L  LG     K
Sbjct: 323 DAACVAESAIGMTRMELNKEGGLYASVTLPNLMVGTVGGGTSLPSQKACLDLLGLHGNGK 382

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +    + LA +CAA  L GELS++ A    G    AH +L R
Sbjct: 383 S----QALAEVCAALCLAGELSIVGAFC-AGHFSRAHHKLAR 419


>gi|28628717|gb|AAO49323.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Nocardia sp.
           SMA88]
          Length = 158

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 107/136 (78%)

Query: 158 YGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIG 217
           YGS+SG  C DKKATA+NGI+GRGKN ++E+ +   + ++ L +   +++ LN +KNL+G
Sbjct: 1   YGSISGIYCPDKKATAVNGILGRGKNVISELIVPHEVVEQRLHSPAAQVVQLNIRKNLVG 60

Query: 218 TFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLIL 277
           T LAGGIRSANAH+ANMLLA+YLATGQD ANIVEGSQG+T+A+     LYFSCT+PNLI+
Sbjct: 61  TLLAGGIRSANAHYANMLLAFYLATGQDPANIVEGSQGITHAEDRAGDLYFSCTLPNLIV 120

Query: 278 GCVGNGKNIPAIKNNL 293
           G VGNGK+   +  NL
Sbjct: 121 GTVGNGKHASFVDENL 136


>gi|260942619|ref|XP_002615608.1| hypothetical protein CLUG_04490 [Clavispora lusitaniae ATCC 42720]
 gi|238850898|gb|EEQ40362.1| hypothetical protein CLUG_04490 [Clavispora lusitaniae ATCC 42720]
          Length = 1008

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 181/344 (52%), Gaps = 13/344 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G+   +  + M
Sbjct: 642 MPLPVGVAGPLIIDGT----PYHIPMATTEGCLVASTMRGCK-AINAGGGVETIITQDGM 696

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR   + F +     A     +    +  I +    TS+F R   + + IAG LLF+R +
Sbjct: 697 TRGPCVSFSSLARAGACKLWLDSEEGQKTIKKAFNSTSRFARLQHIKTAIAGTLLFIRFK 756

Query: 127 FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             TGDA G NM++K  +  + ++  +  W  +   +VSGN C+DKK  AIN I GRGK+ 
Sbjct: 757 TTTGDAMGMNMISKGVEYSLKYMAEECGWDDMSVIAVSGNYCTDKKPAAINWIEGRGKSV 816

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VAE  I   + QK L++  + ++ LN  KNLIG+ +AG +   NAH AN++ A YLA GQ
Sbjct: 817 VAEARIPSEVVQKVLKSDVDALVELNISKNLIGSAMAGSVGGFNAHAANLVTAVYLACGQ 876

Query: 245 DAANIVEGSQGLTYA-KLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           D A  VE S  +T   +L +  L  S ++P++ +G +G G  +      L  LG      
Sbjct: 877 DPAQNVESSNCMTLMNRLPNGDLQISVSMPSIEVGTIGGGTILEPQGAMLELLGVRGPHP 936

Query: 304 T--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           T  GDN+RRLA I A+ VL  ELSL +A    G L+++H++  R
Sbjct: 937 TNPGDNSRRLACIVASAVLAAELSLCSALA-AGHLVQSHMQHNR 979


>gi|160358778|ref|NP_032281.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Mus musculus]
 gi|148668565|gb|EDL00884.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Mus musculus]
          Length = 887

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 183/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 530 IGYMPIPVGVAGPLCLDGKEYQ----VPMATTEGCLVASTNRGCRAISL-GGGASSRVLA 584

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     +    E     A I    + TS+F R  +LH  +AG  L++
Sbjct: 585 DGMTRGPVVRLPRACDSAEVKTWLETPEGFAVIKEAFDSTSRFARLQKLHVTMAGRNLYI 644

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK 
Sbjct: 645 RFQSRTGDAMGMNMISKGTEKALLKLQEFFPDMQILAVSGNYCTDKKPAAINWIEGRGKT 704

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 705 VVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 764

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 765 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 824

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 825 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVRSHMVHNRSKIN 874


>gi|225457660|ref|XP_002275827.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 593

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 115/344 (33%), Positives = 187/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + ++ + 
Sbjct: 242 MPVGYVQIPVGIAGPLLLDGFEYSVPMATTEGCLVASTNRGCK-AIYVSGGATSMVLRDG 300

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E       ++ +  ++S+F R   +   +AG  L++R 
Sbjct: 301 MTRAPVVRFATAKRAAELKFFLENPENFETLSVIFNRSSRFARLQSIQCAMAGKNLYIRF 360

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 361 SCSTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 420

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH  N++ A ++ATGQD
Sbjct: 421 CEAVIKEDVVRKVLKTNIAALVELNMLKNLAGSAVAGALGGFNAHAGNIVSAIFIATGQD 480

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE    +T  +  +D   L+ S T+P++ +G VG G  +P+    L  LG     +
Sbjct: 481 PAQNVESCHCITMMEAVNDGKDLHISVTMPSVEVGTVGGGTQLPSQSACLNLLGVKGASK 540

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N++ LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 541 ESPGSNSKLLATIIAGSVLAGELSLMSAIAA-GQLVKSHMKYNR 583


>gi|156841150|ref|XP_001643950.1| hypothetical protein Kpol_1001p4 [Vanderwaltozyma polyspora DSM
            70294]
 gi|156114581|gb|EDO16092.1| hypothetical protein Kpol_1001p4 [Vanderwaltozyma polyspora DSM
            70294]
          Length = 1065

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 181/343 (52%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGPM I G        +P+AT E  L  S  RG   ++    G    +  + M
Sbjct: 687  MPLPVGVIGPMIIDGV----SYHIPMATTEGCLVASAMRGCK-AINAGGGAITVVTKDGM 741

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 742  TRGPCVRFATLARAGACKIWLDSEDGQNRIKKAFNSTSRFARLQHIQTALAGDLLFIRFR 801

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  ++ ++++  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 802  TTTGDAMGMNMISKGVEFSLNQMVNEFGWDDMEIVSVSGNYCTDKKPAAINWIEGRGKSI 861

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +K L++    ++ LN  KNLIG+ +AG +   NAH AN++ A YLA GQ
Sbjct: 862  VAEATIPGDVVRKVLKSDVAALVELNISKNLIGSAMAGSVGGFNAHAANLVTAVYLALGQ 921

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D +L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 922  DPAQNVESSNCITLMKEVDGNLRISVSMPSIEVGTIGGGTILEPQGAMLDLLGVRGPHPT 981

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL AA    G L+++H+   R
Sbjct: 982  EPGTNARQLARIVACAVLAGELSLCAALA-AGHLVQSHMVHNR 1023


>gi|78099313|sp|Q01237|HMDH_MOUSE RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|54648291|gb|AAH85083.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Mus musculus]
          Length = 887

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 183/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 530 IGYMPIPVGVAGPLCLDGKEYQ----VPMATTEGCLVASTNRGCRAISL-GGGASSRVLA 584

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     +    E     A I    + TS+F R  +LH  +AG  L++
Sbjct: 585 DGMTRGPVVRLPRACDSAEVKTWLETPEGFAVIKEAFDSTSRFARLQKLHVTMAGRNLYI 644

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK 
Sbjct: 645 RFQSRTGDAMGMNMISKGTEKALLKLQEFFPDMQILAVSGNYCTDKKPAAINWIEGRGKT 704

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 705 VVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 764

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 765 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 824

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 825 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVRSHMVHNRSKIN 874


>gi|4107037|dbj|BAA36291.1| HMG-CoA reductase [Cucumis melo]
 gi|269851485|gb|ACZ50511.1| 3-hydroxy-3-methylglutaryl coenzyme-A reductase [Cucumis melo]
          Length = 587

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 188/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 236 MPVGYVQIPVGIAGPLLLDGFEYTVPMATTEGCLVASTNRGCK-AIYASGGATSMLLKDG 294

Query: 68  MTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+      +A+ A  L    E       +A V  ++S+F R   +   IAG  L++R 
Sbjct: 295 MTRAPVVRFGSAKRASELKFFLEDPSNFDTLAVVFNRSSRFARLQSIRCSIAGKNLYVRF 354

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V++++   +S +    +SGN C+DKK  A+N I GRGK+ V
Sbjct: 355 CCSTGDAMGMNMVSKGVQNVLEFLQHDFSDMEVIGISGNFCADKKPAAVNWIEGRGKSVV 414

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+TS   ++ LN  KNL G+ +AG +   NAH +N++ A +LATGQD
Sbjct: 415 CEAVIKDEVVRKVLKTSVASLVELNMLKNLTGSAMAGALGGFNAHSSNIVSAIFLATGQD 474

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  ++   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 475 PAQNVESSHCITMMEPVNNGRDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASK 534

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA I A +VL GELSL++A    G+L+ +H++  R
Sbjct: 535 ESPGANSRLLATIVAGSVLAGELSLMSA-IAAGQLVRSHMKYNR 577


>gi|6323565|ref|NP_013636.1| Hmg1p [Saccharomyces cerevisiae S288c]
 gi|123336|sp|P12683|HMDH1_YEAST RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 1;
            Short=HMG-CoA reductase 1
 gi|171686|gb|AAA34676.1| 3-hydroxy-3-methyl-glutaryl coenzyme A reductase [Saccharomyces
            cerevisiae]
 gi|587536|emb|CAA86503.1| HMG1 [Saccharomyces cerevisiae]
 gi|285813927|tpg|DAA09822.1| TPA: Hmg1p [Saccharomyces cerevisiae S288c]
          Length = 1054

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 178/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 689  MPLPVGVIGPLVIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 743

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 744  TRGPVVRFPTLKRSGACKIWLDSEEGQNAIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 803

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 804  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 863

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +K L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 864  VAEATIPGDVVRKVLKSDVSALVELNIAKNLVGSAMAGSVGGFNAHAANLVTAVFLALGQ 923

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 924  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHAT 983

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL AA    G L+++H+   R
Sbjct: 984  APGTNARQLARIVACAVLAGELSLCAALA-AGHLVQSHMTHNR 1025


>gi|68161153|gb|AAY87014.1| 3-hydroxy-methylglutaryl coenzyme A reductase [Michelia chapensis]
          Length = 556

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 119/344 (34%), Positives = 187/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + L+ + 
Sbjct: 205 MPVGYVRLPVGIAGPLLLDGREYTVPMATTEGCLVASTNRGCK-AIYVSGGATSVLMKDG 263

Query: 68  MTRSIF--FETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+    F T     AL    E  +    +A V  ++S+F R   +   +AG  +++R 
Sbjct: 264 MTRAPVARFGTVKRAAALKFFLEDPINFDTLALVFNRSSRFARLQGIQCSLAGKNVYMRF 323

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    VMD++ + +  +   S+S N CSDKK  A+N I GRGK+ V
Sbjct: 324 TCSTGDAMGMNMVSKGVQNVMDFLHTDFPDMDIISISSNFCSDKKPAAVNWIEGRGKSVV 383

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +  L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 384 CEAIIKEEVLRTVLKTNVPALVELNMLKNLAGSAMAGALGGFNAHASNIVSAIFIATGQD 443

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE S  +T  +  ++   L+ S T+P++ +G VG G  + +    L  LG      
Sbjct: 444 PAQNVESSHCITMMEAINNGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASM 503

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 504 ESPGANARLLATIIAGSVLAGELSLMSALAT-GQLVQSHMKYNR 546


>gi|157785597|ref|NP_001099083.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [Bos taurus]
 gi|157279398|gb|AAI53263.1| HMGCR protein [Bos taurus]
          Length = 888

 Score =  178 bits (452), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 122/353 (34%), Positives = 185/353 (52%), Gaps = 17/353 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 585

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR   + F        + A  E       I    + TS+  R  +LH  +AG  L++
Sbjct: 586 DGMTRGPVVRFPRACDSAEVKAWLETPEGFTVIKEAFDSTSRVARLQKLHMSVAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLQEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG--- 297
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 298 -CIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
            C +    G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 826 ACRD--NPGENARQLARIVCGTVMAGELSLMAALA-AGHLVRSHMIHNRSKIN 875


>gi|297745608|emb|CBI40773.3| unnamed protein product [Vitis vinifera]
          Length = 541

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 115/344 (33%), Positives = 187/344 (54%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + ++ + 
Sbjct: 190 MPVGYVQIPVGIAGPLLLDGFEYSVPMATTEGCLVASTNRGCK-AIYVSGGATSMVLRDG 248

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E       ++ +  ++S+F R   +   +AG  L++R 
Sbjct: 249 MTRAPVVRFATAKRAAELKFFLENPENFETLSVIFNRSSRFARLQSIQCAMAGKNLYIRF 308

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 309 SCSTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 368

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH  N++ A ++ATGQD
Sbjct: 369 CEAVIKEDVVRKVLKTNIAALVELNMLKNLAGSAVAGALGGFNAHAGNIVSAIFIATGQD 428

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE    +T  +  +D   L+ S T+P++ +G VG G  +P+    L  LG     +
Sbjct: 429 PAQNVESCHCITMMEAVNDGKDLHISVTMPSVEVGTVGGGTQLPSQSACLNLLGVKGASK 488

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N++ LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 489 ESPGSNSKLLATIIAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 531


>gi|60688087|gb|AAH91631.1| Unknown (protein for IMAGE:7197923) [Xenopus laevis]
          Length = 881

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 183/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 524 IGYMPIPVGVAGPLCLDGKEYQ----VPMATTEGCLVASTNRGCRAISL-GGGASSRVLA 578

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     +    E     A I    + TS+F R  +LH  +AG  L++
Sbjct: 579 DGMTRGPVVRLPRACDSAEVKTWLETPEGFAVIKEAFDSTSRFARLQKLHVTMAGRNLYI 638

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  TGDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK 
Sbjct: 639 RFQSRTGDAMGMNMISKGTEKALLKLQEFFPDMQILAVSGNYCTDKKPAAINWIEGRGKT 698

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E ++ +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 699 VVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 758

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 759 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 818

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 819 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVRSHMVHNRSKIN 868


>gi|1763234|gb|AAB69727.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camptotheca
           acuminata]
          Length = 589

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 187/346 (54%), Gaps = 13/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + M +   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 241 VGYVQMAVGIAGPLLLDGR----EYLVPMATTEGCLVASTNRGCK-AIYASGGATSVILR 295

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F T      L    E       +A V  ++S+F RF  +H  +AG  L++
Sbjct: 296 DGMTRAPVVRFGTAKMSAELKFFLEDPRNFDTLAVVFNKSSRFGRFQGIHCALAGQNLYM 355

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++ + +S +    +SGN CSDKK  A+N I GRGK+
Sbjct: 356 RFSCSTGDAMGMNMVSKGVQNVLDFLQNDFSDMDVIGISGNFCSDKKPAAVNWIEGRGKS 415

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATG
Sbjct: 416 VVCESIIKEEVVRKVLKTNVASLVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYIATG 475

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S ++P++ +  VG G  + +    L  LG    
Sbjct: 476 QDPAQNVESSHCITMMEAVNDGKDLHVSVSMPSIEV-IVGGGTQLASQSACLNLLGVKGA 534

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +   G N+R LA I A +VL GELSL++A    G+L+++H++  R
Sbjct: 535 SKESPGSNSRLLATIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 579


>gi|126320638|ref|XP_001368743.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-coenzyme A
           reductase (HMG-CoA reductase) [Monodelphis domestica]
          Length = 884

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 194/354 (54%), Gaps = 19/354 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 527 IGYMPVPVGVAGPLHLDGKEFQ----VPMATTEGCLVASTNRGCR-AICLGGGASSCVLA 581

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQ----TSQFTRFLQLHSQIAGNLL 121
           + MTR       +A    +A  +  L+  E  ++I++    TS+F R  ++H  +AG   
Sbjct: 582 DGMTRGPVVRFPSA--CDSANMKTWLESPESFKIIKEAFDSTSRFARLQKVHISLAGRNA 639

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           ++R +  TGDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRG
Sbjct: 640 YIRFQSRTGDAMGMNMISKGTENALAKLREFFPEMQILAVSGNYCTDKKPAAINWIEGRG 699

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  I   + ++ L+T+ E ++ +N  KNL+G+ +AG I   NAH AN++ A ++A
Sbjct: 700 KSVVCEAVIPAKVVREVLKTTTEALVEVNINKNLVGSAMAGSIGGYNAHAANIVTAIFIA 759

Query: 242 TGQDAANIVEGSQGLTYAK----LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
            GQDAA  V  S  +T  +    L++D LY SCT+P++ +G VG G N+   +  L  LG
Sbjct: 760 CGQDAAQNVGSSNCITLMEATGPLNED-LYISCTMPSIEIGTVGGGTNLRPQQACLQMLG 818

Query: 298 CIEERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 819 VQGACKDNPGENARQLAKIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 871


>gi|151946089|gb|EDN64320.1| 3-hydroxy-3-methylglutaryl-coenzyme A (HMG-CoA) reductase isozyme
            [Saccharomyces cerevisiae YJM789]
 gi|190408169|gb|EDV11434.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase isozyme
            [Saccharomyces cerevisiae RM11-1a]
          Length = 1054

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 178/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 689  MPLPVGVIGPLVIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 743

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 744  TRGPVVRFPTLKRSGACKIWLDSEEGQNAIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 803

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 804  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 863

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +K L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 864  VAEATIPGDVVRKVLKSDVSALVELNIAKNLVGSAMAGSVGGFNAHAANLVTAVFLALGQ 923

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 924  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHAT 983

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL AA    G L+++H+   R
Sbjct: 984  APGTNARQLARIVACAVLAGELSLCAALA-AGHLVQSHMTHNR 1025


>gi|259148501|emb|CAY81746.1| Hmg1p [Saccharomyces cerevisiae EC1118]
          Length = 1054

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 178/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 689  MPLPVGVIGPLVIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 743

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 744  TRGPVVRFPTLKRSGACKIWLDSEEGQNAIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 803

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 804  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 863

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +K L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 864  VAEATIPGDVVRKVLKSDVSALVELNIAKNLVGSAMAGSVGGFNAHAANLVTAVFLALGQ 923

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 924  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHAT 983

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL AA    G L+++H+   R
Sbjct: 984  APGTNARQLARIVACAVLAGELSLCAALA-AGHLVQSHMTHNR 1025


>gi|332995357|gb|AEF05412.1| hydroxymethylglutaryl-coenzyme A reductase [Alteromonas sp. SN2]
          Length = 394

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 116/330 (35%), Positives = 174/330 (52%), Gaps = 11/330 (3%)

Query: 2   HMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRA 61
           H   V+ +  P+   GP+ I G   Q +  VP+AT E  L  S  RG  ++     G++ 
Sbjct: 56  HFTGVAQV--PIGLAGPLVIKGVDAQGEFYVPMATTEGTLVASYNRGMRLTAES-GGVKT 112

Query: 62  TLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
           T+ID+ M R+  F  E+A  AL   + +T     I    E+T+   +   +       + 
Sbjct: 113 TVIDDAMQRAPVFVFEDARAALAFGKWVTDNFELIKAKAEETTSVGKLRDIEQYAVSKMR 172

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQW-SYLHYGSVSGNICSDKKATAINGIMGR 180
           +LR  F  GDA+G NMV+KA      W+ +Q  + L + ++SGN+ +DKK + +N +  R
Sbjct: 173 WLRFNFTCGDAAGQNMVSKATRHACQWMQAQHIAGLEHFALSGNLDTDKKHSFVNSLHTR 232

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK  VAE TI   + +  +  SP+ +       N+ G F+AG + S  AHFAN + A ++
Sbjct: 233 GKRVVAETTIPADLMKSLMHCSPDALFKQRQLSNM-GAFVAGSV-SNGAHFANGITALFI 290

Query: 241 ATGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
           A GQD AN+ E S G TY+++  +   YFS TIP+L++   G G  +   +  L  LGC 
Sbjct: 291 ACGQDVANVAESSAGYTYSEITPNGDYYFSITIPSLVVASYGGGTGLATQRECLETLGCY 350

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAA 329
              +      +LA I AATVLCGELSL AA
Sbjct: 351 GNGRV----NKLAEIIAATVLCGELSLGAA 376


>gi|323303634|gb|EGA57422.1| Hmg1p [Saccharomyces cerevisiae FostersB]
          Length = 1054

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 178/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 689  MPLPVGVIGPLVIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 743

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 744  TRGPVVRFPTLKRSGACKIWLDSEEGQNAIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 803

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 804  TTTGDAMGMNMISKGVEYSLKQMVEEYDWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 863

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +K L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 864  VAEATIPGDVVRKVLKSDVSALVELNIAKNLVGSAMAGSVGGFNAHAANLVTAVFLALGQ 923

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 924  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHAT 983

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL AA    G L+++H+   R
Sbjct: 984  APGTNARQLARIVACAVLAGELSLCAALA-AGHLVQSHMTHNR 1025


>gi|195449956|ref|XP_002072300.1| GK22403 [Drosophila willistoni]
 gi|194168385|gb|EDW83286.1| GK22403 [Drosophila willistoni]
          Length = 926

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 184/345 (53%), Gaps = 16/345 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G        VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 567 VPIPVGYAGPLMLDGQ----SYYVPMATTEGALVASTNRGCK--ALSVRGVRSVVEDVGM 620

Query: 69  TRSI---FFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           TR+    F     A +A   +++  +   +I    + TS+F R    H  + G  L++R 
Sbjct: 621 TRAPCVRFPSVARASLAKLWIED-EVNYQQIKTEFDSTSRFGRLKDCHIAMDGPQLYIRF 679

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NMV+K A+  +  I  ++  +   S+SGN C DKK  AIN I GRGK  V
Sbjct: 680 VALTGDAMGMNMVSKGAEMALRRIKREFPDMQIISLSGNFCCDKKPAAINWIKGRGKRVV 739

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE TI  A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LATGQD
Sbjct: 740 AECTIPAATLKSVLKTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQD 799

Query: 246 AANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            A  V  S   T  +    + + LY +CT+P+L +G VG G  +P     L  LG     
Sbjct: 800 PAQNVTSSNCSTAMECWVENSEDLYMTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGAH 859

Query: 303 KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            T  GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 860 ATQPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 903


>gi|170095946|ref|XP_001879193.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164645561|gb|EDR09808.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 555

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 186/350 (53%), Gaps = 12/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  I +P+   GP+ I G +      +P+AT E  L  S  RG   ++    G+   +  
Sbjct: 169 VGYIPIPLGIAGPLNIDGTLY----PIPMATAEGTLVASTSRGCK-ALNAGGGVTTVVTR 223

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR    +  +  +A  A   I  ++  A I    E TS+F +   L + +AG  L++
Sbjct: 224 DGMTRGPAIDFPSIIVAAEAKAWIASEEGYATIKTAFESTSRFAKLSSLKTALAGRTLYV 283

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   ATGDA G NM++K  +  ++ +  ++  +   ++SGN C+DKK  AIN I GRGK+
Sbjct: 284 RFTTATGDAMGMNMISKGTEKALEALQLKFPQMVVLALSGNYCTDKKPAAINWIEGRGKS 343

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            VAE  I   + +  L+T+ + +  LNT+KNLIG+ +AG I   NAH AN+L A +LATG
Sbjct: 344 VVAEAVIPGNVVKTVLKTTVDSLCNLNTKKNLIGSAMAGSIGGFNAHAANILTAVFLATG 403

Query: 244 QDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +  + L  + ++P + +G VG G  +   +  L  LG    
Sbjct: 404 QDPAQNVESSMCMTLMEPTNGGEDLLMTVSMPCIEVGTVGGGTVLAPQQGCLDLLGVKGA 463

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
              + G NA+ LA + AA V+ GELSLL+A    G L+ AH+   R   N
Sbjct: 464 HPSQPGKNAQTLARVIAAAVMAGELSLLSALAA-GHLIRAHMAHNRSQTN 512


>gi|256269737|gb|EEU05004.1| Hmg1p [Saccharomyces cerevisiae JAY291]
          Length = 1054

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 178/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 689  MPLPVGVIGPLVIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 743

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 744  TRGPVVRFPTLKRSGACKIWLDSEEGQNAIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 803

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 804  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 863

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +K L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 864  VAEATIPGDVVRKVLKSDVSALVELNIAKNLVGSAMAGSVGGFNAHAANLVTAVFLALGQ 923

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 924  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHAT 983

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL AA    G L+++H+   R
Sbjct: 984  APGTNARQLARIVACAVLAGELSLCAALA-AGHLVQSHMTHNR 1025


>gi|255714308|ref|XP_002553436.1| KLTH0D16786p [Lachancea thermotolerans]
 gi|238934816|emb|CAR22998.1| KLTH0D16786p [Lachancea thermotolerans]
          Length = 1046

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 182/350 (52%), Gaps = 20/350 (5%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  
Sbjct: 676  IGYMPLPVGVIGPLVIDGV----PYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTK 730

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGN 119
            + MTR   + F T    +A     +I L   E    + +    TS+F R     + +AG+
Sbjct: 731  DGMTRGPCVRFPT----LARAGACKIWLDSEEGQNRVKKAFNSTSRFARLQHCQTALAGD 786

Query: 120  LLFLRLEFATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGI 177
            LLF+R    TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I
Sbjct: 787  LLFIRFRTTTGDAMGMNMISKGVEFSLKQMVEEFGWDDMSIVSVSGNYCTDKKPAAINWI 846

Query: 178  MGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA 237
             GRGK+ VAE  I   + +K L++  + ++ LN  KNLIG+ +AG +   NAH AN+L A
Sbjct: 847  EGRGKSVVAEAIIPGDVVRKVLKSDVKALVELNISKNLIGSAMAGSVGGFNAHAANLLTA 906

Query: 238  YYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
             YLA GQD A  VE S  +T     +  L  S ++P++ +G +G G  +      L  LG
Sbjct: 907  VYLALGQDPAQNVESSNCITLMNEVNGDLKISVSMPSIEVGTIGGGTILEPQSAMLDLLG 966

Query: 298  CIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                  T  GDNAR+LA + A  VL GELSL +A    G L+++H+ L R
Sbjct: 967  VRGPHPTAPGDNARQLAKVVACAVLAGELSLCSALA-AGHLVQSHMILNR 1015


>gi|166204095|gb|ABY84848.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Ganoderma lucidum]
 gi|166204097|gb|ABY84849.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Ganoderma lucidum]
          Length = 1226

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 124/347 (35%), Positives = 185/347 (53%), Gaps = 12/347 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+KI G +      +P+AT E  L  S  RG   ++    G+   L  + M
Sbjct: 844  MPLPLGIAGPLKIDGLMY----PIPMATAEGTLVASTSRGCK-ALNAGGGVTTVLTADGM 898

Query: 69   TR--SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR  +I F +        A  E     A I    E TS+F +  ++   +AG  LF+R  
Sbjct: 899  TRGPAIDFPSIVRAAEAKAFIESEDGYATIREAFESTSRFAKLQKIKCALAGRTLFVRFA 958

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
              TGDA G NM++KA +  +D +  ++  +   ++SGN C+DKK  AI+ I GRGK+ VA
Sbjct: 959  TRTGDAMGMNMISKATEKALDVLSHEFPEMVVLALSGNYCTDKKPAAISWIEGRGKSIVA 1018

Query: 187  EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
            E  I   + +  L+T+ E +  +NT+KNLIG+ +AG +   NAH AN+L A +LATGQD 
Sbjct: 1019 EAVIPGKVVKSVLKTTVESLCNVNTKKNLIGSAMAGSVGGFNAHAANILTAVFLATGQDP 1078

Query: 247  ANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            A  VE S  +T  +  +  + L  + ++P + +G VG G  +      L  LG      T
Sbjct: 1079 AQNVESSNCMTLMEPTNGGEDLLMTISMPCIEVGTVGGGTILEPQGAVLDLLGVRGAHPT 1138

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
              G NA++LA I A+ V+ GELSL++A    G L+ AHL   R  LN
Sbjct: 1139 NPGQNAQQLARIIASAVMAGELSLISALAA-GHLVRAHLAHNRSQLN 1184


>gi|91773084|ref|YP_565776.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanococcoides
           burtonii DSM 6242]
 gi|91712099|gb|ABE52026.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Methanococcoides burtonii
           DSM 6242]
          Length = 414

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 133/348 (38%), Positives = 204/348 (58%), Gaps = 16/348 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+   G + + G     +  +PLAT E  L  SV RG  + +    G    +  
Sbjct: 75  IGTIQIPLGVAGAIMVNGEYASGEFMLPLATTEGALVASVNRGCTV-ITASGGSNVRIFQ 133

Query: 66  ERMTRSIFFETENAEMALTALQEIT--LKKAE-IARVIEQTSQFTRFLQLHSQ---IAGN 119
           + MTR+  F+ EN    +  ++E    +K+ E    + E+  + TRF +L S    I GN
Sbjct: 134 DLMTRAPVFKLEN----VNKVKEFVDWVKREETFTNMKEKAGETTRFGELLSVDPFITGN 189

Query: 120 LLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMG 179
            +FLR  + T DA G NMVT A DAV+++I   +  ++  S+SGN+C+DKK  AIN I+G
Sbjct: 190 TVFLRFAYDTKDAMGMNMVTIATDAVLNFISEDFG-VYPISLSGNMCTDKKPAAINNILG 248

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
           RGK   A++TI + I +K L+T+P+ +  +N +KNL+G+  AG +   NAH AN++ A Y
Sbjct: 249 RGKTVAADVTIPKEIVEKKLKTTPKMMEEVNYRKNLLGSARAGAL-GFNAHAANIIAALY 307

Query: 240 LATGQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           LA GQDAA++VEGS  +T  +++++  LY S T+P++ +G VG G  I   ++ L  LG 
Sbjct: 308 LACGQDAAHVVEGSSAITTMEVNENGDLYCSVTLPSIQVGTVGGGTGIATQRDCLNLLGV 367

Query: 299 IEERKT-GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               +  G N+++LA I AA VL GE+SL+ AQ   G L +AH  L R
Sbjct: 368 AGAGEVPGHNSKKLAEIIAAAVLAGEISLIGAQA-AGHLAKAHAELGR 414


>gi|24649399|ref|NP_732900.1| HMG coenzyme A reductase, isoform A [Drosophila melanogaster]
 gi|45553469|ref|NP_996271.1| HMG coenzyme A reductase, isoform B [Drosophila melanogaster]
 gi|281362379|ref|NP_001163703.1| HMG coenzyme A reductase, isoform C [Drosophila melanogaster]
 gi|66774181|sp|P14773|HMDH_DROME RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|7301039|gb|AAF56175.1| HMG coenzyme A reductase, isoform A [Drosophila melanogaster]
 gi|45446606|gb|AAS65198.1| HMG coenzyme A reductase, isoform B [Drosophila melanogaster]
 gi|272477127|gb|ACZ94998.1| HMG coenzyme A reductase, isoform C [Drosophila melanogaster]
          Length = 920

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 129/346 (37%), Positives = 184/346 (53%), Gaps = 18/346 (5%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 561 VPIPVGYAGPLLLDG----ETYYVPMATTEGALVASTNRGCK--ALSVRGVRSVVEDVGM 614

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVI----EQTSQFTRFLQLHSQIAGNLLFLR 124
           TR+      +   A  A   I  +  E  RV+    + TS+F R    H  + G  L++R
Sbjct: 615 TRAPCVRFPSVARAAEAKSWI--ENDENYRVVKTEFDSTSRFGRLKDCHIAMDGPQLYIR 672

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
               TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK  
Sbjct: 673 FVAITGDAMGMNMVSKGAEMALRRIQLQFPDMQIISLSGNFCCDKKPAAINWIKGRGKRV 732

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           V E TI+ A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LATGQ
Sbjct: 733 VTECTISAATLRSVLKTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQ 792

Query: 245 DAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           D A  V  S   T  +    + + LY +CT+P+L +G VG G  +P     L  LG    
Sbjct: 793 DPAQNVTSSNCSTAMECWAENSEDLYMTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGA 852

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              + GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 853 HATRPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 897


>gi|11464503|gb|AAG35211.1|AF123438_1 3-hydroxy-3-methylglutaryl coenzyme A reductase [Haloarcula
           hispanica]
          Length = 405

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 117/341 (34%), Positives = 172/341 (50%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V ++ +PM  +GP+ + G   +    +PLAT E  L  SV RG   ++    G  A ++ 
Sbjct: 69  VGAVQVPMGVVGPLPVDGGAAEGDHHLPLATSEGALLASVNRGVS-TIRNAGGATARVLK 127

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F  E+   A      +      +A   E T+       +   + G+ +FLR 
Sbjct: 128 SGMTRAPVFRVEDVAKAGEVSAWVREHVDVLADAAESTTSHGELQDVTPYVVGDSVFLRF 187

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NM T A +A  D + S+ +     ++SGN+CSDKK  AIN + GRG+   
Sbjct: 188 SYDTKDAMGMNMATIATEAACDVVESE-TPADLVALSGNLCSDKKPAAINAVEGRGRTVA 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++ I     ++ L T+ + I+  NT+KNL+G+  AG +   NAH AN++ A +LA GQD
Sbjct: 247 ADVLIPHEQVEERLDTTSDAIVEANTRKNLVGSAKAGAL-GFNAHTANVVAAAFLALGQD 305

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKN-NLTALGCIEERKT 304
            A +VEG+  +T     +D LY S TIP L +G VG G+   A     +           
Sbjct: 306 IAQVVEGNNAITTVDAREDGLYASVTIPFLEVGNVGRGRFPEAFGGLEVGGDNGGGGDPA 365

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA  L  + A   L GELSLLAA ++   L  AH  L R
Sbjct: 366 GSNAEALGEVIAGGALAGELSLLAALSSR-HLSSAHAELGR 405


>gi|133722002|gb|ABO37160.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Phaedon cochleariae]
          Length = 887

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/350 (35%), Positives = 189/350 (54%), Gaps = 20/350 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+ + GP+ + G     ++ VP+AT E  L  S  RG     L   G+ ++++ 
Sbjct: 518 IGYMPVPVGYAGPLLLDGR----ELYVPMATTEGCLVASTNRGCR--ALKTVGVASSIVA 571

Query: 66  ERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR       +   A  AL+  E     A++    + TS+F R  +L  +IAG  LF+
Sbjct: 572 DGMTRGPVVRFPSLVEASAALKWMETPENFAKMKAEFDSTSRFARLSKLLIRIAGRYLFI 631

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NM++K  +  +  + + +  +   S+SGN C+DKK  A+N I GRGK+
Sbjct: 632 RFVAKTGDAMGMNMLSKGTEIALKHVQNVFPDMEILSLSGNFCTDKKPAAVNWIEGRGKS 691

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  +   I    L+T+ + ++ +N  KN+IG+ +AG I   NAH  N++ A ++ATG
Sbjct: 692 VVCEAIVPSQIVTSVLKTTVQALVDVNYSKNMIGSAVAGSIGGFNAHAGNIVTAIFIATG 751

Query: 244 QDAANIVEGSQGLT----YAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC- 298
           QD A  +  S  +T    + K  +D LY SCT+P++ +G VG G  +PA  + L  LG  
Sbjct: 752 QDPAQNIGSSHCMTLMEPWGKAGED-LYISCTMPSIEIGTVGGGTVLPAQASCLEMLGVR 810

Query: 299 ---IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              IE    G+NA +LA I    VL GELSL+AA    G L+ +HLR  R
Sbjct: 811 GANIE--CPGENANQLARIVCGLVLAGELSLMAALA-AGHLVRSHLRHNR 857


>gi|294495244|ref|YP_003541737.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanohalophilus
           mahii DSM 5219]
 gi|292666243|gb|ADE36092.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanohalophilus
           mahii DSM 5219]
          Length = 414

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 127/346 (36%), Positives = 189/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+KI G   Q    +PLAT E  L  SV RG   ++    G    + +
Sbjct: 75  IGAVQVPLGIAGPVKIRGEFAQGDYYLPLATTEGALVASVNRGCS-AISASGGTVVRVFN 133

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLL 121
           E MTR+  F   +   A   +  I  K  ++   ++    +T++F +   +   + GN +
Sbjct: 134 EVMTRAPVFRMNDINHAKEFVDWI--KDGDVFEQLQNKASETTRFGKLTDVGPYVLGNNV 191

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           +LR EF T DA G NMVT A  A++D I  ++  ++  S+SGN+CSDKK  AIN I GRG
Sbjct: 192 YLRFEFDTKDAMGMNMVTIATQAIVDLISDEFG-VYPVSLSGNMCSDKKPAAINNIKGRG 250

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K  V E+ +   + +K L+T+P+ +  +N +KNL+G+  A  +   NAH AN++ A Y+A
Sbjct: 251 KTVVVEVELTAEVVEKKLKTTPQAMEEVNYRKNLLGSARAQSL-GFNAHAANIIAAMYIA 309

Query: 242 TGQDAANIVEGSQGLTYAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            GQD A++VEGS  +T   +    SLY + T+P L LG VG G  I      L  LG   
Sbjct: 310 CGQDPAHVVEGSSAITTMDVTKYGSLYCTVTLPALQLGTVGGGTKIGTQAECLGLLGVAG 369

Query: 301 ERKT-GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G N+++LA I A+ VL GE+SL+ AQ   G L  AH  L R
Sbjct: 370 GSDVPGANSKKLAEIIASAVLAGEISLVGAQA-AGHLARAHAELGR 414


>gi|195392349|ref|XP_002054820.1| GJ22582 [Drosophila virilis]
 gi|194152906|gb|EDW68340.1| GJ22582 [Drosophila virilis]
          Length = 921

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 188/348 (54%), Gaps = 22/348 (6%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 562 VPIPVGYAGPLLLDG----ESYYVPMATTEGALVASTNRGCK--ALSVRGVRSVVEDVGM 615

Query: 69  TRS--IFFET----ENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           TR+  + F +      A+  + + +   L K E     + TS+F R  + H  + G  L+
Sbjct: 616 TRAPCVRFPSVARASEAKKWIESEENYKLVKTEF----DSTSRFGRLKECHIAMDGPQLY 671

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R    TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK
Sbjct: 672 IRFVALTGDAMGMNMVSKGAEMALRCIKRQFPDMQIISLSGNFCCDKKPAAINWIKGRGK 731

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
             VAE TI  A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LAT
Sbjct: 732 RVVAECTIPAATLRSVLKTDAKTLVECNKLKNMSGSAMAGSIGGNNAHAANMVTAVFLAT 791

Query: 243 GQDAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
           GQD A  V  S   T  +    +D+ LY +CT+P+L +G VG G  +P     L  LG  
Sbjct: 792 GQDPAQNVTSSNCSTAMECWPENDEDLYMTCTMPSLEVGTVGGGTGLPGQGACLDMLGVR 851

Query: 300 EERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 852 GAHATQPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 898


>gi|190610724|gb|ACE80213.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Pyrus pyrifolia]
          Length = 609

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 183/346 (52%), Gaps = 11/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G   ++    P+AT E  L  S  RG     L   G  + L+ 
Sbjct: 258 VGYVQIPVGIAGPLLLDG---REYSVPPMATTEGCLVASTNRGCKAINLS-GGATSVLLR 313

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E       ++ V  ++S+F R   +   IAG  L++
Sbjct: 314 DGMTRAPCVRFNSAKRAAELKFYLEDPNNYDTLSAVFNRSSRFGRLQTIKCAIAGKNLYM 373

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K A  V+D++ + +  +    +SGN CSDKK  A+N I GRGK+
Sbjct: 374 RFTCSTGDAMGMNMVSKGAQNVLDFLQNDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKS 433

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+   +  LN  KNL G+ +AG +   NAH +N++ A Y+ATG
Sbjct: 434 VVCEAVIKGDVVQKVLKTNVASLCELNMLKNLTGSAMAGALGGFNAHASNIVSAIYIATG 493

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P+  +G VG G  + +    L  LG    
Sbjct: 494 QDPAQNVESSHCITMMEPINDGQDLHVSVTMPSTEVGTVGGGTQLASQSACLNLLGVKGA 553

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A +VL GELSL++A  + G+L+ +H++  R
Sbjct: 554 NREAPGSNARLLATVVAGSVLAGELSLMSA-ISAGQLVNSHMKYNR 598


>gi|2072322|gb|AAB53748.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Oryza sativa]
          Length = 495

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 190/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G    ++  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 146 VGYVQLPVGVAGPLVLDG----ERFYVPMATTEGCLVASTNRGCK-AIAESGGATSVVLQ 200

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+      +A  A  L    E       +A V  ++S+F R  ++   +AG  L++
Sbjct: 201 DGMTRAPVARFPSARRAAELKGFLENPANVDTLAMVFNRSSRFARLQRVKCAVAGRNLYM 260

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK+ A+N I GRGK+
Sbjct: 261 RFSCSTGDAMGMNMVSKGVQNVLDYLQDDFPDMDVISISGNFCSDKKSAAVNWIEGRGKS 320

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 321 VVCEAVIKEEVVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 380

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 381 QDPAQNVESSQCITMLEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGA 440

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LAA+ A  VL GELSL++AQ   G L+++H++  R
Sbjct: 441 NRESPGSNARLLAAVVAGAVLAGELSLISAQA-AGHLVQSHMKYNR 485


>gi|76800838|ref|YP_325846.1| hydroxymethylglutaryl-CoA reductase (NADPH) 1 [Natronomonas
           pharaonis DSM 2160]
 gi|76556703|emb|CAI48275.1| hydroxymethylglutaryl-CoA reductase (NADPH) 1 [Natronomonas
           pharaonis DSM 2160]
          Length = 539

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 168/322 (52%), Gaps = 11/322 (3%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAH-ISMLCPDGIRATLIDERMT 69
           MP+   GP+K+ G        +PLAT E  L  S  RG   I+M    G  AT++D+RM 
Sbjct: 209 MPLGLAGPVKVNGEHADGYYPIPLATTEGTLVASYSRGMKAINMAG--GATATVVDDRMN 266

Query: 70  RSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFAT 129
           R+  F  E+A  A      +      +    E+TS     +++   +  NL  LR  F T
Sbjct: 267 RAPVFVFEDARNARDFRDWVFDHYDTMKEKAEETSSVAELVEIEDYMTNNLAHLRFSFRT 326

Query: 130 GDASGHNMVTKAADAVMDWILSQW-SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           GDA+G NMV KA  A  +W L ++  Y+    + GN  +DKKA+ +N +M RGK   AE+
Sbjct: 327 GDAAGQNMVGKATFAACNWALQEYPGYVENFYLEGNFATDKKASKVNDMMTRGKRVTAEV 386

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
           T++   C  +L   PE +   +++   +G+F++G   +  AH AN L A ++ATGQD AN
Sbjct: 387 TLDEETCIHHLGAEPESLD-HHSKIGTLGSFMSGA-NTNGAHPANGLAALFIATGQDEAN 444

Query: 249 IVEGSQG-LTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307
           + E S   L    L D+SL+ S TIP+LI+   G G  +   +  L  L C     TG N
Sbjct: 445 VAESSAAILNTTLLADNSLHISVTIPSLIVATYGGGTGMATQQECLAMLDC---NGTG-N 500

Query: 308 ARRLAAICAATVLCGELSLLAA 329
             +LA I A  VL GELSL AA
Sbjct: 501 VNKLAEIAATVVLAGELSLGAA 522


>gi|67526719|ref|XP_661421.1| hypothetical protein AN3817.2 [Aspergillus nidulans FGSC A4]
 gi|40740835|gb|EAA60025.1| hypothetical protein AN3817.2 [Aspergillus nidulans FGSC A4]
 gi|259481626|tpe|CBF75320.1| TPA: hypothetical protein similar to HMG-CoA reductase (Eurofung)
            [Aspergillus nidulans FGSC A4]
          Length = 1125

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 122/346 (35%), Positives = 183/346 (52%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            + ++ +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  
Sbjct: 759  IGTLPLPLGVAGPLVIDGQ----SYFIPMATTEGVLVASASRGAK-AINAGGGAVTVLTG 813

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   + F T     A     +    K+ +      TS+F R   L + +AG  L++
Sbjct: 814  DGMTRGPCVGFPTLARAAAAKVWLDSEEGKSVMTAAFNSTSRFARLQHLKTALAGTYLYI 873

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGRG 181
            R +  TGDA G NM++K  +  +  + ++  +      SVSGN C+DKKA A+N I GRG
Sbjct: 874  RFKTTTGDAMGMNMISKGVEKALHVMATECGFDDMATISVSGNFCTDKKAAALNWIDGRG 933

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ VAE  I   + +  L++  + ++ LNT KNLIG+ +AG +   NAH +N++ A +LA
Sbjct: 934  KSVVAEAIIPGDVVRNVLKSDVDALVELNTSKNLIGSAMAGSLGGFNAHASNIVTAIFLA 993

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A  VE S  +T  K  + +L  + ++P++ +G +G G  + A    L  LG    
Sbjct: 994  TGQDPAQNVESSSCITTMKNTNGNLQIAVSMPSIEVGTIGGGTILEAQGAMLDLLGVRGS 1053

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1054 HPTNPGDNARQLARIVAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1098


>gi|322372182|ref|ZP_08046723.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Haladaptatus
           paucihalophilus DX253]
 gi|320548191|gb|EFW89864.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Haladaptatus
           paucihalophilus DX253]
          Length = 403

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 180/344 (52%), Gaps = 11/344 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V +I +P+   GP+ ++G     +  +PLAT E  L  SV RG  + +    G  A +  
Sbjct: 67  VGTIQVPLGVAGPVAVSGGSADGEYYLPLATTEGALLASVNRGCSV-IDSAGGADARVTK 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F  +    A   +  +   +  +A   E T+     L + + + G+ +FLR 
Sbjct: 126 QGMTRAPVFRVQGITEAEEVVNWVRDNRDALAETAESTTNHGELLDVTTYVVGDSVFLRF 185

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NM T A       +  + +     ++SGN+CSDKK  AIN + GRG++  
Sbjct: 186 VYDTKDAMGMNMATIATREAASLV-EEETPASLVALSGNLCSDKKPAAINAVEGRGRSVT 244

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++ I R + ++ L T+PE I   NT+KNL+G+  AG +   NAH AN++ A +LATGQD
Sbjct: 245 ADVKIPREVVEERLHTTPEAIEEANTRKNLVGSAKAGAL-GFNAHAANVVAAAFLATGQD 303

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
           AA +VEGS  +T  +  +D LY S +I +L +G VG G  +P     L  LG    R  G
Sbjct: 304 AAQVVEGSNAITTVEAREDELYASVSIASLEVGTVGGGTKLPTQAEALDVLGL---RGGG 360

Query: 306 D----NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           D    NA  LA I     L GELSLLAA  +   L  AH  L R
Sbjct: 361 DPAGSNADALAEIITVGALAGELSLLAALASR-HLSSAHEELGR 403


>gi|26347907|dbj|BAC37602.1| unnamed protein product [Mus musculus]
          Length = 336

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 118/325 (36%), Positives = 173/325 (53%), Gaps = 9/325 (2%)

Query: 32  VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENA--EMALTALQEI 89
           VP+AT E  L  S  RG     L   G  + ++ + MTR        A     +    E 
Sbjct: 1   VPMATTEGCLVASTNRGCRAISL-GGGASSRVLADGMTRGPVVRLPRACDSAEVKTWLET 59

Query: 90  TLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWI 149
               A I    + TS+F R  +LH  +AG  L++R +  TGDA G NM++K  +  +  +
Sbjct: 60  PEGFAVIKEAFDSTSRFARLQKLHVTMAGRNLYIRFQSRTGDAMGMNMISKGTEKALLKL 119

Query: 150 LSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILL 209
              +  +   +VSGN C+DKK  AIN I GRGK  V E  I   + ++ L+T+ E ++ +
Sbjct: 120 QEFFPDMQILAVSGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREVLKTTTEAMVDV 179

Query: 210 NTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLH---DDSL 266
           N  KNL+G+ +AG I   NAH AN++ A Y+A GQDAA  V  S+ +T  +     ++ L
Sbjct: 180 NINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSKCITLMEASGPTNEDL 239

Query: 267 YFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAAICAATVLCGEL 324
           Y SCT+P++ +G VG G N+   +  L  LG     K   G+NAR+LA I   TV+ GEL
Sbjct: 240 YISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGEL 299

Query: 325 SLLAAQTNPGELMEAHLRLERMHLN 349
           SL+AA    G L+ +H+   R  +N
Sbjct: 300 SLMAALA-AGHLVRSHMVHNRSKIN 323


>gi|29468180|gb|AAO85434.1|AF479817_1 HMG-CoA reductase [Emericella nidulans]
          Length = 1090

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 122/346 (35%), Positives = 183/346 (52%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            + ++ +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  
Sbjct: 724  IGTLPLPLGVAGPLVIDGQ----SYFIPMATTEGVLVASASRGAK-AINAGGGAVTVLTG 778

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   + F T     A     +    K+ +      TS+F R   L + +AG  L++
Sbjct: 779  DGMTRGPCVGFPTLARAAAAKVWLDSEEGKSVMTAAFNSTSRFARLQHLKTALAGTYLYI 838

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGRG 181
            R +  TGDA G NM++K  +  +  + ++  +      SVSGN C+DKKA A+N I GRG
Sbjct: 839  RFKTTTGDAMGMNMISKGVEKALHVMATECGFDDMATISVSGNFCTDKKAAALNWIDGRG 898

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ VAE  I   + +  L++  + ++ LNT KNLIG+ +AG +   NAH +N++ A +LA
Sbjct: 899  KSVVAEAIIPGDVVRNVLKSDVDALVELNTSKNLIGSAMAGSLGGFNAHASNIVTAIFLA 958

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A  VE S  +T  K  + +L  + ++P++ +G +G G  + A    L  LG    
Sbjct: 959  TGQDPAQNVESSSCITTMKNTNGNLQIAVSMPSIEVGTIGGGTILEAQGAMLDLLGVRGS 1018

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1019 HPTNPGDNARQLARIVAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1063


>gi|14572556|gb|AAK64657.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Malus x domestica]
          Length = 608

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 180/346 (52%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG     L   G    L+ 
Sbjct: 258 VGYVQIPVGIAGPLMLDGR----EFSVPMATTEGCLVASTNRGFKAINLS-GGATNVLLK 312

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F +      L    E       +  V  ++S+F R   +   IAG  L++
Sbjct: 313 DGMTRAPCVRFNSAKRAAELKFYLEEPKNYDTLPTVFNRSSRFGRLQTIKCAIAGKNLYM 372

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGD  G NMV+K    V+D++ + +  +    +SGN CSDKK  A+N I GRGK+
Sbjct: 373 RFTCSTGDXMGMNMVSKGVQNVLDFLQNDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKS 432

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+   +  LN  KNL G+ +AG +   NAH +N++ A Y+ATG
Sbjct: 433 VVCEAVIKGDVVQKVLKTNVASLCELNMLKNLTGSAMAGALGGFNAHASNIVSAIYIATG 492

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 493 QDPAQNVESSHCITMMEPINDGQDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 552

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LA + A +VL GELSL++A  + G+L+ +H++  R
Sbjct: 553 NREAPGSNARLLATVVAGSVLAGELSLMSA-ISAGQLVNSHMKYNR 597


>gi|320582711|gb|EFW96928.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pichia angusta DL-1]
          Length = 1050

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 125/348 (35%), Positives = 192/348 (55%), Gaps = 23/348 (6%)

Query: 11   MPMRWIGPMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            MP+    P+ + G +I D V   +P+AT E  L  S  RG   ++    G++  L ++ M
Sbjct: 674  MPI----PVGVAGPMIIDGVPYHIPMATTEGCLVASTMRGCK-AINAGGGVQTVLTNDGM 728

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQ----TSQFTRFLQLHSQIAGNLLF 122
            TR   I F T    +A +   ++ L   E  +V++     TS+F R   L + +AG LLF
Sbjct: 729  TRGPCISFPT----LARSGAAKMWLDSEEGQKVMKSAFNSTSRFARLQHLQTAMAGTLLF 784

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +++++++  +  +   S+SGN C+DKKA AIN I GR
Sbjct: 785  IRFKTTTGDAMGMNMISKGVEYALNYMINECGFDDMEIISLSGNYCTDKKAAAINWIEGR 844

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VA   +     +K L++  + ++ LN  KNLIG+ +AG +   NAH AN++ A YL
Sbjct: 845  GKSVVAAAIVPAETVRKVLKSDVDALVELNVSKNLIGSAMAGSVGGFNAHAANLVTAVYL 904

Query: 241  ATGQDAANIVEGSQGLTYA-KLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
            ATGQD A  VE S  +T   KL +  L  S ++P++ +G +G G  +      L  LG  
Sbjct: 905  ATGQDPAQNVESSNCITLMNKLPNGDLQISVSMPSIEVGTIGGGTVLEPQGAMLELLGVK 964

Query: 300  EERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                T  G NAR+LA I A+ VL  ELSL +A    G L+++H+   R
Sbjct: 965  GPHPTEPGANARQLAKIVASAVLAAELSLCSALA-AGHLVQSHMTHNR 1011


>gi|302794769|ref|XP_002979148.1| hypothetical protein SELMODRAFT_177513 [Selaginella moellendorffii]
 gi|300152916|gb|EFJ19556.1| hypothetical protein SELMODRAFT_177513 [Selaginella moellendorffii]
          Length = 554

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 121/350 (34%), Positives = 188/350 (53%), Gaps = 12/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 189 VGYVQIPVGVAGPLLLDGL----EYTVPMATTEGCLVASTNRGCK-AIHQSGGAVSEILK 243

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + +TR+  + F +      L    E T     I+ V  +TS+F R   +   +AG   ++
Sbjct: 244 DGITRAPVVSFSSLKGAAELKFYLEDTNNFDTISTVFNRTSRFARLQSVKCLLAGRNAYI 303

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NM++K    V+D++   +  +   SVSGN+C+DKKAT++N I GRGK+
Sbjct: 304 RFCCSTGDAMGMNMISKGVQNVLDYLHDVFPDMCVISVSGNLCADKKATSVNWIEGRGKS 363

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   +  K L+TS   ++ LNT KNL G+ LAG +   NAH +N++ A ++ATG
Sbjct: 364 VVCEAVIKGDVVSKVLKTSVSALVELNTLKNLAGSALAGAVGGFNAHASNIVSAVFIATG 423

Query: 244 QDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ LT  +  +    LY S T+P++ +G +G G  + +    L  LG    
Sbjct: 424 QDPAQNVESSQCLTLMEATNCGKDLYVSVTMPSVEVGTIGGGTQLASQSACLNLLGIKGS 483

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
                G NA+ LA + A  VL GELSL++A    G+L+++H++  R   N
Sbjct: 484 NPDSPGLNAQTLARVVAGAVLAGELSLMSALA-AGQLVKSHMKYNRSSKN 532


>gi|195112218|ref|XP_002000671.1| GI10363 [Drosophila mojavensis]
 gi|193917265|gb|EDW16132.1| GI10363 [Drosophila mojavensis]
          Length = 917

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 129/344 (37%), Positives = 187/344 (54%), Gaps = 14/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 558 VPIPVGYAGPLLLDG----ETYYVPMATTEGALVASTNRGCK--ALSVRGVRSVVEDVGM 611

Query: 69  TRSIFFETENAEMALTALQEI-TLKKAEIARV-IEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      +   A  A + I + +  E+ +   + TS+F R  + H  + G  L++R  
Sbjct: 612 TRAPCVRFPSVARASEAKKWIESAENYEVVKTEFDSTSRFGRLKECHIAMDGPQLYIRFV 671

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK  V 
Sbjct: 672 ALTGDAMGMNMVSKGAEMALRCIKRQFPDMQIISLSGNFCCDKKPAAINWIKGRGKRVVT 731

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E TI+ A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LATGQD 
Sbjct: 732 ECTISAATLRSVLKTDAKTLVECNKLKNMSGSAMAGSIGGNNAHAANMVTAVFLATGQDP 791

Query: 247 ANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           A  V  S   T  +    +++ LY +CT+P+L +G VG G  +P     L  LG      
Sbjct: 792 AQNVTSSNCSTAMECWNENNEDLYMTCTMPSLEVGTVGGGTGLPGQGACLDLLGVRGAHA 851

Query: 304 T--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           T  GDNAR+LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 852 THPGDNARKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 894


>gi|50293713|ref|XP_449268.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49528581|emb|CAG62242.1| unnamed protein product [Candida glabrata]
          Length = 1056

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 122/346 (35%), Positives = 180/346 (52%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G+   L  
Sbjct: 683  IGYMPLPVGVIGPLVIDGV----SYHIPMATTEGCLVASAMRGCK-AINAGGGVTTVLTK 737

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   + F +     A     +    + +I +  + TS+F R     + +AG+LLF+
Sbjct: 738  DGMTRGPCVRFPSLTRAGACKIWLDSEEGQNQIKKAFDSTSRFARLQHAQTALAGDLLFI 797

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  + V+  ++ +  W  +   SVSGN C+DKK  AIN I GRG
Sbjct: 798  RFRTTTGDAMGMNMISKGVEFVLKQMVEEFGWHDMEIVSVSGNYCTDKKPAAINWIEGRG 857

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ VAE  I   + +K L++    ++ LN  KNLIG+ +AG +   NAH AN++ A YLA
Sbjct: 858  KSIVAEAIIPGDVVRKVLKSDVSALVELNISKNLIGSAMAGSVGGFNAHAANLVTAVYLA 917

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
             GQD A  VE S  +T     +  L  S ++P++ +G +G G  +      L  LG    
Sbjct: 918  LGQDPAQNVESSNCMTLMNDVNGDLKISVSMPSIEVGTIGGGTVLDPQGAMLDLLGVRGP 977

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  G NAR+LA I A  VL GELSL AA    G L+++H+   R
Sbjct: 978  HPTNPGANARQLAKIVACAVLAGELSLCAALA-AGHLVQSHMTHNR 1022


>gi|310798729|gb|EFQ33622.1| hydroxymethylglutaryl-coenzyme A reductase [Glomerella graminicola
            M1.001]
          Length = 1185

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 123/342 (35%), Positives = 181/342 (52%), Gaps = 11/342 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 806  LPLPVGVAGPLVIDGQ----SYFLPMATTEGVLVASASRGCK-AINSGGGAVTVLTGDGM 860

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + FET     A     +    +A + +    TS F R   + + +AG  L++R +
Sbjct: 861  TRGPCVSFETLERAGAAKIWLDSEAGQATMKKAFNSTSNFARLQSMKTALAGTNLYIRFK 920

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NM++K  +  +  + S+ +  +   SVSGN C+DKKA AIN I GRGK+ V
Sbjct: 921  TTTGDAMGMNMISKGVEHALSVMASEGFEDMSIVSVSGNYCTDKKAAAINWIDGRGKSVV 980

Query: 186  AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            AE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH AN++ A +LATGQD
Sbjct: 981  AEAIIPGDVVKSVLKSDVDTLVQLNVDKNLIGSAMAGSVGGFNAHAANIVAAIFLATGQD 1040

Query: 246  AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
             A +VE +  +T  K    SL  S ++P+L +G +G G  +      L  LG      T 
Sbjct: 1041 PAQVVESANCITIMKNLRGSLQISVSMPSLEVGTLGGGTILEPQSAMLDMLGVRGPHPTT 1100

Query: 305  -GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G+N+RRLA I AA VL GELSL +A    G L+ AH++  R
Sbjct: 1101 PGENSRRLARIIAAGVLAGELSLCSALAA-GHLVRAHMQHNR 1141


>gi|516635|gb|AAA40608.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Rattus norvegicus]
          Length = 887

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 183/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 530 IGYMPIPVGVAGPLCLDGKEYQ----VPMATTEGCLVASTNRGCRAISL-GGGASSRVLA 584

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + M+R        A     + +  E     A +    + TS+F R  +LH  +AG  L++
Sbjct: 585 DGMSRGPVVRLPRACDSAEVKSWLETPEGFAVVKEAFDSTSRFARLQKLHVTLAGRNLYI 644

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           RL+  TGDA G NM++K  +  +  +      L   +VSGN C+DKK  AIN I GRGK 
Sbjct: 645 RLQSKTGDAMGMNMISKGTEKALLKLQEGVPELQILAVSGNYCTDKKPAAINWIEGRGKT 704

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E ++ +N  KNL+G+ +AG I   N H AN++ A Y+A G
Sbjct: 705 VVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNLHAANIVTAIYIACG 764

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 765 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 824

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+ +H+   R  +N
Sbjct: 825 ACKDNPGENARQLARIVCGTVMAGELSLMAALAA-GHLVRSHMVHNRSKIN 874


>gi|223999807|ref|XP_002289576.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220974784|gb|EED93113.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 368

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 194/344 (56%), Gaps = 10/344 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  I +P+  +GP+ + G    + V +P+AT E  L  S  RG   ++    G R+T++ 
Sbjct: 26  VGYIPIPVGIVGPVTLNG----ESVYIPMATTEGCLVASTNRGCK-AITQGSGARSTILR 80

Query: 66  ERMTRSIFFETENA-EMALTALQ-EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + +TR+      +A E A   L  E     A++    E T+ F + ++    +AG  +++
Sbjct: 81  DGITRAPCVRLPSAHEAAQVHLWIEEADNFAKLKEAFESTTSFGKLIEASPTVAGRNVYI 140

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           RL   +GDA G NM++K + AV++ +  Q+  L   ++SGN+C+DKKA A+N I GRGK+
Sbjct: 141 RLRCFSGDAMGMNMISKGSLAVIECLREQFPQLSLVALSGNMCTDKKAAAMNWIEGRGKS 200

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI + + +  L+TS   I+  N  KNLIG+ +AG +   NAH AN + A +LATG
Sbjct: 201 VVIEATIPKDVVRSTLKTSVPAIVEANVNKNLIGSAMAGTVGGFNAHAANNVTAVFLATG 260

Query: 244 QDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EE 301
           QD A  VE S  +T  ++  +  L+ SCT+P++ +G VG G  + A    L A+G     
Sbjct: 261 QDPAQNVESSNCITLMEVSPEGDLWISCTMPSIEVGTVGGGTGLSAQSACLRAIGVKGGG 320

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNAR+LA + A   + GELSL+AA  +   L+ AH++  R
Sbjct: 321 ENPGDNARQLAHVVACATMAGELSLMAALAS-NSLVAAHMQHNR 363


>gi|242786913|ref|XP_002480898.1| HMG-CoA reductase [Talaromyces stipitatus ATCC 10500]
 gi|218721045|gb|EED20464.1| HMG-CoA reductase [Talaromyces stipitatus ATCC 10500]
          Length = 1122

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 127/347 (36%), Positives = 190/347 (54%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GPM I G        +P+AT E  L  S  RGA  ++    G    +  + M
Sbjct: 753  LPLPLGVAGPMVIDGQ----SYFIPMATTEGVLVASTSRGAK-AINAGGGAITVVHGDGM 807

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVI----EQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A  A  +  L   E A ++    + TS+F R   L + +AG  L+
Sbjct: 808  TRGPGVSFPT----LARAAEAKNWLDSEEGASIMKAAFDSTSRFARLQNLKTALAGTNLY 863

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  ++ + +Q  +  ++  S+S N C+DKKA AIN I GR
Sbjct: 864  IRFKTTTGDAMGMNMISKGVEKALEVMATQCGFEDMNTISLSANYCTDKKAAAINWIDGR 923

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   I +  L++S + ++ LN  KNL+G+ +AG +   NAH +N++ A +L
Sbjct: 924  GKSVVAEAIIPGDIVKSVLKSSVDAMVELNISKNLVGSAMAGSLGGFNAHASNIVTAIFL 983

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K  D +L+ S ++P++ +G +G G  + A    L  LG   
Sbjct: 984  ATGQDPAQNVESSNCITLMKNLDGNLHISVSMPSIEVGTIGGGTILEAQSAMLEMLGVRG 1043

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  G+NAR+LA I AA VL GELSL AA    G L++AH+   R
Sbjct: 1044 PHPTNPGENARQLARIVAAGVLAGELSLCAALA-AGHLVKAHMAHNR 1089


>gi|93115164|gb|ABE98255.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Samia cynthia ricini]
          Length = 839

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 128/350 (36%), Positives = 185/350 (52%), Gaps = 13/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  I +P+ + GP+ + G        +P+AT E  L  S  RGA    +   G+ + + D
Sbjct: 482 IGYIGVPVGYAGPLVVDGKAYM----IPMATTEGALVASTNRGA--KAIGSRGVTSVVED 535

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
             MTR+   +  N   A    Q I  K   A I    + TS+F R  ++H  + G  L+L
Sbjct: 536 VGMTRAPAVKLPNVVRAHECRQWIDNKDNYALIKEAFDSTSRFARLQEIHIGVDGATLYL 595

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K A+  +  +   +  +   S+SGN CSDKKATA+N I GRGK 
Sbjct: 596 RFRATTGDAMGMNMVSKGAENALKLLKGYFPDMEVISLSGNYCSDKKATAMNWIKGRGKR 655

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I+    +   +T    +   N  KNL G+ LAG I   NAH ANM+ A ++ATG
Sbjct: 656 VVCETIISNESLRNIFKTDSRTLARCNKIKNLSGSALAGSIGGNNAHAANMVTAIFIATG 715

Query: 244 QDAANIVEGSQGLTYAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
           QD A  V  S   T  ++H ++   LY +CT+P+L +G VG G  +      L  LG   
Sbjct: 716 QDPAQNVTSSYCSTSMEVHGENGEDLYVTCTMPSLGVGTVGGGTVLIGQGACLDILGVRG 775

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             R+  +N+ RLA++  ATVL GELSL+AA  N  +L+++H++  R  LN
Sbjct: 776 AGRRPAENSARLASLICATVLAGELSLMAALVN-SDLVKSHMKHNRSTLN 824


>gi|89276801|gb|ABD66599.1| putative 3-hydroxy-3-methylglutaryl CoA reductase [Tuber borchii]
          Length = 1097

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 184/347 (53%), Gaps = 13/347 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+   GP+ I G +      +P+AT E  L  S  RG   ++    G    L  
Sbjct: 755  IGYMPLPVGIAGPLNIDGEIFY----LPMATTEGVLVASTSRGCK-AINAGGGAVTVLTG 809

Query: 66   ERMTRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR    E  +   A  A   I  ++ +  + +  + TS+F R   + + +AG  LF+
Sbjct: 810  DGMTRGPVVEFPSVRRAGAAKNWIDSEEGQRRLKKAFDSTSRFARLQTIKTALAGTYLFI 869

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKK  AIN I GRG
Sbjct: 870  RFRTTTGDAMGMNMISKGVECALHVMSTECGFDDMFIVSVSGNYCTDKKPAAINWIEGRG 929

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ VAE  I  A+ +  L++  + ++ LN  KNLIG+ +AG +   NAH AN++ A +LA
Sbjct: 930  KSIVAEAIIPAAVVKSVLKSDVDALVELNISKNLIGSAMAGSVGGFNAHAANIVTAVFLA 989

Query: 242  TGQDAANIVEGSQGLTY-AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            TGQD    VE S  +T   K  + +L  S ++P++ +G +G G  +      L  LG   
Sbjct: 990  TGQDPPQNVESSNCITVMKKTVEGALQISVSMPSIEVGTIGGGTILEPQGAMLDLLGVRG 1049

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +T  GDNAR+LA I AA VL GELSL +A    G L+++H+   R
Sbjct: 1050 AHQTNPGDNARKLARIVAAAVLAGELSLCSALA-AGHLVKSHMAHNR 1095


>gi|296421906|ref|XP_002840504.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636722|emb|CAZ84695.1| unnamed protein product [Tuber melanosporum]
          Length = 1020

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 121/344 (35%), Positives = 183/344 (53%), Gaps = 13/344 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G +      +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 656 MPLPVGIAGPLNIDGEIFY----LPMATTEGVLVASTSRGCK-AINAGGGAVTVLTGDGM 710

Query: 69  TRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR    E  +   A  A   I  ++ +  + +  + TS+F R   + + +AG  LF+R  
Sbjct: 711 TRGPVVEFPSVRRAGAAKNWIDSEEGQRRLKKAFDSTSRFARLQTIKTALAGTYLFIRFR 770

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGKNF 184
             TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 771 TTTGDAMGMNMISKGVEYALHVMSTECGFDDMFIVSVSGNYCTDKKPAAINWIEGRGKSV 830

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VAE  I  A+ +  L++    ++ LN  KNLIG+ +AG +   NAH AN++ A +LATGQ
Sbjct: 831 VAEAIIPAAVVKSVLKSDVNALVELNISKNLIGSAMAGSVGGFNAHAANIVTAVFLATGQ 890

Query: 245 DAANIVEGSQGLTYAK-LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           D A  VE S  +T  K   + +L  S ++P++ +G +G G  +      L  LG     +
Sbjct: 891 DPAQNVESSNCITVMKRTAEGALQISVSMPSIEVGTIGGGTILEPQGAMLDLLGVRGAHQ 950

Query: 304 T--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           T  GDNAR+LA I AA VL GELSL +A    G L+++H+   R
Sbjct: 951 TNPGDNARKLARIVAAAVLAGELSLCSALA-AGHLVKSHMAHNR 993


>gi|241635592|ref|XP_002410562.1| hydroxymethylglutaryl-coA reductase, putative [Ixodes scapularis]
 gi|215503459|gb|EEC12953.1| hydroxymethylglutaryl-coA reductase, putative [Ixodes scapularis]
          Length = 949

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 186/344 (54%), Gaps = 16/344 (4%)

Query: 18  PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ + G ++ D  K  VP+AT E  L  S  RG   ++    G  ++++ + MTR     
Sbjct: 581 PVGVAGPLLLDNCKFHVPMATTEGCLVASTNRGCR-AIAISGGASSSVVYDGMTRGPVVR 639

Query: 76  TENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGD 131
              A+ A   +  + L+K+E    +    + TS+F R  +LH+ IA   LF+R    TGD
Sbjct: 640 LPTAQQAAEVM--LWLQKSENFEILKTAFDATSRFARLQKLHTSIAAKYLFIRFVSVTGD 697

Query: 132 ASGHNMVTKAADAVMDW-ILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           A G NM++K +   + + +L  +  L   SVSGN C+DKK  A+N I GRGK+ V E TI
Sbjct: 698 AMGMNMLSKVSLLQLFFLVLRVFPALEIISVSGNYCTDKKPAALNWIEGRGKSVVCEATI 757

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
              + ++ L+T+   ++ +N  KNLIG+ +AG +   NA  AN++ A ++ATGQD A  V
Sbjct: 758 PAKVVKEVLKTNTHALVDVNITKNLIGSAMAGSVGGFNAQAANIVTAIFIATGQDPAQNV 817

Query: 251 EGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTG 305
             S  LT  +    + D LY SCT+P++ +G VG G  + A  + L  LG         G
Sbjct: 818 TSSNCLTILEATGENGDDLYISCTMPSIEIGTVGGGTVLEAQGSMLDLLGVRGASAETPG 877

Query: 306 DNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
            +A  LA +   TV+ GELSLL+A    G L+ +H+R  R  +N
Sbjct: 878 AHACTLARVVCGTVMAGELSLLSALAA-GHLVRSHMRHNRSSIN 920


>gi|226500112|ref|NP_001142036.1| hypothetical protein LOC100274191 [Zea mays]
 gi|194706862|gb|ACF87515.1| unknown [Zea mays]
          Length = 302

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 161/284 (56%), Gaps = 7/284 (2%)

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F +      L A  E       +A V  ++S+F R   +   IAG  L++R 
Sbjct: 1   MTRAPAVRFPSARRAAELKAFLEDPANFDTLAMVFNRSSRFGRLQGVKCAIAGRNLYMRF 60

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V+D++ + +  +   S+SGN CSDKK+ A+N I GRGK+ V
Sbjct: 61  SCSTGDAMGMNMVSKGVQNVLDYLQADFPDMDVISISGNFCSDKKSAAVNWIDGRGKSVV 120

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 121 CEAVIKEEVVKKVLKTNVQALVELNVIKNLAGSAVAGALGGFNAHASNIVAAIFIATGQD 180

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG      
Sbjct: 181 PAQNVESSQCITMLEAINDGKDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGANR 240

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR LA + A  VL GELSL++AQ   G L+++H++  R
Sbjct: 241 ESPGSNARLLATVVAGAVLAGELSLISAQA-AGHLVKSHMKYNR 283


>gi|171695526|ref|XP_001912687.1| hypothetical protein [Podospora anserina S mat+]
 gi|170948005|emb|CAP60169.1| unnamed protein product [Podospora anserina S mat+]
          Length = 1170

 Score =  176 bits (447), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 122/342 (35%), Positives = 184/342 (53%), Gaps = 11/342 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 799  MPLPVGVAGPLVIDGQ----SYFIPMATTEGVLVASASRGCK-AINSGGGAVTVLTADGM 853

Query: 69   TRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR      E  E A  A   +  +K +  + +    TS+F R   + + IAG  L++R +
Sbjct: 854  TRGPCVSFETLERAGYAKLWLDSEKGQNVMKKAFNSTSRFARLETMKTAIAGTNLYIRFK 913

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NM++K  +  +  + ++ +  ++  +VSGN C+DKK  AIN I GRGK+ V
Sbjct: 914  TTTGDAMGMNMISKGVEHALSVMRNEGFEDMNIVTVSGNYCTDKKPAAINWIEGRGKSVV 973

Query: 186  AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            AE  I   + +  L+T  + ++ LN  KNLIG+ +AG +   NAH AN++ A +LATGQD
Sbjct: 974  AEAIIPAEVVKSVLKTDVDTMVALNVDKNLIGSAMAGSVGGFNAHAANIVAAIFLATGQD 1033

Query: 246  AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
             A +VE +  +T  K    SL  S ++P++ +G +G G  +    + L  LG      T 
Sbjct: 1034 PAQVVESANCITIMKNLRGSLQISVSMPSIEVGTLGGGTILDPQGSMLDLLGVRGPHPTS 1093

Query: 305  -GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G+NARRLA I AA VL GELSL +A    G L++AH++  R
Sbjct: 1094 PGENARRLARIVAAAVLAGELSLCSALAA-GHLVKAHMQHNR 1134


>gi|115479895|ref|NP_001063541.1| Os09g0492700 [Oryza sativa Japonica Group]
 gi|113631774|dbj|BAF25455.1| Os09g0492700 [Oryza sativa Japonica Group]
          Length = 576

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 190/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G    ++  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 227 VGYVQLPVGVAGPLVLDG----ERFYVPMATTEGCLVASTNRGCK-AIAESGGATSVVLQ 281

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+      +A  A  L    E       +A V  ++S+F R  ++   +AG  L++
Sbjct: 282 DGMTRAPVARFPSARRAAELKGFLENPANFDTLAMVFNRSSRFARLQRVKCAVAGRNLYM 341

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK+ A+N I GRGK+
Sbjct: 342 RFSCSTGDAMGMNMVSKGVQNVLDYLQDDFPDMDVISISGNFCSDKKSAAVNWIEGRGKS 401

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 402 VVCEAVIKEEVVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 461

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 462 QDPAQNVESSQCITMLEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGA 521

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LAA+ A  VL GELSL++AQ   G L+++H++  R
Sbjct: 522 NRESPGSNARLLAAVVAGAVLAGELSLISAQA-AGHLVQSHMKYNR 566


>gi|1154889|emb|CAA92821.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Oryza sativa Indica
           Group]
 gi|1171364|gb|AAD08820.1| 3-hydroxy-3-methylglutaryl=CoA reductase [Oryza sativa Indica
           Group]
          Length = 576

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 190/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G    ++  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 227 VGYVQLPVGVAGPLVLDG----ERFYVPMATTEGCLVASTNRGCK-AIAESGGATSVVLQ 281

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+      +A  A  L    E       +A V  ++S+F R  ++   +AG  L++
Sbjct: 282 DGMTRAPVARFPSARRAAELKGFLENPANFDTLAMVFNRSSRFARLQRVKCAVAGRNLYM 341

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK+ A+N I GRGK+
Sbjct: 342 RFSCSTGDAMGMNMVSKGVQNVLDYLQDDFPDMDVISISGNFCSDKKSAAVNWIEGRGKS 401

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 402 VVCEAVIKEEVVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 461

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 462 QDPAQNVESSQCITMLEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGA 521

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LAA+ A  VL GELSL++AQ   G L+++H++  R
Sbjct: 522 NRESPGSNARLLAAVVAGAVLAGELSLISAQA-AGHLVQSHMKYNR 566


>gi|212543521|ref|XP_002151915.1| HMG-CoA reductase [Penicillium marneffei ATCC 18224]
 gi|210066822|gb|EEA20915.1| HMG-CoA reductase [Penicillium marneffei ATCC 18224]
          Length = 1127

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 190/345 (55%), Gaps = 16/345 (4%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GPM I G        +P+AT E  L  S  RGA  ++    G    +  + M
Sbjct: 754  LPLPLGVAGPMVIDGQ----NYFIPMATTEGVLVASTSRGAK-AINAGGGAVTVVHGDGM 808

Query: 69   TRS--IFFET-ENAEMALTALQEITLKKAEIARV-IEQTSQFTRFLQLHSQIAGNLLFLR 124
            TR   + F T   A  A T L   + + A I R     TS+F R   L + +AG  L++R
Sbjct: 809  TRGPGVSFPTLTRAAEAKTWLD--SEEGASIMRTAFNSTSRFARLQHLKTALAGTNLYIR 866

Query: 125  LEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGK 182
             +  TGDA G NM++K  +  ++ + ++  +  ++  S+S N C+DKKA AIN I GRGK
Sbjct: 867  FKTTTGDAMGMNMISKGVEKALEVMANECGFDDMNVISLSANYCTDKKAAAINWIDGRGK 926

Query: 183  NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
            + VAE  I   I +  L++S + ++ LN  KNLIG+ +AG +   NAH +N++ A +LAT
Sbjct: 927  SVVAEAIIPGDIVKSVLKSSVDAMVELNISKNLIGSAMAGSLGGFNAHASNIVTAVFLAT 986

Query: 243  GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            GQD A  VE S  +T  K  D +L+ S ++P++ +G +G G  + A    L  LG     
Sbjct: 987  GQDPAQNVESSNCITLMKNLDGNLHISVSMPSIEVGTIGGGTILEAQSAMLEMLGVRGPH 1046

Query: 303  KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             T  G+N+R+LA I AA+VL GELSL AA    G L++AH+   R
Sbjct: 1047 PTNPGENSRQLARIVAASVLAGELSLCAALA-AGHLVKAHMAHNR 1090


>gi|125564213|gb|EAZ09593.1| hypothetical protein OsI_31874 [Oryza sativa Indica Group]
          Length = 576

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 190/346 (54%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G    ++  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 227 VGYVQLPVGVAGPLVLDG----ERFYVPMATTEGCLVASTNRGCK-AIAESGGATSVVLQ 281

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+      +A  A  L    E       +A V  ++S+F R  ++   +AG  L++
Sbjct: 282 DGMTRAPVARFPSARRAAELKGFLENPANFDTLAMVFNRSSRFARLQRVKCAVAGRNLYM 341

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++   +  +   S+SGN CSDKK+ A+N I GRGK+
Sbjct: 342 RFSCSTGDAMGMNMVSKGVQNVLDYLQDDFPDMDVISISGNFCSDKKSAAVNWIEGRGKS 401

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 402 VVCEAVIKEEVVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 461

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 462 QDPAQNVESSQCITMLEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGA 521

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NAR LAA+ A  VL GELSL++AQ   G L+++H++  R
Sbjct: 522 NRESPGSNARLLAAVVAGAVLAGELSLISAQA-AGHLVQSHMKYNR 566


>gi|158934009|emb|CAJ41062.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hypocrea lixii]
          Length = 1150

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 182/343 (53%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 784  MPIPVGVAGPLVIDGQ----SFFIPMATTEGVLVASTSRGCK-AINSGGGAVTVLTADGM 838

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + FET +   A     +    +  +      TS+F R   + + IAG  L++R  
Sbjct: 839  TRGPVVSFETLDRAGAAKLWLDSEEGQTTMKTAFNSTSRFARLQTMKTAIAGTNLYIRFR 898

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  ++ + ++  +  +   S+SGN CSDKK  AIN I GRGK+ 
Sbjct: 899  TTTGDAMGMNMISKGCEHALNVMQNEAGFDDMVIVSLSGNYCSDKKPAAINWIEGRGKSV 958

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I   + +  L+T  + ++ LNT KN+IG+ +AG +   NAH AN++ A +LATGQ
Sbjct: 959  VAEAIIPGEVVRSVLKTDVDSLVELNTSKNMIGSAMAGSMGGFNAHAANIVAAIFLATGQ 1018

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A +VE +  +T  K    SL  S ++P+L +G +G G  +    + L  LG      T
Sbjct: 1019 DPAQVVESANCITIMKNLRGSLQISVSMPSLEVGTLGGGTILDPQGSMLELLGVRGSHPT 1078

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNARRLA I  A+VL GELSL +A    G L++AH+   R
Sbjct: 1079 NPGDNARRLARIIGASVLAGELSLCSALAA-GHLVKAHMAHNR 1120


>gi|21102|emb|CAA48610.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Raphanus sativus]
          Length = 583

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 119/344 (34%), Positives = 185/344 (53%), Gaps = 11/344 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   +M    G  +T++ + 
Sbjct: 228 MPVGYVQIPVGIAGPLLLDGCEYSVPMATTEGCLVASTNRGCK-AMYVSGGGTSTVVKDG 286

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F +      L    E       +A V  ++S+F R   +   +AG   ++R 
Sbjct: 287 MTRAPVVRFASARRASELKFYLEDLENFDTLAVVFNRSSRFARLQSVKCTLAGKNAYVRF 346

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V++++   +  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 347 SCSTGDAMGMNMVSKGVQNVLEFLTDDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVV 406

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   I  K L+TS   ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQD
Sbjct: 407 CEAVIRGEIVNKVLKTSVAALVELNMLKNLTGSAVAGSLGGFNAHASNIVSAVFIATGQD 466

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
            A  VE SQ +T  +  +D   ++ S T+P++ +G VG G  + +    L  LG      
Sbjct: 467 PAQNVELSQCITMMEAVNDGKDIHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGAST 526

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+R LA I A  VL GELSL++A    G+L+++H++  R
Sbjct: 527 ESPGMNSRTLATIVAGAVLAGELSLMSA-IAAGQLVKSHMKYNR 569


>gi|195502999|ref|XP_002098468.1| GE10390 [Drosophila yakuba]
 gi|194184569|gb|EDW98180.1| GE10390 [Drosophila yakuba]
          Length = 954

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 126/344 (36%), Positives = 180/344 (52%), Gaps = 14/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 595 VPIPVGYAGPLLLDG----ETYYVPMATTEGALVASTNRGCK--ALSVRGVRSVVEDVGM 648

Query: 69  TRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      +   A  A    E  +    +    + TS+F R    H  + G  L++R  
Sbjct: 649 TRAPCVRFPSVARAAEAKSWIENDVNYQVVKTEFDSTSRFGRLKDCHIAMDGPQLYIRFV 708

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK  V 
Sbjct: 709 AITGDAMGMNMVSKGAEMALRRIKRQFPDMQIISLSGNFCCDKKPAAINWIKGRGKRVVT 768

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E TI  A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LATGQD 
Sbjct: 769 ECTIPAATLRSVLKTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQDP 828

Query: 247 ANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
           A  V  S   T  +    + + LY +CT+P+L +G VG G  +P     L  LG      
Sbjct: 829 AQNVTSSNCSTAMECWAENSEDLYMTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGANA 888

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            + GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 889 TRPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 931


>gi|164604970|dbj|BAF98281.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
          Length = 606

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 188/347 (54%), Gaps = 17/347 (4%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG    H+S     G  + L+
Sbjct: 253 MPVGYVQIPVGIAGPLLLDGKEYSVPMATTEGCLVASTNRGCKAIHLS----GGATSVLL 308

Query: 65  DERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            + MTR+  + F T      L    E       ++    ++S+F R   +   IAG  L+
Sbjct: 309 RDGMTRAPVVRFGTAKRAAQLKLYLEDPANFETLSTSFNKSSRFGRLQSIKCAIAGKNLY 368

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R   +TGDA G NMV+K    V++++ + +  +    +SGN CSDKK  A+N I GRGK
Sbjct: 369 MRFCCSTGDAMGMNMVSKGVQNVLNFLQNDFPDMDVIGLSGNFCSDKKPAAVNWIEGRGK 428

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + V E  I   + +K L+T+ E ++ LN  KNL G+ +AG +   NAH +N++ A Y+AT
Sbjct: 429 SVVCEAIIKGDVVKKVLKTNVEALVELNMLKNLTGSAMAGALGGFNAHASNIVTAIYIAT 488

Query: 243 GQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           GQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG   
Sbjct: 489 GQDPAQNVESSNCITMMEAVNDGQDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKG 548

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +   G N+R LA+I A +VL  ELSL++A    G+L+ +H++  R
Sbjct: 549 ASKETPGANSRVLASIVAGSVLAAELSLMSA-IAAGQLVNSHMKYNR 594


>gi|153800764|ref|ZP_01955350.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae MZO-3]
 gi|124123739|gb|EAY42482.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae MZO-3]
          Length = 417

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 114/342 (33%), Positives = 183/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFIMRHSPVTPVQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 321 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + A   L GELS++ A    G    AH +L R
Sbjct: 379 --GHARALAEVAATLCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|40317610|gb|AAP14352.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Andrographis
           paniculata]
          Length = 556

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 188/350 (53%), Gaps = 12/350 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    L+ 
Sbjct: 209 VGYVQIPVGIAGPLLLNGC----EYSVPMATTEGCLVASTNRGCK-AIHASGGATCVLLR 263

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+      +A+ A  L    E  +    ++ V  ++S+F R   + S IAG  L+L
Sbjct: 264 DGMTRAPVVRFPSAKRASELKFFIEDPINFETLSVVFNRSSRFARLQSIKSAIAGKNLYL 323

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V++++ + +  +    +SGN CSDKK  A+N I GRGK+
Sbjct: 324 RFTCSTGDAMGMNMVSKGVQNVLEFLQNDFPDMDVIGISGNYCSDKKPAAVNWIEGRGKS 383

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI+  +  K L+T+   ++ LN  KNL  + +AG +   NAH AN++ A ++ATG
Sbjct: 384 VVCEATISGDVVSKVLKTTVSGLVELNMLKNLTRSAMAGALGGFNAHAANIVSAIFIATG 443

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  +E S  +T  +  +D   ++ S T+P++ +G VG G  + +    L  LG    
Sbjct: 444 QDPAQNIESSHCITMMEAVNDGKDIHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 503

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
            +   G NA+ L  + A  VL GELSL++A  + G+L+++H++  R   N
Sbjct: 504 NKESPGANAQLLGLVVAGAVLAGELSLMSA-ISAGQLVKSHMKYNRSQKN 552


>gi|194910272|ref|XP_001982103.1| GG11225 [Drosophila erecta]
 gi|190656741|gb|EDV53973.1| GG11225 [Drosophila erecta]
          Length = 973

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 128/348 (36%), Positives = 184/348 (52%), Gaps = 22/348 (6%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+++ + D  M
Sbjct: 614 VPIPVGYAGPLLLDG----ETYYVPMATTEGALVASTNRGCK--ALSVRGVKSVVEDVGM 667

Query: 69  TRSIFFETENAEMALTALQEI------TLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           TR+   +  +   A  A   I       L K E     + TS+F R    H  + G  L+
Sbjct: 668 TRAPCVKFPSVARAAEAKSWIENDANYQLVKTEF----DSTSRFGRLKDCHIAMDGPQLY 723

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R    TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK
Sbjct: 724 IRFVAITGDAMGMNMVSKGAEMALRRIKRQFPDMQIISLSGNFCCDKKPAAINWIKGRGK 783

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
             V E TI+ A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LAT
Sbjct: 784 RVVTECTISAATLRSVLKTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTAVFLAT 843

Query: 243 GQDAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC- 298
           GQD A  V  S   T  +    +++ LY +CT+P+L +G VG G  +P     L  LG  
Sbjct: 844 GQDPAQNVTSSNCSTSMECWAENNEDLYMTCTMPSLEVGTVGGGTGLPGQSACLEMLGVR 903

Query: 299 -IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                + GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 904 GAHATRPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 950


>gi|34809529|gb|AAQ82685.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Taxus x media]
          Length = 595

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 118/346 (34%), Positives = 186/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G     +  VP+AT E  L  S   G     +C  G  + L+ 
Sbjct: 240 IGYVQIPVGVAGPLLLNGF----EYMVPVATTEGCLVASTNSGCKAIHMC-GGATSILLR 294

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+     ++A+ A  L    E       ++ +  +T++F R   +   IAG  L++
Sbjct: 295 DGMTRAPVVRFQSAKRAADLKYYIEDPTNAENLSHIFNRTTRFGRLQGMQCAIAGKNLYM 354

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K    V+D++ + +  ++  SVSGN C+DKK TA+N I GRGK+
Sbjct: 355 RFCCFTGDAMGMNMVSKGVQNVLDYLQTVFPDMNLISVSGNFCADKKPTAVNWIEGRGKS 414

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH AN++ A ++ATG
Sbjct: 415 IVCEAVITEEVVKKVLKTTVPALLELNMLKNLTGSAMAGAMGGFNAHAANIVSAVFIATG 474

Query: 244 QDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +    L+ S T+P + +G VG G ++ +    L  LG    
Sbjct: 475 QDPAQNVESSHCITMMEPANGGKDLHVSVTMPCIEVGTVGGGTHLASQAACLNMLGVKGA 534

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NA+ LA I A  VL GELSL++A    G+L+++H++  R
Sbjct: 535 NAASPGANAQNLARIVAGAVLAGELSLMSALA-AGQLVKSHMKYNR 579


>gi|119498345|ref|XP_001265930.1| HMG-CoA reductase [Neosartorya fischeri NRRL 181]
 gi|119414094|gb|EAW24033.1| HMG-CoA reductase [Neosartorya fischeri NRRL 181]
          Length = 1130

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 184/347 (53%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  + M
Sbjct: 767  LPLPLGVAGPLTIDGQ----SYFIPMATTEGVLVASTSRGAK-AINAGGGAVTVLTGDGM 821

Query: 69   TRS--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A  A  ++ +   E    +      TS+F R   L + +AG  L+
Sbjct: 822  TRGPCVGFPT----LARAAAAKVWIDSEEGRSILTAAFNSTSRFARLQHLKTALAGTYLY 877

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +      SVSGN C+DKKA AIN I GR
Sbjct: 878  IRFKTTTGDAMGMNMISKGVEKALHVMATECGFDDMATISVSGNFCTDKKAAAINWIDGR 937

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++    ++ LNT KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 938  GKSVVAEAIIPGDVVRSVLKSDVNALVELNTSKNLIGSAMAGSVGGFNAHASNIVTAVFL 997

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  +  + +L  + ++P++ +G +G G  + A    L  LG   
Sbjct: 998  ATGQDPAQNVESSSCITTMRNLNGNLQIAVSMPSIEVGTIGGGTILEAQSAMLDMLGVRG 1057

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNAR+LA I AA VL GELSL +A    G L++AH+   R
Sbjct: 1058 SHPTNPGDNARQLARIVAAAVLAGELSLCSALA-AGHLVKAHMAHNR 1103


>gi|1763230|gb|AAB69726.1| 3-hydroxy-3-methylglutaryl coenzyme a reductase [Camptotheca
           acuminata]
          Length = 575

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 117/346 (33%), Positives = 185/346 (53%), Gaps = 13/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+  +GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ 
Sbjct: 227 VGYVQIPVGIVGPLLLDGR----EYSVPMATTEGCLVASTNRGCK-AIYASGGATSILLR 281

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F T      L    E  +    +A V  ++S+F R   +   IAG  L++
Sbjct: 282 DGMTRAPVVRFSTAKRAAELKFFLEDPMNFDTLAVVFNKSSRFGRLQGIKCAIAGKNLYM 341

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NM++K    V+D++ + +  +    +SGN CSDKK  A N I GRGK+
Sbjct: 342 RFTCSTGDAMGMNMISKGVQNVLDFLQNDFPDMDVLGISGNFCSDKKPAACNWIEGRGKS 401

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   N+H +N++ A Y+ATG
Sbjct: 402 VVCEAIIKEEVVRKVLKTNVAALVELNMLKNLTGSAMAGALGGFNSHASNIVSAVYIATG 461

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 462 QDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVG-GTQLASQAACLLLLGVKGA 520

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +   G N+R LA I A +VL GELS+++A    G L+ +H++  R
Sbjct: 521 NKESPGSNSRLLATIVAGSVLAGELSVMSA-IAAGHLVMSHMKYNR 565


>gi|159128913|gb|EDP54027.1| HMG-CoA reductase [Aspergillus fumigatus A1163]
          Length = 1130

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 183/347 (52%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  + M
Sbjct: 767  LPLPLGVAGPLTIDGQ----SYFIPMATTEGVLVASTSRGAK-AINAGGGAVTVLTGDGM 821

Query: 69   TRS--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A  A  ++ +   E    +      TS+F R   L + +AG  L+
Sbjct: 822  TRGPCVGFPT----LARAAAAKVWIDSEEGRSILTAAFNSTSRFARLQHLKTALAGTYLY 877

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +      SVSGN C+DKKA AIN I GR
Sbjct: 878  IRFKTTTGDAMGMNMISKGVEKALHVMATECGFDDMATISVSGNFCTDKKAAAINWIDGR 937

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++    ++ LNT KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 938  GKSVVAEAIIPGDVVRSVLKSDVNALVELNTSKNLIGSAMAGSVGGFNAHASNIVTAVFL 997

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  +  + +L  + ++P++ +G +G G  + A    L  LG   
Sbjct: 998  ATGQDPAQNVESSSCITTMRNLNGNLQIAVSMPSIEVGTIGGGTILEAQSAMLDMLGVRG 1057

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1058 SHPTNPGDNARQLARIVAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1103


>gi|196049380|ref|NP_001124468.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase isoform 2 [Homo
           sapiens]
 gi|21707182|gb|AAH33692.1| HMGCR protein [Homo sapiens]
 gi|119616162|gb|EAW95756.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase, isoform CRA_b
           [Homo sapiens]
 gi|123979904|gb|ABM81781.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [synthetic
           construct]
 gi|123994667|gb|ABM84935.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [synthetic
           construct]
          Length = 835

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 103/261 (39%), Positives = 153/261 (58%), Gaps = 6/261 (2%)

Query: 94  AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQW 153
           A I    + TS+F R  +LH+ IAG  L++R +  +GDA G NM++K  +  +  +   +
Sbjct: 563 AVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYF 622

Query: 154 SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQK 213
             +   +VSGN C+DKK  AIN I GRGK+ V E  I   + ++ L+T+ E +I +N  K
Sbjct: 623 PEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINK 682

Query: 214 NLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLH---DDSLYFSC 270
           NL+G+ +AG I   NAH AN++ A Y+A GQDAA  V  S  +T  +     ++ LY SC
Sbjct: 683 NLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISC 742

Query: 271 TIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAAICAATVLCGELSLLA 328
           T+P++ +G VG G N+   +  L  LG     K   G+NAR+LA I   TV+ GELSL+A
Sbjct: 743 TMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMA 802

Query: 329 AQTNPGELMEAHLRLERMHLN 349
           A    G L+++H+   R  +N
Sbjct: 803 ALA-AGHLVKSHMIHNRSKIN 822


>gi|114599631|ref|XP_001148260.1| PREDICTED: hypothetical protein isoform 2 [Pan troglodytes]
          Length = 835

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 103/261 (39%), Positives = 153/261 (58%), Gaps = 6/261 (2%)

Query: 94  AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQW 153
           A I    + TS+F R  +LH+ IAG  L++R +  +GDA G NM++K  +  +  +   +
Sbjct: 563 AVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYF 622

Query: 154 SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQK 213
             +   +VSGN C+DKK  AIN I GRGK+ V E  I   + ++ L+T+ E +I +N  K
Sbjct: 623 PEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINK 682

Query: 214 NLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLH---DDSLYFSC 270
           NL+G+ +AG I   NAH AN++ A Y+A GQDAA  V  S  +T  +     ++ LY SC
Sbjct: 683 NLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISC 742

Query: 271 TIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAAICAATVLCGELSLLA 328
           T+P++ +G VG G N+   +  L  LG     K   G+NAR+LA I   TV+ GELSL+A
Sbjct: 743 TMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMA 802

Query: 329 AQTNPGELMEAHLRLERMHLN 349
           A    G L+++H+   R  +N
Sbjct: 803 ALA-AGHLVKSHMIHNRSKIN 822


>gi|16304120|gb|AAL16927.1|AF420477_1 3-hydroxy-3-methylglutaryl CoA reductase [Solanum lycopersicum]
          Length = 302

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 107/289 (37%), Positives = 163/289 (56%), Gaps = 7/289 (2%)

Query: 63  LIDERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           L+ + MTR+  + F T      L    E  L    ++ +  ++S+F R   +   IAG  
Sbjct: 3   LLRDGMTRAPVVRFTTAKRAAELKFFVEDPLNFEILSLMFNKSSRFARLQGIQCAIAGKN 62

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           L++R   +TGDA G NMV+K    V+D++ S++  +    +SGN CSDKK  A+N I GR
Sbjct: 63  LYMRFSCSTGDAMGMNMVSKGVQNVLDYLQSEYPDMDVIGISGNFCSDKKPAAVNWIEGR 122

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ V E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A YL
Sbjct: 123 GKSVVCEAIIKEDVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYL 182

Query: 241 ATGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           ATGQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG 
Sbjct: 183 ATGQDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGV 242

Query: 299 IEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               +   G NAR LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 243 KGANRDAPGSNARLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 290


>gi|83775635|dbj|BAE65755.1| unnamed protein product [Aspergillus oryzae]
          Length = 427

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 122/342 (35%), Positives = 182/342 (53%), Gaps = 11/342 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GPM I G        +P+AT E  L  S  RG   ++    G   TL  + M
Sbjct: 84  LPLPLGLAGPMVIDGQA----YFIPMATTEGVLVASASRGCK-AINAGGGAVTTLKGDGM 138

Query: 69  TRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR       +A+ A  A +  E  + +  +      TS+F R   L    AG  L++R  
Sbjct: 139 TRGPCLGFPSAKRAAEAQRWAESPIGRRVLTDTFNATSRFARLQSLTFAQAGTYLYIRFR 198

Query: 127 FATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             TGDA G NM++K  +  +  + +  +  ++  ++SGN C+DKK+ AIN I GRGK+ +
Sbjct: 199 TTTGDAMGMNMISKGIEQALQAMTAHGFPDMNTITLSGNFCADKKSAAINWIGGRGKSVI 258

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE TI     +K L+T  + ++ LNT KNL+G+ +AG +   NAH +N++ A +LATGQD
Sbjct: 259 AEATIPAETVRKVLKTEVDALVELNTAKNLVGSAMAGSMGGFNAHASNLVQAVFLATGQD 318

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
            A  VE S  +T  K  D +L+ + ++P++ +G +G G  + A    L  LG      T 
Sbjct: 319 PAQNVESSSCITTMKNIDGNLHIAVSMPSMEVGTIGGGTILEAQGAMLDLLGVRGAHPTD 378

Query: 305 -GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G NARRLA I AA VL GELS  +A    G L+ AH++  R
Sbjct: 379 PGANARRLARIIAAAVLAGELSTCSALA-AGHLVNAHMQHNR 419


>gi|325504964|dbj|BAJ83615.1| 3-Hydroxy-3-methyl-glutaryl-CoA reductase [Neurospora crassa]
          Length = 509

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 184/342 (53%), Gaps = 11/342 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G        VP+AT E  L  S  RG   ++    G    L  + M
Sbjct: 139 MPLPVGVAGPLVIDGQ----SFFVPMATTEGVLVASTSRGCK-AINSGGGAVTVLTADGM 193

Query: 69  TRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR    + E  E A  A   +  +K +  + +    TS+F R   + + +AG  L++R +
Sbjct: 194 TRGPCVQFETLERAGAAKLWLDSEKGQSIMKKAFNSTSRFARLETMKTAMAGTNLYIRFK 253

Query: 127 FATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             TGDA G NM++K  +  +  + ++ +  ++  S+SGN C+DKKA AIN I GRGK+ V
Sbjct: 254 TTTGDAMGMNMISKGVEHALSVMYNEGFEDMNIVSLSGNYCTDKKAAAINWIDGRGKSVV 313

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I   + +  L+T  + ++ LN  KNLIG+ +AG +   NAH AN++ A +LATGQD
Sbjct: 314 AEAIIPADVVKNVLKTDVDTLVELNVNKNLIGSAMAGSMGGFNAHAANIVAAIFLATGQD 373

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
            A +VE +  +T  +    +L  S ++P++ +G +G G  +      L  LG      T 
Sbjct: 374 PAQVVESANCITLMRNLRGNLQISVSMPSIEVGTLGGGTILEPQSAMLDMLGVRGPHPTN 433

Query: 305 -GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G+NARRLA I AA VL GELSL +A    G L++AH+   R
Sbjct: 434 PGENARRLARIVAAAVLAGELSLCSALA-AGHLVKAHMAHNR 474


>gi|70989305|ref|XP_749502.1| HMG-CoA reductase [Aspergillus fumigatus Af293]
 gi|66847133|gb|EAL87464.1| HMG-CoA reductase [Aspergillus fumigatus Af293]
          Length = 1130

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 183/347 (52%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  + M
Sbjct: 767  LPLPLGVAGPLTIDGQ----SYFIPMATTEGVLVASTSRGAK-AINAGGGAVTVLTGDGM 821

Query: 69   TRS--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A  A  ++ +   E    +      TS+F R   L + +AG  L+
Sbjct: 822  TRGPCVGFPT----LARAAAAKVWIDSEEGRSILTAAFNSTSRFARLQHLKTALAGTYLY 877

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +      SVSGN C+DKKA AIN I GR
Sbjct: 878  IRFKTTTGDAMGMNMISKGVEKALHVMATECGFDDMATISVSGNFCTDKKAAAINWIDGR 937

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++    ++ LNT KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 938  GKSVVAEAIIPGDVVRSVLKSDVNALVELNTSKNLIGSAMAGSVGGFNAHASNIVTAVFL 997

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  +  + +L  + ++P++ +G +G G  + A    L  LG   
Sbjct: 998  ATGQDPAQNVESSSCITTMRNLNGNLQIAVSMPSIEVGTIGGGTILEAQSAMLDMLGVRG 1057

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1058 SHPTNPGDNARQLARIVAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1103


>gi|307595778|ref|YP_003902095.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Vulcanisaeta
           distributa DSM 14429]
 gi|307550979|gb|ADN51044.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Vulcanisaeta
           distributa DSM 14429]
          Length = 416

 Score =  175 bits (443), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 127/342 (37%), Positives = 192/342 (56%), Gaps = 6/342 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +  +P+   GP+++ G+       +PLAT E  L  SV RGA I +    G R+ +I+
Sbjct: 72  IGAAQVPIGIAGPLRVIGDYANGLYYIPLATTEGALVASVNRGAKI-VTEAGGARSKVIN 130

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+      +   A+  +  +     E+  V E TS+  + + +   I GN ++LR 
Sbjct: 131 DGMTRAPVIAVPSVIDAVELVNWVNEHFNEVKSVAESTSRHAKLVSIQPFIVGNNVWLRF 190

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           +F TGDA G NMVT A D  + +ILS +      ++SGN+C DKKA A+N ++GRGK  +
Sbjct: 191 KFTTGDAMGMNMVTIATDKAVKYILSNFPKARLVALSGNMCVDKKANAVNFLLGRGKTVI 250

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           +E  I R+  +K+  T+ E +  +N +KNL+G+ LA      NAHFAN++ A ++ATGQD
Sbjct: 251 SEAVIPRSTLEKWGVTA-EDVAEVNNRKNLLGSALAHSY-GFNAHFANIIAAIFIATGQD 308

Query: 246 AANIVEGSQGLTYAK-LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERK 303
            A +VE S G+T+ + L +  LY S T+P+L +G VG G  +P  +  L  LG       
Sbjct: 309 VAQVVESSMGITWMESLDNGDLYVSVTLPSLEVGTVGGGTGLPTQREMLQMLGVYGSGNP 368

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G NA + A I AA VL GE++L+ A     EL  AH  L R
Sbjct: 369 PGTNALKFAEIVAAAVLAGEVNLVLALARD-ELARAHEMLGR 409


>gi|146160684|gb|ABQ08571.1| mitochondrial 3-hydroxy-3-methylglutaryl-CoA reductase 1 [Hortaea
           werneckii]
          Length = 634

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 127/347 (36%), Positives = 182/347 (52%), Gaps = 20/347 (5%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G        +P+AT E  L  S+ RG   ++    G    L  + M
Sbjct: 253 MPLPLGVAGPLTIDGR----SYFLPMATTEGVLVASISRGCK-AINAGGGAVTVLTGDGM 307

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQ----TSQFTRFLQLHSQIAGNLLF 122
           TR   I F+T    +A  A  +I L   E  +V++     TS+F R  Q+ + IAG  ++
Sbjct: 308 TRGPCIGFQT----LARAAEAKIWLDSPEGQKVMKDAFNSTSRFARLQQMKTSIAGTYVY 363

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
           +R +  TGDA G NM++K  +  +  +  +  +      SVSGN C DKK  AIN I GR
Sbjct: 364 VRFKTTTGDAMGMNMISKGVEHALGVMSKEAGFEDMAIISVSGNFCIDKKPAAINWIDGR 423

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ VAE  I     +  L++    ++ LN  KN IG+ +AG I   NAH ANM+ A +L
Sbjct: 424 GKSVVAEAIIPAETVKNVLKSDVNALVELNMSKNFIGSAMAGSIGGFNAHAANMVTAMFL 483

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  +      L  LG   
Sbjct: 484 ATGQDPAQNVESSNCITVMKNLNGNLQISVSMPSIEVGTIGGGTILEPQAAMLDMLGVRG 543

Query: 301 ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  GDNAR+LA I AA VL GELSL +A    G L++AH+   R
Sbjct: 544 AHATTPGDNARQLAKIIAACVLAGELSLCSALAA-GHLVKAHMAHNR 589


>gi|302404012|ref|XP_002999844.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Verticillium
            albo-atrum VaMs.102]
 gi|261361346|gb|EEY23774.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Verticillium
            albo-atrum VaMs.102]
          Length = 1173

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 181/342 (52%), Gaps = 13/342 (3%)

Query: 11   MPMRWIGPMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            MP+    P+ + G ++ D V   +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 802  MPL----PVGVAGPLVIDGVSYFIPMATTEGVLVASTSRGCK-AINSGGGAVTVLTGDGM 856

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + FET     A     +       + +    TS F R   + + IAG  L++R +
Sbjct: 857  TRGPCVSFETLERAGAAKIWLDSEAGHGVMKKAFNSTSNFARLQSMKTAIAGTKLYIRFK 916

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NM++K  +  +D ++S+ +  ++  SVSGN C DKK  AIN I GRGK+ V
Sbjct: 917  TTTGDAMGMNMISKGVEHALDVMMSEGFEDMNIVSVSGNFCIDKKPAAINWIDGRGKSVV 976

Query: 186  AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            AE  I   + +  L++  + ++ LN  KNLIG+ +A  +   NAH AN++ A +LATGQD
Sbjct: 977  AEAIIPGDVVRDVLKSDVDTLVELNISKNLIGSAMAASVGGFNAHAANIVAAIFLATGQD 1036

Query: 246  AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
             A +VE +  +T  +    SL  S ++P++ +G +G G  +      L  LG      T 
Sbjct: 1037 PAQVVESANCITIMQNLRGSLQISVSMPSIEVGTLGGGTILEPQSAMLDMLGVRGPHPTT 1096

Query: 305  -GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G+NARRLA I AA  L GELSL +A    G L++AH++  R
Sbjct: 1097 PGENARRLARIVAAATLAGELSLCSALAA-GHLVKAHMQHNR 1137


>gi|332233859|ref|XP_003266122.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase isoform
           2 [Nomascus leucogenys]
          Length = 835

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 102/259 (39%), Positives = 152/259 (58%), Gaps = 6/259 (2%)

Query: 96  IARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSY 155
           I    + TS+F R  +LH+ IAG  L++R +  +GDA G NM++K  +  +  +   +  
Sbjct: 565 IKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPE 624

Query: 156 LHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNL 215
           +   +VSGN C+DKK  AIN I GRGK+ V E  I   + ++ L+T+ E +I +N  KNL
Sbjct: 625 MQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNL 684

Query: 216 IGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLH---DDSLYFSCTI 272
           +G+ +AG I   NAH AN++ A Y+A GQDAA  V  S  +T  +     ++ LY SCT+
Sbjct: 685 VGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTM 744

Query: 273 PNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAAICAATVLCGELSLLAAQ 330
           P++ +G VG G N+   +  L  LG     K   G+NAR+LA I   TV+ GELSL+AA 
Sbjct: 745 PSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAAL 804

Query: 331 TNPGELMEAHLRLERMHLN 349
              G L+++H+   R  +N
Sbjct: 805 A-AGHLVKSHMIHNRSKIN 822


>gi|322699358|gb|EFY91120.1| HMG CoA reductase [Metarhizium acridum CQMa 102]
          Length = 1254

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 181/343 (52%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 878  LPLPVGVAGPLVIDGQ----SYFIPMATTEGVLVASTSRGCK-AINSGGGAITVLTSDGM 932

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + FET     A     +  + +  +    + TS+F R   + + +AG  L++R +
Sbjct: 933  TRGPCVSFETLERAGAAKLWLDSEVGQKTMKDAFDSTSRFARLQHMKTALAGTNLYIRFK 992

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  ++ + ++  +  ++  +VSGN C DKK  A+N I GRGK  
Sbjct: 993  TTTGDAMGMNMISKGVEHALNVMSTEGGFDDMNIVTVSGNFCIDKKPAAMNWIDGRGKGI 1052

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I   I +  L++  + ++ LN  KNLIG+ +AG I   NAH AN++ A +LATGQ
Sbjct: 1053 VAEAIIPADIVKSVLKSDVDALVELNVAKNLIGSAMAGSIGGFNAHAANIVAAIFLATGQ 1112

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A +VE +  +T  K    SL  + ++P+L +G +G G  +      L  LG      T
Sbjct: 1113 DPAQVVESANCITTMKNLHGSLQIAVSMPSLEVGTLGGGTILEPQSAMLDMLGVRGSHPT 1172

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNARRLA I  A VL GELSL +A    G L++AH++  R
Sbjct: 1173 NPGDNARRLARIIGAAVLAGELSLCSA-LQAGHLVKAHMQHNR 1214


>gi|146160682|gb|ABQ08570.1| 3-hydroxy-3-methylglutaryl-CoA reductase 2 [Hortaea werneckii]
          Length = 1159

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 128/347 (36%), Positives = 182/347 (52%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S+ RG   ++    G    L  + M
Sbjct: 778  MPLPLGVAGPLTIDGR----SYFLPMATTEGVLVASISRGCK-AINAGGGAVTVLTGDGM 832

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQ----TSQFTRFLQLHSQIAGNLLF 122
            TR   I F+T    +A  A  +I L  AE  +V++     TS+F R  Q+ + IAG  ++
Sbjct: 833  TRGPCIGFQT----LARAAEAKIWLDSAEGQKVMKDAFNSTSRFARLQQMKTSIAGTYVY 888

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  +  +  +      SVSGN C DKK  AIN I GR
Sbjct: 889  VRFKTTTGDAMGMNMISKGVEHALGVMSKEAGFEDMAIISVSGNFCIDKKPAAINWIDGR 948

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I     +  L++    ++ LN  KN IG+ +AG I   NAH ANM+ A +L
Sbjct: 949  GKSVVAEAIIPAETVKNVLKSDVNALVELNMSKNFIGSAMAGSIGGFNAHAANMVTAMFL 1008

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  +      L  LG   
Sbjct: 1009 ATGQDPAQNVESSNCITVMKNLNGNLQISVSMPSIEVGTIGGGTILEPQAAMLDMLGVRG 1068

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1069 AHATTPGDNARQLAKIIAACVLAGELSLCSALAA-GHLVRAHMAHNR 1114


>gi|332304878|ref|YP_004432729.1| Hydroxymethylglutaryl-CoA reductase (NADPH) [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172207|gb|AEE21461.1| Hydroxymethylglutaryl-CoA reductase (NADPH) [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 395

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 180/338 (53%), Gaps = 11/338 (3%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+K+ G   +    VPLAT E  L  S  RG  + +    G++ T++D+ M R
Sbjct: 64  VPIGLAGPVKVNGEHAKGDFYVPLATTEGTLVASYNRGMRV-LGAAGGVKVTVVDDVMQR 122

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  E+A  A      I+ +  +I    E T+   +   +    A  +L+LR  F TG
Sbjct: 123 APVFIFEDARQAHAFGNWISAQFDDIKSQAETTTSVGKLRNIEQYAAARMLYLRFNFTTG 182

Query: 131 DASGHNMVTKAADAVMDWILSQW--SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           DA+G NMV KA  A  +WI + +  + L   ++SG + +DKK + +N +  RGK  +AE 
Sbjct: 183 DAAGQNMVGKATFAACEWIKANYPGAGLQRYNLSGAMDTDKKHSQLNTLHSRGKRVIAEA 242

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
           TI+  I +  L  S + +  +    N+ G+F+AG I +  +H AN + A ++A GQDAAN
Sbjct: 243 TISSEILESKLGVSAQMLFKMRQISNM-GSFMAGSINNG-SHSANGITAMFIACGQDAAN 300

Query: 249 IVEGSQGLTYAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307
           + E S  L++  + + D+ Y + T+P+LI+   G G  +   K  L  + C  E K    
Sbjct: 301 VAESSAALSFVDVDEQDNFYIAITLPSLIVATYGGGTALATQKECLEMMDCFGEGK---- 356

Query: 308 ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           A++LA I  ATVL GELSL AA    G+ + +H  L R
Sbjct: 357 AKKLAEIIGATVLAGELSLSAA-VLAGDWVTSHDALGR 393


>gi|162944694|gb|ABY20416.1| AT09917p [Drosophila melanogaster]
          Length = 920

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 128/346 (36%), Positives = 183/346 (52%), Gaps = 18/346 (5%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 561 VPIPVGYAGPLLLDG----ETYYVPMATTEGALVASTNRGCK--ALSVRGVRSVVEDVGM 614

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVI----EQTSQFTRFLQLHSQIAGNLLFLR 124
           TR+      +   A  A   I  +  E  RV+    + TS+F      H  + G  L++R
Sbjct: 615 TRAPCVRFPSVARAAEAKSWI--ENDENYRVVKTEFDSTSRFGCLKDCHIAMDGPQLYIR 672

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
               TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK  
Sbjct: 673 FVAITGDAMGMNMVSKGAEMALRRIQLQFPDMQIISLSGNFCCDKKPAAINWIKGRGKRV 732

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           V E TI+ A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LATGQ
Sbjct: 733 VTECTISAATLRSVLKTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTAVFLATGQ 792

Query: 245 DAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           D A  V  S   T  +    + + LY +CT+P+L +G VG G  +P     L  LG    
Sbjct: 793 DPAQNVTSSNCSTAMECWAENSEDLYMTCTMPSLEVGTVGGGTGLPGQSACLEMLGVRGA 852

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              + GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 853 HATRPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 897


>gi|237625978|gb|ACR02667.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Amomum villosum]
          Length = 571

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 183/343 (53%), Gaps = 12/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  A ++ + M
Sbjct: 225 VQLPVGVAGPLLLNGR----RYYVPMATTEGCLVASTNRGCK-AISESGGATAIVLRDGM 279

Query: 69  TRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      +A  A  L A  E       I+ V  ++S+F +F  +   +AG  L++R  
Sbjct: 280 TRAPAVRLPSARCAAELKAFLEDRNNFETISLVFNKSSRFAKFQGIKCALAGRNLYMRFS 339

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
            +TGDA G NMV+K    V+D++LS +  +    +SGN CSDKK  A+N I GRGK+ V 
Sbjct: 340 CSTGDAMGMNMVSKGVQNVLDYLLSDFPDMEVIGISGNYCSDKKPAAVNWIEGRGKSVVC 399

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   +  K L+ +   ++ LN  KNL G+ +AG +   NA  +N++ A ++ATGQD 
Sbjct: 400 EAIIKEEVVMKILKINVPALVELNMIKNLAGSAVAGALGGFNAQASNIVSAVFIATGQDP 459

Query: 247 ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
           A  VE S  +T  +  ++   L+ S T+P++ +G VG G  + +    L  LG       
Sbjct: 460 AQNVESSHCITMMEAVNNGKDLHISVTMPSIEVGTVGGGTQLASQAACLDLLGVKGASLD 519

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G NAR LA I A  VL GELSLL+A    G+L+++H++  R
Sbjct: 520 TPGANARLLANIVAGAVLAGELSLLSALAA-GQLVKSHMKYNR 561


>gi|255730251|ref|XP_002550050.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Candida tropicalis
            MYA-3404]
 gi|240132007|gb|EER31565.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Candida tropicalis
            MYA-3404]
          Length = 1043

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 118/348 (33%), Positives = 181/348 (52%), Gaps = 14/348 (4%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G+   L  
Sbjct: 662  IGYMPIPVGVAGPLVIDGK----PYHIPMATTEGCLVASTMRGCK-AINAGGGVETVLTK 716

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   + F T     A     +    +  I +    TS+F R   + + +AG  LF+
Sbjct: 717  DGMTRGPCVRFPTLKRAGAAKLWIDSEEGQTTIKKAFNSTSRFARLQHIQTALAGTSLFV 776

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +  + +++ +  W  +   SVSGN C+DKK  AIN I GRG
Sbjct: 777  RFRTTTGDAMGMNMISKGVEYSLKYMVEECGWDDMEVVSVSGNYCTDKKPAAINWIEGRG 836

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ VA  TI   +  K L++  + ++ LN  KNL+G+ +AG +   NAH AN++ A YLA
Sbjct: 837  KSIVAAATIPAEVVTKVLKSDVDALVELNISKNLVGSAMAGSVGGFNAHAANLVTAVYLA 896

Query: 242  TGQDAANIVEGSQGLTYAKLHDDS--LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
             GQD A  VE S  +T  + + ++  L  S ++P++ +G +G G  +      L  LG  
Sbjct: 897  CGQDPAQNVESSNCITLMEKNKETGDLQISVSMPSIEVGTIGGGTILEPQGAMLELLGVR 956

Query: 300  EERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                T  GDNAR+LA I A+ VL  ELSL +A    G L+++H++  R
Sbjct: 957  GPHPTNPGDNARQLAKIVASAVLAAELSLCSALA-AGHLVQSHMQHNR 1003


>gi|260777690|ref|ZP_05886583.1| hydroxymethylglutaryl-CoA reductase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605703|gb|EEX31988.1| hydroxymethylglutaryl-CoA reductase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 424

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 179/342 (52%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G        VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 91  IGTVKLPVGLAGPLRVNGLHANGDYFVPLATTEAALVASYNRGSQL-ITAAGGASAMLLN 149

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  FE ++   A   +  +  +     +V E T+   +   ++  I GN  +L  
Sbjct: 150 EGVTRTPVFEFQHLADAGQFVAWVVTQYDHFKQVAESTTSHGQLHDININIEGNHAYLIF 209

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           EF TGDASG NMVT A + V ++IL         + + GN+  DKK  A      RGK  
Sbjct: 210 EFHTGDASGQNMVTIATNEVFNYILDHSPISPQDAFLDGNLSGDKKPNAHTLRHVRGKKV 269

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AEI + R + +KYL T+PE+++    Q    G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 270 TAEIQLTRELVEKYLHTTPEQMVKFG-QMTTTGAALSGSI-GVNAHYANALAALYIACGQ 327

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSC-TIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L+     ++C T+PNL++G VG G ++P+ K  L  +G +   K
Sbjct: 328 DAACVSESAIGITRMELNKQGGLYACVTLPNLMVGTVGGGTHLPSQKACLELMGLLGTGK 387

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               A+ LA + A   L GELS++ A    G    AH +L R
Sbjct: 388 ----AKALAEVAAVLCLAGELSIVGAFC-AGHFSRAHQKLAR 424


>gi|219130292|ref|XP_002185302.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217403217|gb|EEC43171.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 367

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 111/316 (35%), Positives = 176/316 (55%), Gaps = 9/316 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+  +GP+ + G    + V VP+AT E  L  S  RGA  ++    G  A L+ 
Sbjct: 25  VGYVPLPVGLVGPLTVNG----ETVYVPMATTEGCLVASTNRGAK-AITAGGGATAVLLR 79

Query: 66  ERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + +TR+      +A  A  L    E     + + R  E T+ F + L+    +AG  ++L
Sbjct: 80  DGITRAPCVRMPSAAQAAHLKLWCETPQHFSTLKRAFESTTSFGKLLKCAPTVAGRNVYL 139

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           RL   +GDA G NMV+K + AV++ +  ++  L   ++SGN+C+DKKA A N + GRGK+
Sbjct: 140 RLTCFSGDAMGMNMVSKGSLAVIETLQQEFPELVLVALSGNMCTDKKAAATNWLEGRGKS 199

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI + +    L+T+   ++  N  KNLIG+ +AG +   NAH +N++ A +LATG
Sbjct: 200 IVVEATIPKDVVTNTLKTTVHSMVQTNLHKNLIGSAMAGALGGFNAHASNIVTAVFLATG 259

Query: 244 QDAANIVEGSQGLT-YAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           QD A  VE S  +T   +  +  L+ SCT+P++ +G VG G ++PA    L A+G     
Sbjct: 260 QDPAQNVESSNCITLLEETEEGDLWISCTMPSIEVGTVGGGTSLPAQAACLQAMGVRGGG 319

Query: 303 KT-GDNARRLAAICAA 317
            T G +A++LA I A+
Sbjct: 320 ATPGAHAQKLAQIVAS 335


>gi|119494793|ref|XP_001264202.1| hmg-CoA reductase [Neosartorya fischeri NRRL 181]
 gi|119412364|gb|EAW22305.1| hmg-CoA reductase [Neosartorya fischeri NRRL 181]
          Length = 599

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 188/344 (54%), Gaps = 15/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+K+ G      V +P+AT E  L  S  RG  +++    G+ A ++ + M
Sbjct: 261 MPIPLGVAGPIKVNGKA----VFLPMATTEGALVASTNRGC-MAINAGGGVTALVLGDGM 315

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQ----TSQFTRFLQLHSQIAGNLLFLR 124
            R+   +  + E A  A + +  +     R+IE+    TS+F R   + + + G+ L++R
Sbjct: 316 ARAPIVQFPSLEEAGAAKRWLDSEAG--FRIIEEAFNATSRFARLQNVRATVVGSDLYIR 373

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
              +TGDA G NM++K  + +++ +    +  +   S+SGN C+DKK  A+N I GRGK 
Sbjct: 374 FTASTGDAMGMNMISKGVEQILEAMRKHGFESMDIVSLSGNFCADKKPAAVNWIEGRGKT 433

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
             A+ TI   + ++ L+TS E ++ LN  KNL+G+ +AG +   NAH AN++ A YLATG
Sbjct: 434 VSAQATIPGHVVRETLKTSVEALVELNVSKNLVGSAVAGSLGGFNAHAANVVTAIYLATG 493

Query: 244 QDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
           QD A  V+ S  LT  K  +  L  S  +P++ +G VG G  +   K  L  +G      
Sbjct: 494 QDPAQNVQSSSTLTVMKNVNGDLQISVFMPSIEVGTVGGGTVLSPQKAMLGMMGVQGAHP 553

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            + G NA+ LA + A+ VL GELSL +A    G L+++HL   R
Sbjct: 554 EQPGRNAQELALLVASGVLAGELSLCSALAA-GSLVQSHLAHNR 596


>gi|109077613|ref|XP_001104536.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase isoform
           4 [Macaca mulatta]
          Length = 835

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 153/261 (58%), Gaps = 6/261 (2%)

Query: 94  AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQW 153
           A I    + TS+F R  +LH+ IAG  L++R +  +GDA G NM++K  +  +  +   +
Sbjct: 563 AVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYF 622

Query: 154 SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQK 213
             +   +VSGN C+DKK  AIN I GRGK+ V E  I   + ++ L+T+ + +I +N  K
Sbjct: 623 PEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTDAMIEVNINK 682

Query: 214 NLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLH---DDSLYFSC 270
           NL+G+ +AG I   NAH AN++ A Y+A GQDAA  V  S  +T  +     ++ LY SC
Sbjct: 683 NLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISC 742

Query: 271 TIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAAICAATVLCGELSLLA 328
           T+P++ +G VG G N+   +  L  LG     K   G+NAR+LA I   TV+ GELSL+A
Sbjct: 743 TMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMA 802

Query: 329 AQTNPGELMEAHLRLERMHLN 349
           A    G L+++H+   R  +N
Sbjct: 803 ALA-AGHLVKSHMIHNRSKIN 822


>gi|121710398|ref|XP_001272815.1| HMG-CoA reductase [Aspergillus clavatus NRRL 1]
 gi|119400965|gb|EAW11389.1| HMG-CoA reductase [Aspergillus clavatus NRRL 1]
          Length = 1132

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 122/347 (35%), Positives = 183/347 (52%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  + M
Sbjct: 769  LPLPLGVAGPLTIDGQ----SYFIPMATTEGVLVASASRGAK-AINAGGGAVTVLTGDGM 823

Query: 69   TRS--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A  A  ++ +   E    +      TS+F R   L + +AG  L+
Sbjct: 824  TRGPCVGFPT----LARAAAAKVWIDSEEGRSILTAAFNSTSRFARLQHLKTALAGTYLY 879

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +      SVSGN C+DKKA AIN I GR
Sbjct: 880  IRFKTTTGDAMGMNMISKGVEKALHIMATECGFDDMATISVSGNFCTDKKAAAINWIDGR 939

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++  + ++ LNT KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 940  GKSVVAEAIIPGDVVRNVLKSDVDALVELNTSKNLIGSAMAGSVGGFNAHASNIVTAIFL 999

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  +  + +L  + ++P++ +G +G G  +      L  LG   
Sbjct: 1000 ATGQDPAQNVESSNCITTMRNINGNLQIAVSMPSIEVGTIGGGTILEGQSAMLDLLGVRG 1059

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1060 SHPTNPGDNARQLARIVAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1105


>gi|315051726|ref|XP_003175237.1| hypothetical protein MGYG_02768 [Arthroderma gypseum CBS 118893]
 gi|311340552|gb|EFQ99754.1| hypothetical protein MGYG_02768 [Arthroderma gypseum CBS 118893]
          Length = 1159

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 186/347 (53%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GPM I G      + +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 778  LPLPLGVAGPMVIDGQ----SLFIPMATTEGVLVASTSRGCK-AINAGGGATTVLTADGM 832

Query: 69   TRS--IFFETEN----AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F + +    A++ L + +  ++ KA        TS+F R   + + +AG  L+
Sbjct: 833  TRGPCVSFSSVSRAGEAKVWLDSEEGQSIMKA----AFNSTSRFARLQTMKTTLAGTNLY 888

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKKA A+N I GR
Sbjct: 889  IRFKTTTGDAMGMNMISKGVEKALSVMANEAGFEDMQTISVSGNFCTDKKAAAVNWIDGR 948

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   I +  L++  + ++ LN  KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 949  GKSVVAEAIIPANIVKSVLKSDVDSMVELNISKNLIGSAMAGALGGFNAHASNIVTALFL 1008

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K    +L+ S ++P++ +G +G G  +      L  LG   
Sbjct: 1009 ATGQDPAQNVESSNCITIMKNVGGNLHISVSMPSIEVGTIGGGTILEGQGAMLDLLGVRG 1068

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDN+RRLA I AA VL GELSL AA    G L+ AH+   R
Sbjct: 1069 AHPTSPGDNSRRLARIVAAAVLAGELSLCAALAA-GHLVRAHMAHNR 1114


>gi|85113573|ref|XP_964546.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Neurospora crassa
            OR74A]
 gi|28926332|gb|EAA35310.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Neurospora crassa
            OR74A]
          Length = 1173

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 184/342 (53%), Gaps = 11/342 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        VP+AT E  L  S  RG   ++    G    L  + M
Sbjct: 803  MPLPVGVAGPLVIDGQ----SFFVPMATTEGVLVASTSRGCK-AINSGGGAVTVLTADGM 857

Query: 69   TRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR    + E  E A  A   +  +K +  + +    TS+F R   + + +AG  L++R +
Sbjct: 858  TRGPCVQFETLERAGAAKLWLDSEKGQSIMKKAFNSTSRFARLETMKTAMAGTNLYIRFK 917

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NM++K  +  +  + ++ +  ++  S+SGN C+DKKA AIN I GRGK+ V
Sbjct: 918  TTTGDAMGMNMISKGVEHALSVMYNEGFEDMNIVSLSGNYCTDKKAAAINWIDGRGKSVV 977

Query: 186  AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            AE  I   + +  L+T  + ++ LN  KNLIG+ +AG +   NAH AN++ A +LATGQD
Sbjct: 978  AEAIIPADVVKNVLKTDVDTLVELNVNKNLIGSAMAGSMGGFNAHAANIVAAIFLATGQD 1037

Query: 246  AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
             A +VE +  +T  +    +L  S ++P++ +G +G G  +      L  LG      T 
Sbjct: 1038 PAQVVESANCITLMRNLRGNLQISVSMPSIEVGTLGGGTILEPQSAMLDMLGVRGPHPTN 1097

Query: 305  -GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G+NARRLA I AA VL GELSL +A    G L++AH+   R
Sbjct: 1098 PGENARRLARIVAAAVLAGELSLCSALAA-GHLVKAHMAHNR 1138


>gi|90416752|ref|ZP_01224682.1| 3-hydroxy-3-methylglutaryl-CoA reductase [marine gamma
           proteobacterium HTCC2207]
 gi|90331505|gb|EAS46741.1| 3-hydroxy-3-methylglutaryl-CoA reductase [marine gamma
           proteobacterium HTCC2207]
          Length = 388

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 113/336 (33%), Positives = 174/336 (51%), Gaps = 9/336 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+  IGP+++ G        VP+AT E  L  S  RGA + +    G++ T++D+ M R
Sbjct: 59  VPLGLIGPLRVNGEHASGDFYVPMATSEGTLIASYNRGARL-LRDSGGVKVTVVDDAMQR 117

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F   +A  A      +     EIA   E T+   +   +    A  + +LR  F TG
Sbjct: 118 APVFVFNDAREARDFGLWVEQNVEEIAAQAETTTSSGKLRNIEQYAAARMRYLRFNFTTG 177

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DA+G NMV KA     +WI+  +  +    +SG + +DKK + IN +  RGK  VAE+ I
Sbjct: 178 DAAGQNMVGKATFIACEWIMKTYPGIQRYMLSGAMDTDKKHSQINTLHSRGKRVVAEVLI 237

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
              + +K +  + E ++    Q N +G+F+AG   S  AH AN + A ++ATGQDAAN+ 
Sbjct: 238 PGELLEKTMGVTAE-VLFKARQINQVGSFMAGS-SSTGAHAANGIAAVFIATGQDAANVA 295

Query: 251 EGSQGLTYAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNAR 309
           E S  + +A +    + Y S T+P+LI+   G G  +P  +  L  LGC    K      
Sbjct: 296 ESSSSIIFADVDKAGNYYLSITLPSLIVATYGGGTGLPTQQECLDMLGCNGAGKV----H 351

Query: 310 RLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +LA I  ATVL GE+SL++A    G+ + +H  L R
Sbjct: 352 KLAEIIGATVLAGEVSLMSAVL-AGDWVTSHDALGR 386


>gi|21226437|ref|NP_632359.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanosarcina
           mazei Go1]
 gi|20904698|gb|AAM30031.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanosarcina
           mazei Go1]
          Length = 418

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 196/344 (56%), Gaps = 8/344 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   G +K+ G     +  +PLAT E  L  SV RG  + +    G    + +
Sbjct: 76  IGAVQIPLGVAGLLKVNGEYAAGEYYIPLATTEGALVASVNRGCSV-ITRSGGANVRVFE 134

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  F+ E+ E A      +   +   ++ +  E+T++F + L +   + G  ++L
Sbjct: 135 DEMTRAPVFKFESLERARKFYDWVKSPETFEQMKQAAEKTTRFGKLLSVKPFVTGTYIYL 194

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R  + T DA G NMVT A DAVM  I  ++   H  ++SGN+C+DKK  +I+ I+GRGK 
Sbjct: 195 RFSYDTKDAMGMNMVTIATDAVMHLIEDEFG-AHPVTLSGNMCTDKKPASISAILGRGKT 253

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            VAE+TI + I ++ L+ +PE +  +N  KNL+G+  AG +   NAH AN++ A YLA G
Sbjct: 254 VVAEVTIPQEIVKETLKCTPESMFEVNYSKNLLGSARAGAM-GFNAHAANIIAAVYLACG 312

Query: 244 QDAANIVEGSQGLTYAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           QDAA++VEGS  +T  +L   + ++ S T+P L +G VG G  +   ++ L  LG     
Sbjct: 313 QDAAHVVEGSTAITSMELTKYEEIHCSVTLPALPVGTVGGGTGLGTQRDCLNILGVAGAG 372

Query: 303 KT-GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            T G N+R+ A I A+ VL GE+SL+ AQ   G L  AH +L R
Sbjct: 373 DTPGINSRKFAEIVASAVLAGEISLIGAQA-AGHLARAHAQLGR 415


>gi|2495263|sp|Q12577|HMDH_GIBFU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|4376229|emb|CAA63970.1| HMG-CoA-reductase [Gibberella fujikuroi]
          Length = 976

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 180/346 (52%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  
Sbjct: 590 IGYMPLPVGVAGPLVIDGQ----SYFIPMATTEGVLVASASRGCK-AINSGGGAITVLTA 644

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR   + FET     A     +    +  + +    TS+F R   + + +AG  L++
Sbjct: 645 DGMTRGPCVAFETLERAGAAKLWLDSEAGQDMMKKAFNSTSRFARLQSMKTALAGTNLYI 704

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
           R +  TGDA G NM++K  +  +  + +   +  +   SVSGN C+DKKA A+N I GRG
Sbjct: 705 RFKTTTGDAMGMNMISKGVEHALSVMANDGGFDDMQIISVSGNYCTDKKAAALNWIDGRG 764

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K  VAE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH AN++ A +LA
Sbjct: 765 KGVVAEAIIPGEVVRSVLKSDVDSLVELNVAKNLIGSAMAGSVGGFNAHAANIVAAIFLA 824

Query: 242 TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           TGQD A +VE +  +T  K  + +L  S ++P+L +G +G G  +      L  LG    
Sbjct: 825 TGQDPAQVVESANCITIMKNLNGALQISVSMPSLEVGTLGGGTILEPQGAMLDILGVRGS 884

Query: 302 RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             T  GDNARRLA I  A VL GELSL +A    G L+ AH++  R
Sbjct: 885 HPTNPGDNARRLARIIGAAVLAGELSLCSALA-AGHLVRAHMQHNR 929


>gi|156054340|ref|XP_001593096.1| hypothetical protein SS1G_06018 [Sclerotinia sclerotiorum 1980]
 gi|154703798|gb|EDO03537.1| hypothetical protein SS1G_06018 [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 1211

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 120/343 (34%), Positives = 180/343 (52%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 826  LPLPLGVAGPIVIDGQ----SFFLPMATTEGVLVASTSRGCK-AINSGGGAVTVLTGDGM 880

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   I FET     A     +    +  +      TS+F R   + + +AG  L+ R +
Sbjct: 881  TRGPCIAFETLERAGAAKVWLDSEAGQQTMTDAFNSTSRFARLQSIKTALAGTNLYPRFK 940

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKKA A+N I GRGK+ 
Sbjct: 941  TTTGDAMGMNMISKGVEHALKVMSTECGFDDMEIISVSGNFCTDKKAAAVNWIDGRGKSV 1000

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I   + +K L+T  + ++ LN  KNL+G+ +AG +   NAH AN++ A +LATGQ
Sbjct: 1001 VAEAIIPGDVVRKVLKTDVDALVELNIAKNLVGSAMAGAMGGFNAHAANIVAAIFLATGQ 1060

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A +VE S  +T  K    +L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 1061 DPAQVVESSSCITLMKNLRGNLQISVSMPSIEVGTLGGGTILEPQSAMLDLLGVRGSHPT 1120

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNAR+LA + AA VL GELSL +A    G L+++H+   R
Sbjct: 1121 NPGDNARKLARVIAAAVLAGELSLCSALAA-GHLVQSHMAHNR 1162


>gi|254480638|ref|ZP_05093885.1| Hydroxymethylglutaryl-coenzyme A reductase [marine gamma
           proteobacterium HTCC2148]
 gi|214039221|gb|EEB79881.1| Hydroxymethylglutaryl-coenzyme A reductase [marine gamma
           proteobacterium HTCC2148]
          Length = 394

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 177/341 (51%), Gaps = 13/341 (3%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ + G   Q +  VPLAT E  L  S  RG  + +    G+  T+  + M R
Sbjct: 59  VPIGVAGPLLVNGEHAQGEFYVPLATIEGTLIASYNRGMRL-IRESGGVMTTVCGDAMQR 117

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  +N+  A      +      I +  E T+   + +++   +  N +  R  F TG
Sbjct: 118 APAFVFKNSREARDFSNWLRENFEAIKQQAESTTSVGKLVEIEQYVFHNFVNTRFNFTTG 177

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DA+G NM  +A     +WI  Q+  L +  +S N  ++KK +++N + GRG+   AEITI
Sbjct: 178 DAAGQNMTGRATYVACEWIRQQYPQLRHYMLSSNFETEKKPSSLNSLGGRGRRVTAEITI 237

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            +A+    +R +PE++   N Q +L+ +++AG   +A AH AN L A Y+ATGQDA  I 
Sbjct: 238 PKAVLSSLMRATPEQMAYGN-QLSLMSSYIAGSTSNA-AHPANGLAALYIATGQDAGCIG 295

Query: 251 EGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNAR 309
           E  Q   Y+ +  D  LYFS T+P L++   G G  +P  +  L  + C  + K    A 
Sbjct: 296 EAVQSTVYSYVTRDGDLYFSITLPALVMATYGGGTGLPTQRECLELMDCYGQGK----AY 351

Query: 310 RLAAICAATVLCGELSLLAA-----QTNPGELMEAHLRLER 345
           +L  I AATVL GELSL AA     ++   E ++AH +L R
Sbjct: 352 KLIEIAAATVLAGELSLGAATRRNKESGKNEWVDAHEKLGR 392


>gi|195054663|ref|XP_001994244.1| GH23594 [Drosophila grimshawi]
 gi|193896114|gb|EDV94980.1| GH23594 [Drosophila grimshawi]
          Length = 928

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 186/345 (53%), Gaps = 16/345 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +K  VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 569 VPIPVGFAGPLLLDG----EKHYVPMATTEGALVASTNRGCK--ALSVRGVRSVVEDVGM 622

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARV---IEQTSQFTRFLQLHSQIAGNLLFLRL 125
           TR+      +   A  A + I  K A   +V    + TS+F R  +    + G  L++R 
Sbjct: 623 TRAPCVRFPSVARASEAKKWIE-KDANYQQVKTEFDSTSRFGRLKECQIAMDGPQLYIRF 681

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I GRGK  V
Sbjct: 682 VALTGDAMGMNMVSKGAEMALRCIKRQFHDMQIISLSGNFCCDKKPAAINWIKGRGKRVV 741

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE TI  A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +LATGQD
Sbjct: 742 AECTIPAATLRTVLKTDAKTLVECNKLKNMSGSAMAGTIGGNNAHAANMVTAVFLATGQD 801

Query: 246 AANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            A  V  S   T  +    +++ LY +CT+P+L +G VG G  +P     L  LG     
Sbjct: 802 PAQNVTSSNCSTAMECWTDNNEDLYMTCTMPSLEVGTVGGGTGLPGQGACLDMLGLRGAH 861

Query: 303 KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            T  GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 862 ATQPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 905


>gi|224104797|ref|XP_002313569.1| predicted protein [Populus trichocarpa]
 gi|222849977|gb|EEE87524.1| predicted protein [Populus trichocarpa]
          Length = 589

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 118/347 (34%), Positives = 186/347 (53%), Gaps = 17/347 (4%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG    H+S     G  + L+
Sbjct: 238 MPVGYVQIPVGIAGPLLLDDKEYSVPMATTEGCLVASTNRGCKAIHLS----GGATSVLL 293

Query: 65  DERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            + MTR+  + F T      L    E       ++    ++S+F R   +   +AG  L+
Sbjct: 294 RDAMTRAPVVRFGTAKRAAQLKFYLEDPANFEVVSTAFNKSSRFGRLQNIKCALAGKNLY 353

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R   +TGDA G NMV+K    V+D++   +  +    +SGN CSDKK +A+N I GRGK
Sbjct: 354 MRFSCSTGDAMGMNMVSKGVQNVLDFLQKDFPDMDVLGISGNYCSDKKPSAVNWIEGRGK 413

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NA  +N++ A Y+AT
Sbjct: 414 SVVCEAIIKGDVVRKVLKTNVGALVELNMLKNLTGSAMAGALGGFNAQASNIVSAIYIAT 473

Query: 243 GQDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           GQD A  VE S  +T  +  +  + L+ S T+P++ +G VG G  + +    L  LG   
Sbjct: 474 GQDPAQNVESSHCITMMEPLNGGEDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKG 533

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +   G NAR LA+I A +VL  ELSL++A    G+L+ +H++  R
Sbjct: 534 ASKETPGANARLLASIVAGSVLAAELSLMSA-IAAGQLVSSHMKFNR 579


>gi|73952221|ref|XP_860424.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-coenzyme A
           reductase (HMG-CoA reductase) isoform 5 [Canis
           familiaris]
          Length = 835

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 101/259 (38%), Positives = 151/259 (58%), Gaps = 6/259 (2%)

Query: 96  IARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSY 155
           I    + TS+F R  +LH  +AG  L++R +  +GDA G NM++K  +  +  +   +  
Sbjct: 565 IKEAFDSTSRFARLQKLHMSMAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEHFPE 624

Query: 156 LHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNL 215
           +   +VSGN C+DKK  AIN I GRGK+ V E  I   + ++ L+T+ E +I +N  KNL
Sbjct: 625 MQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNL 684

Query: 216 IGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLH---DDSLYFSCTI 272
           +G+ +AG I   NAH AN++ A Y+A GQDAA  V  S  +T  +     ++ LY SCT+
Sbjct: 685 VGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTM 744

Query: 273 PNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAAICAATVLCGELSLLAAQ 330
           P++ +G VG G N+   +  L  LG     K   G+NAR+LA I   TV+ GELSL+AA 
Sbjct: 745 PSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAAL 804

Query: 331 TNPGELMEAHLRLERMHLN 349
              G L+++H+   R  +N
Sbjct: 805 A-AGHLVKSHMIHNRSKIN 822


>gi|51013051|gb|AAT92819.1| YLR450W [Saccharomyces cerevisiae]
          Length = 1045

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 177/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 685  MPIPVGVIGPLIIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 739

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 740  TRGPVVRFPTLIRSGACKIWLDSEEGQNSIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 799

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 800  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 859

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +  L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 860  VAEATIPGDVVKSVLKSDVSALVELNISKNLVGSAMAGSVGGFNAHAANLVTALFLALGQ 919

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 920  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHPT 979

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL +A    G L+++H+   R
Sbjct: 980  EPGANARQLARIIACAVLAGELSLCSALA-AGHLVQSHMTHNR 1021


>gi|154321287|ref|XP_001559959.1| hypothetical protein BC1G_01518 [Botryotinia fuckeliana B05.10]
 gi|150852056|gb|EDN27248.1| hypothetical protein BC1G_01518 [Botryotinia fuckeliana B05.10]
          Length = 1152

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 180/343 (52%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 767  LPLPLGVAGPIVIDGQ----SFFLPMATTEGVLVASTSRGCK-AINSGGGAVTVLTGDGM 821

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   I FET     A     +    +  +      TS+F R   + + +AG  L+ R +
Sbjct: 822  TRGPCIAFETLERAGAAKVWLDSEAGQQTMTEAFNSTSRFARLQSIKTALAGTYLYPRFK 881

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKKA A+N I GRGK+ 
Sbjct: 882  TTTGDAMGMNMISKGVEHALKVMSTECGFDDMDIISVSGNFCTDKKAAAVNWIDGRGKSV 941

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I   + +K L+T  + ++ L+  KNL+G+ +AG +   NAH AN++ A +LATGQ
Sbjct: 942  VAEAIIPGDVVRKVLKTDVDTLVELSIAKNLVGSAMAGAMGGFNAHAANIVAAIFLATGQ 1001

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A +VE S  +T  K    +L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 1002 DPAQVVESSSCITLMKNLRGNLQISVSMPSIEVGTLGGGTILEPQSAMLDLLGVRGSHPT 1061

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNAR+LA + AA VL GELSL +A    G L+++H+   R
Sbjct: 1062 NPGDNARKLARVIAAAVLAGELSLCSALAA-GHLVQSHMAHNR 1103


>gi|6323483|ref|NP_013555.1| Hmg2p [Saccharomyces cerevisiae S288c]
 gi|123338|sp|P12684|HMDH2_YEAST RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 2;
            Short=HMG-CoA reductase 2
 gi|171688|gb|AAA34677.1| 3-hydroxy-3-methyl glutaryl coenzyme A reductase [Saccharomyces
            cerevisiae]
 gi|717061|gb|AAB67527.1| Hmg2p: 3-hydroxy-3-methylglutaryl-coenzyme A (HMG-CoA) reductase
            [Saccharomyces cerevisiae]
 gi|285813854|tpg|DAA09750.1| TPA: Hmg2p [Saccharomyces cerevisiae S288c]
          Length = 1045

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 177/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 685  MPIPVGVIGPLIIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 739

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 740  TRGPVVRFPTLIRSGACKIWLDSEEGQNSIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 799

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 800  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 859

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +  L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 860  VAEATIPGDVVKSVLKSDVSALVELNISKNLVGSAMAGSVGGFNAHAANLVTALFLALGQ 919

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 920  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHPT 979

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL +A    G L+++H+   R
Sbjct: 980  EPGANARQLARIIACAVLAGELSLCSALA-AGHLVQSHMTHNR 1021


>gi|207342655|gb|EDZ70357.1| YLR450Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 1063

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 177/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 703  MPIPVGVIGPLIIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 757

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 758  TRGPVVRFPTLIRSGACKIWLDSEEGQNSIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 817

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 818  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 877

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +  L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 878  VAEATIPGNVVKSVLKSDVSALVELNISKNLVGSAMAGSVGGFNAHAANLVTALFLALGQ 937

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 938  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGSIGGGTVLEPQGAMLDLLGVRGPHPT 997

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL +A    G L+++H+   R
Sbjct: 998  EPGANARQLARIIACAVLAGELSLCSALA-AGHLVQSHMTHNR 1039


>gi|151940965|gb|EDN59347.1| 3-hydroxy-3-methylglutaryl-coenzyme A (HMG-CoA) reductase isozyme
            [Saccharomyces cerevisiae YJM789]
          Length = 1045

 Score =  173 bits (438), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 177/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 685  MPIPVGVIGPLIIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 739

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 740  TRGPVVRFPTLIRSGACKIWLDSEEGQNSIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 799

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 800  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 859

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +  L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 860  VAEATIPGDVVKSVLKSDVSALVELNISKNLVGSAMAGSVGGFNAHAANLVTALFLALGQ 919

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 920  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHPT 979

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL +A    G L+++H+   R
Sbjct: 980  EPGANARQLARIIACAVLAGELSLCSALA-AGHLVQSHMTHNR 1021


>gi|190405485|gb|EDV08752.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase isozyme
            [Saccharomyces cerevisiae RM11-1a]
          Length = 1045

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 177/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 685  MPIPVGVIGPLIIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 739

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 740  TRGPVVRFPTLIRSGACKIWLDSEEGQNSIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 799

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 800  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 859

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +  L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 860  VAEATIPGNVVKSVLKSDVSALVELNISKNLVGSAMAGSVGGFNAHAANLVTALFLALGQ 919

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 920  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHPT 979

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL +A    G L+++H+   R
Sbjct: 980  EPGANARQLARIIACAVLAGELSLCSALA-AGHLVQSHMTHNR 1021


>gi|238507922|ref|XP_002385162.1| HMG-CoA reductase, putative [Aspergillus flavus NRRL3357]
 gi|220688681|gb|EED45033.1| HMG-CoA reductase, putative [Aspergillus flavus NRRL3357]
          Length = 1044

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 122/345 (35%), Positives = 183/345 (53%), Gaps = 11/345 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+   GPM I G        +P+AT E  L  S  RG   ++    G   TL  
Sbjct: 698  IGYLPLPLGLAGPMVIDGQAY----FIPMATTEGVLVASASRGCK-AINAGGGAVTTLKG 752

Query: 66   ERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR       +A+ A  A +  E  + +  +      TS+F R   L    AG  L++
Sbjct: 753  DGMTRGPCLGFPSAKRAAEAQRWAESPIGRRVLTDTFNATSRFARLQSLTFAQAGTYLYI 812

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGK 182
            R    TGDA G NM++K  +  +  + +  +  ++  ++SGN C+DKK+ AIN I GRGK
Sbjct: 813  RFRTTTGDAMGMNMISKGIEQALQAMTAHGFPDMNTITLSGNFCADKKSAAINWIGGRGK 872

Query: 183  NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
            + +AE TI     +K L+T  + ++ LNT KNL+G+ +AG +   NAH +N++ A +LAT
Sbjct: 873  SVIAEATIPAETVRKVLKTEVDALVELNTAKNLVGSAMAGSMGGFNAHASNLVQAVFLAT 932

Query: 243  GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            GQD A  VE S  +T  K  D +L+ + ++P++ +G +G G  + A    L  LG     
Sbjct: 933  GQDPAQNVESSSCITTMKNIDGNLHIAVSMPSMEVGTIGGGTILEAQGAMLDLLGVRGAH 992

Query: 303  KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             T  G NARRLA I AA VL GELS  +A    G L+ AH++  R
Sbjct: 993  PTDPGANARRLARIIAAAVLAGELSTCSALA-AGHLVNAHMQHNR 1036


>gi|259148426|emb|CAY81673.1| Hmg2p [Saccharomyces cerevisiae EC1118]
          Length = 1045

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 177/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 685  MPIPVGVIGPLIIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 739

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 740  TRGPVVRFPTLIRSGACKIWLDSEEGQNSIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 799

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 800  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 859

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +  L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 860  VAEATIPGNVVKSVLKSDVSALVELNISKNLVGSAMAGSVGGFNAHAANLVTALFLALGQ 919

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 920  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHPT 979

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL +A    G L+++H+   R
Sbjct: 980  EPGANARQLARIIACAVLAGELSLCSALA-AGHLVQSHMTHNR 1021


>gi|323336314|gb|EGA77584.1| Hmg2p [Saccharomyces cerevisiae Vin13]
          Length = 1045

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 177/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 685  MPIPVGVIGPLIIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 739

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 740  TRGPVVRFPTLIRSGACKIWLDSEEGQNSIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 799

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 800  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 859

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +  L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 860  VAEATIPGNVVKSVLKSDVSALVELNISKNLVGSAMAGSVGGFNAHAANLVTALFLALGQ 919

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 920  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHPT 979

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL +A    G L+++H+   R
Sbjct: 980  EPGANARQLARIIACAVLAGELSLCSALA-AGHLVQSHMTHNR 1021


>gi|323347349|gb|EGA81622.1| Hmg2p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 1045

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 177/343 (51%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 685  MPIPVGVIGPLIIDGT----SYHIPMATTEGCLVASAMRGCK-AINAGGGATTVLTKDGM 739

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +  I +    TS+F R   + + +AG+LLF+R  
Sbjct: 740  TRGPVVRFPTLIRSGACKIWLDSEEGQNSIKKAFNSTSRFARLQHIQTCLAGDLLFMRFR 799

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  ++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 800  TTTGDAMGMNMISKGVEYSLKQMVEEYGWEDMEVVSVSGNYCTDKKPAAINWIEGRGKSV 859

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE TI   + +  L++    ++ LN  KNL+G+ +AG +   NAH AN++ A +LA GQ
Sbjct: 860  VAEATIPGNVVKSVLKSDVSALVELNISKNLVGSAMAGSVGGFNAHAANLVTALFLALGQ 919

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D  L  S ++P++ +G +G G  +      L  LG      T
Sbjct: 920  DPAQNVESSNCITLMKEVDGDLRISVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGPHPT 979

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LA I A  VL GELSL +A    G L+++H+   R
Sbjct: 980  EPGANARQLARIIACAVLAGELSLCSALA-AGHLVQSHMTHNR 1021


>gi|317158184|ref|XP_001826888.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aspergillus oryzae
            RIB40]
          Length = 1044

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 122/345 (35%), Positives = 183/345 (53%), Gaps = 11/345 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+   GPM I G        +P+AT E  L  S  RG   ++    G   TL  
Sbjct: 698  IGYLPLPLGLAGPMVIDGQAY----FIPMATTEGVLVASASRGCK-AINAGGGAVTTLKG 752

Query: 66   ERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR       +A+ A  A +  E  + +  +      TS+F R   L    AG  L++
Sbjct: 753  DGMTRGPCLGFPSAKRAAEAQRWAESPIGRRVLTDTFNATSRFARLQSLTFAQAGTYLYI 812

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGK 182
            R    TGDA G NM++K  +  +  + +  +  ++  ++SGN C+DKK+ AIN I GRGK
Sbjct: 813  RFRTTTGDAMGMNMISKGIEQALQAMTAHGFPDMNTITLSGNFCADKKSAAINWIGGRGK 872

Query: 183  NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
            + +AE TI     +K L+T  + ++ LNT KNL+G+ +AG +   NAH +N++ A +LAT
Sbjct: 873  SVIAEATIPAETVRKVLKTEVDALVELNTAKNLVGSAMAGSMGGFNAHASNLVQAVFLAT 932

Query: 243  GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            GQD A  VE S  +T  K  D +L+ + ++P++ +G +G G  + A    L  LG     
Sbjct: 933  GQDPAQNVESSSCITTMKNIDGNLHIAVSMPSMEVGTIGGGTILEAQGAMLDLLGVRGAH 992

Query: 303  KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             T  G NARRLA I AA VL GELS  +A    G L+ AH++  R
Sbjct: 993  PTDPGANARRLARIIAAAVLAGELSTCSALAA-GHLVNAHMQHNR 1036


>gi|11132850|sp|O74164|HMDH_PICJA RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|3341972|dbj|BAA31937.1| HMG-CoA reductase [Pichia jadinii]
          Length = 934

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 181/346 (52%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ I G        +P+AT E  L  S  RG     L   G+   L  
Sbjct: 590 IGYMPLPVGVAGPLIIDGK----PYHIPMATTEGCLVASAMRGCKAINLG-GGVTTVLTK 644

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR   + F +           +    + E+ +    TS+F R   L + +AG+LLF+
Sbjct: 645 DGMTRGPCVKFPSLKRAGQCKLWLDSDEGQEEMKKAFNSTSRFARLQHLQTALAGDLLFI 704

Query: 124 RLEFATGDASGHNMVTKAADAVMDWI--LSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           R    TGDA G NM++K  +  +  +  +  W  +   SVSGN C+DKK  A+N I GRG
Sbjct: 705 RFRTVTGDAMGMNMISKGVEYALKQMTEVFGWDDMMVVSVSGNYCTDKKPAAVNWINGRG 764

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ VAE +I +    K L++S + ++ +N  KNLIG+ +AG +   NA  ANM+ A YLA
Sbjct: 765 KSVVAEASIPKDAVVKVLKSSVKAVVDVNVNKNLIGSAMAGSVGGFNAQAANMVTAVYLA 824

Query: 242 TGQDAANIVEGSQGLTY-AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            GQD A  VE S  +T   +  D  L  S ++P++ +G +G G  +    + L  LG   
Sbjct: 825 LGQDPAQNVESSNCITLMTETEDGDLKVSVSMPSIEVGTIGGGTILDPQGSMLELLGVRG 884

Query: 301 ERKT-GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G+NAR+LA I A+ VL GELSL++A    G L+++H++  R
Sbjct: 885 PADVPGENARQLAKIVASIVLSGELSLVSALA-AGHLVQSHMQHNR 929


>gi|156766668|gb|ABU95054.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Ozonium sp. BT2]
 gi|157965843|gb|ABW06958.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Ozonium sp. BT2]
          Length = 1173

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 122/347 (35%), Positives = 184/347 (53%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 803  LPLPLGVAGPLNIDGQ----NYFLPMATTEGVLVASTSRGCK-AINAGGGCITVLTGDGM 857

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
            TR   + FET    +A     ++ +   E  +V++     TS+F R   L + +AG  L+
Sbjct: 858  TRGPCVGFET----LARAGEAKVWIDSEEGQKVMKAAFNSTSRFARLQTLKTALAGTYLY 913

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +      SVSGN C+DKK  AIN + GR
Sbjct: 914  IRFKTTTGDAMGMNMISKGVEHALSVMKNEAGFDDMAIISVSGNFCTDKKPAAINWVDGR 973

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++    ++ LN  KNLIG+ +AG I   NAH AN++ A +L
Sbjct: 974  GKSVVAEAIIPADVVKNVLKSDVNALVELNIAKNLIGSAMAGSIGGYNAHAANIVTAVFL 1033

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K  + +L+ S ++P++ +G +G G  +      L  LG   
Sbjct: 1034 ATGQDPAQNVESSNCITVMKNMNGNLHISVSMPSIEVGTIGGGTILEPQSAMLDLLGVRG 1093

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNAR+LA + AA VL GELSL +A    G L++AH+   R
Sbjct: 1094 AHPTSPGDNARQLARVIAAAVLAGELSLCSALAA-GHLVKAHMSHNR 1139


>gi|62122765|ref|NP_001014314.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase b [Danio rerio]
 gi|61403535|gb|AAH91792.1| 3-hydroxy-3-methylglutaryl-Coenzyme A reductase b [Danio rerio]
          Length = 845

 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 121/348 (34%), Positives = 187/348 (53%), Gaps = 13/348 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     +  VP+AT E  L  S  RG     L   G+ + ++ + M
Sbjct: 492 VPVPVGVAGPLLLDGK----EFHVPMATTEGCLVASTNRGCRAVTL-SGGVSSRVLADGM 546

Query: 69  TRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR    +  +A  A  +    E +    EI +  + TS+F R  +L   +AG  L++R +
Sbjct: 547 TRGPVVQMPSACRAAEVKGWLESSEGFTEIKQAFDHTSRFARLDRLQVSLAGRNLYIRFQ 606

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NM++K  +  +  +  ++  +   +VSGN C+DKK  A+N I GRGK+ V 
Sbjct: 607 SQTGDAMGMNMLSKGTEQALGRLQERYPDMRLLAVSGNYCTDKKPAAVNWIHGRGKSTVC 666

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I   + ++ L++S   ++ LN  KNL+G+ +AG I   NAH AN++ A Y+A GQD 
Sbjct: 667 EAVIPARVVKEVLKSSTAALVELNISKNLVGSAMAGSIGGFNAHAANIVTAIYIACGQDP 726

Query: 247 ANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEE 301
           A  V  S  +T  +      + LY SCT+P+L LG +G G  +PA    L  LG      
Sbjct: 727 AQTVGSSNCITLMECVGTSGEDLYVSCTMPSLELGTIGGGTGLPAQHACLQMLGVGGASV 786

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
           +  G+N+R LA I  A+VL GELSL+AA    G L+++H+   R  +N
Sbjct: 787 QCPGENSRTLARIVCASVLAGELSLMAALA-AGHLVQSHMTHNRSKVN 833


>gi|108733587|gb|ABG00048.1| HMG CoA reductase [Neotyphodium lolii]
          Length = 1188

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 126/348 (36%), Positives = 184/348 (52%), Gaps = 22/348 (6%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 811  LPLPVGVAGPLVIDGQ----SYFIPMATTEGVLVASTSRGCK-AINSGGGAITVLTSDGM 865

Query: 69   TRS--IFFET-ENAEMALTALQ----EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
            TR   + FET E A  A   L     + T+KKA        TS+F R   + + +AG  L
Sbjct: 866  TRGPCVSFETLERAGAAKLWLDSEAGQNTMKKA-----FNSTSRFARLQHMKTALAGTNL 920

Query: 122  FLRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMG 179
            ++R +  TGDA G NM++K  +  ++ + +   +  ++  +VSGN C DKK  A+N I G
Sbjct: 921  YIRFKTTTGDAMGMNMISKGVEHALNVMATDGGFDDMNIITVSGNFCIDKKPAAMNWIDG 980

Query: 180  RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
            RGK  VAE  I   + +  L++  + ++ LN  KNLIG+ +AG I   NAH AN++ A +
Sbjct: 981  RGKGIVAEAIIPADVVKSVLKSDVDALVELNIAKNLIGSAMAGSIGGFNAHAANIVAAIF 1040

Query: 240  LATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI 299
            LATGQD A +VE    +T  K    SL  + ++P+L +G +G G  +      L  LG  
Sbjct: 1041 LATGQDPAQVVESCNCITTMKNLHGSLQIAVSMPSLEVGTLGGGTILEPQSAMLDMLGVR 1100

Query: 300  EERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                T  GDNARRLA I  A+VL GELSL +A    G L++AH++  R
Sbjct: 1101 GSHPTNPGDNARRLARIIGASVLAGELSLCSA-LQAGHLVKAHMQHNR 1147


>gi|73952223|ref|XP_860459.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-coenzyme A
           reductase (HMG-CoA reductase) isoform 6 [Canis
           familiaris]
          Length = 888

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 119/351 (33%), Positives = 183/351 (52%), Gaps = 13/351 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRILA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E       I    + TS++ +   +   +AG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETPEGFTVIKEAFDSTSRYVKMSNICGCMAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEHFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG   
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQG 825

Query: 301 ERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 826 ACKDNPGENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 875


>gi|307352707|ref|YP_003893758.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanoplanus
           petrolearius DSM 11571]
 gi|307155940|gb|ADN35320.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanoplanus
           petrolearius DSM 11571]
          Length = 401

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 118/341 (34%), Positives = 184/341 (53%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   G +K+ G    D+  +PLAT E  L  S+ RG   ++    G    +  
Sbjct: 65  IGAVQVPVGIAGKLKVNGEYADDEFYIPLATTEGALVASINRGCK-AITLAGGADVRIQR 123

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F  +N   A  A + I      +  + E T+   + L +   + G  L  R+
Sbjct: 124 DGMTRAPVFAAKNVVQATEAARWIEENITLLKEIAETTTSHGKLLDIRCFVTGTNLHARI 183

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           EF TGDA G NMVT A++ V   I  +   +   ++SGN+C+DKK +AIN I+GRGK  V
Sbjct: 184 EFFTGDAMGMNMVTIASEKVAAKIQEETGVVLV-ALSGNMCTDKKPSAINVILGRGKTVV 242

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A + +   + +   +T  + +  +N +KNL+G+  A  +   N+H AN++ A +LA GQD
Sbjct: 243 AGVFLPDDLIKSTFKTDSKTMAEVNMKKNLVGSARAVSL-GFNSHAANVIAAVFLACGQD 301

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
            A++VEGS  +T  +  +  +Y S T+P+L +G VG G  +   +  L  LGC    +T 
Sbjct: 302 PAHVVEGSNTITTVEQAEGGVYVSVTLPSLQVGTVGGGTGLDTQREALNLLGCAGGGETS 361

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G N+R+ A I AA VL GELSL+ A    G L  AH +L R
Sbjct: 362 GANSRKFAEIIAAAVLAGELSLIGA-LGAGHLARAHKQLGR 401


>gi|317029567|ref|XP_001391903.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aspergillus niger
            CBS 513.88]
          Length = 1131

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 121/350 (34%), Positives = 185/350 (52%), Gaps = 20/350 (5%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  
Sbjct: 765  IGYLPLPLGVAGPLTIDGQ----SYFIPMATTEGVLVASTSRGAK-AINAGGGAVTVLTG 819

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVI----EQTSQFTRFLQLHSQIAGN 119
            + MTR   + F T    +A  A  ++ L   E   ++      TS+F R   + + +AG 
Sbjct: 820  DGMTRGPCVGFPT----LARAAAAKVWLDSEEGQSIMMAAFNSTSRFARLQHMKTALAGT 875

Query: 120  LLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGI 177
             L++R +  TGDA G NM++K  +  ++ + ++  +      SVSGN C+DKK+ A+N I
Sbjct: 876  YLYIRFKTTTGDAMGMNMISKGVEKALNVMATECGFDDMATISVSGNFCTDKKSAAVNWI 935

Query: 178  MGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA 237
             GRGK+ VAE  I   I +  L++    ++ LNT KNLIG+ +AG +   NAH +N++ A
Sbjct: 936  DGRGKSVVAEAIIPGEIVRNVLKSDVNALVELNTSKNLIGSAMAGSLGGFNAHASNIVTA 995

Query: 238  YYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
             +LATGQD A  VE S  +T  +  + +L  + ++P++ +G +G G  +      L  LG
Sbjct: 996  VFLATGQDPAQNVESSSCITTMRNLNGNLQIAVSMPSIEVGTIGGGTILEGQSAMLEFLG 1055

Query: 298  CIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                  T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1056 VRGSHPTNPGDNARQLARIVAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1104


>gi|109896756|ref|YP_660011.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Pseudoalteromonas
           atlantica T6c]
 gi|109699037|gb|ABG38957.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pseudoalteromonas
           atlantica T6c]
          Length = 395

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 178/338 (52%), Gaps = 11/338 (3%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+K+ G   + +  VPLAT E  L  S  RG  + +    G++ T++D+ M R
Sbjct: 64  VPIGLAGPVKVNGEYAKGEFYVPLATTEGTLVASYNRGMRV-LSAAGGVKVTVVDDVMQR 122

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  E+A  A T    +T    +I    E T+   +   +    A  + +LR  F TG
Sbjct: 123 APVFIFEDARQAQTFGNWVTDNFEDIKAQAETTTSVGKLRNIEQYAAARMQYLRFNFTTG 182

Query: 131 DASGHNMVTKAADAVMDWILSQWS--YLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           DA+G NMV KA  A  +W+ + +    L   ++SG + +DKK + +N +  RGK  +AE 
Sbjct: 183 DAAGQNMVGKATFAACEWMKANFPGVGLQRYNLSGAMDTDKKHSQLNTLHSRGKRVIAEA 242

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
           TI+  I +  L  S + +  +    N+ G+F+AG I +  +H AN + A ++A GQDAAN
Sbjct: 243 TISSEILESKLGVSAQMLFKMRQISNM-GSFMAGSINNG-SHSANGITAMFIACGQDAAN 300

Query: 249 IVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307
           + E S  L++  + +  + Y + T+P+LI+   G G  +   K  L  + C  E K    
Sbjct: 301 VAESSAALSFVDVDEQGNFYIAITLPSLIVATFGGGTALATQKECLEMMDCFGEGK---- 356

Query: 308 ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           AR+LA I  ATVL GELSL AA    G+ + +H  L R
Sbjct: 357 ARKLAEIIGATVLAGELSLSAA-VLAGDWVTSHDALGR 393


>gi|295663911|ref|XP_002792508.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Paracoccidioides
            brasiliensis Pb01]
 gi|226279178|gb|EEH34744.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Paracoccidioides
            brasiliensis Pb01]
          Length = 1157

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 180/346 (52%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  
Sbjct: 776  VGYLPLPLGLAGPLVIDGT----SYFIPMATTEGVLVASTSRGCK-AINAGGGAITVLTG 830

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   + F T     A     +    +A +      TS+F R   + + +AG  L++
Sbjct: 831  DGMTRGPCVSFPTLTRAGAAKVWLDSEEGQAVMKNAFNSTSRFARLQSMKTAMAGTNLYI 890

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
            R +  TGDA G NM++K  +  +  + ++  +  +   S+SGN C+DKK  A+N I GRG
Sbjct: 891  RFKTTTGDAMGMNMISKGVEKALQVMSTEAGFDDMTVVSISGNYCADKKPAAVNWIEGRG 950

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K  VAE  I   + +  L++  E ++ LNT KNLIG+ +AG I   NAH +N++ A ++A
Sbjct: 951  KAVVAEAIIPADVVRGVLKSDVETLVELNTSKNLIGSAMAGSIGGFNAHASNIVTALFIA 1010

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  + A    L  LG    
Sbjct: 1011 TGQDPAQNVESSNCITIMKNVNGNLQISVSMPSIEVGTIGGGTILEAQSAMLELLGVRGA 1070

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1071 HPTNPGDNARQLARIIAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1115


>gi|225677987|gb|EEH16271.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Paracoccidioides
            brasiliensis Pb03]
          Length = 1143

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 180/346 (52%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  
Sbjct: 762  VGYLPLPLGLAGPLVIDGT----SYFIPMATTEGVLVASTSRGCK-AINAGGGAITVLTG 816

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   + F T     A     +    +A +      TS+F R   + + +AG  L++
Sbjct: 817  DGMTRGPCVSFPTLTRAGAAKVWLDSEEGQAVMKHAFNSTSRFARLQSMKTAMAGTNLYI 876

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
            R +  TGDA G NM++K  +  +  + ++  +  +   S+SGN C+DKK  A+N I GRG
Sbjct: 877  RFKTTTGDAMGMNMISKGVEKALQVMSTEAGFDDMTVVSISGNYCADKKPAAVNWIEGRG 936

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K  VAE  I   + +  L++  E ++ LNT KNLIG+ +AG I   NAH +N++ A ++A
Sbjct: 937  KAVVAEAIIPADVVRGVLKSDVETLVELNTSKNLIGSAMAGSIGGFNAHASNIVTALFIA 996

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  + A    L  LG    
Sbjct: 997  TGQDPAQNVESSNCITIMKNVNGNLQISVSMPSIEVGTIGGGTILEAQSAMLELLGVRGA 1056

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1057 HPTNPGDNARQLARIIAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1101


>gi|322707620|gb|EFY99198.1| HMG CoA reductase [Metarhizium anisopliae ARSEF 23]
          Length = 1254

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 180/343 (52%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 878  LPLPVGVAGPLVIDGQ----SYFIPMATTEGVLVASTSRGCK-AINSGGGAITVLTSDGM 932

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + FET     A     +  + +  +    + TS + R   + + +AG  L++R +
Sbjct: 933  TRGPCVSFETLERAGAAKLWLDSDIGQKTMKDAFDSTSGYARLQHMKTALAGTNLYIRFK 992

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  ++ + ++  +  ++  +VSGN C DKK  A+N I GRGK  
Sbjct: 993  TTTGDAMGMNMISKGVEHALNVMSTEGGFEDMNIVTVSGNFCIDKKPAAMNWIDGRGKGI 1052

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I   I +  L++  + ++ LN  KNLIG+ +AG I   NAH AN++ A +LATGQ
Sbjct: 1053 VAEAIIPADIVKSVLKSDVDALVELNVAKNLIGSAMAGSIGGFNAHAANIVAAIFLATGQ 1112

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A +VE +  +T  K    SL  + ++P+L +G +G G  +      L  LG      T
Sbjct: 1113 DPAQVVESANCITTMKNLHGSLQIAVSMPSLEVGTLGGGTILEPQSAMLDMLGVRGPHPT 1172

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNARRLA I  A VL GELSL +A    G L++AH++  R
Sbjct: 1173 NPGDNARRLARIIGAAVLAGELSLCSA-LQAGHLVKAHMQHNR 1214


>gi|115442670|ref|XP_001218142.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aspergillus terreus
            NIH2624]
 gi|114188011|gb|EAU29711.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aspergillus terreus
            NIH2624]
          Length = 1125

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 122/347 (35%), Positives = 181/347 (52%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GPM I G        +P+AT E  L  S  RGA  ++    G    L  + M
Sbjct: 762  LPLPLGVAGPMLIDGQ----NYFIPMATTEGVLVASASRGAK-AINAGGGAVTVLTGDGM 816

Query: 69   TRS--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A  A  ++ L   E    +      TS+F R   + + +AG  L+
Sbjct: 817  TRGPCVGFPT----LARAAAAKVWLDSEEGRNIMTTAFNSTSRFARLQSMKTALAGTYLY 872

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +      SVSGN C+DKK+ A+N I GR
Sbjct: 873  IRFKTTTGDAMGMNMISKGVEKALHVMSTECGFDDMATISVSGNFCTDKKSAALNWIDGR 932

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++    ++ LNT KNLIG+ ++G +   NAH +N++ A +L
Sbjct: 933  GKSVVAEAIIPGDVVRSVLKSDVNALVELNTSKNLIGSAMSGSLGGFNAHASNLVTAVFL 992

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K  D +L  + ++P + +G +G G  +      L  LG   
Sbjct: 993  ATGQDPAQNVESSSCITTMKNVDGNLQIAVSMPAIEVGTIGGGTILEGQSAMLDLLGVRG 1052

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1053 SHPTNPGDNARQLARIVAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1098


>gi|134076392|emb|CAK48210.1| unnamed protein product [Aspergillus niger]
          Length = 1114

 Score =  172 bits (436), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 121/347 (34%), Positives = 183/347 (52%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  + M
Sbjct: 751  LPLPLGVAGPLTIDGQ----SYFIPMATTEGVLVASTSRGAK-AINAGGGAVTVLTGDGM 805

Query: 69   TRS--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A  A  ++ L   E    +      TS+F R   + + +AG  L+
Sbjct: 806  TRGPCVGFPT----LARAAAAKVWLDSEEGQSIMMAAFNSTSRFARLQHMKTALAGTYLY 861

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  ++ + ++  +      SVSGN C+DKK+ A+N I GR
Sbjct: 862  IRFKTTTGDAMGMNMISKGVEKALNVMATECGFDDMATISVSGNFCTDKKSAAVNWIDGR 921

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   I +  L++    ++ LNT KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 922  GKSVVAEAIIPGEIVRNVLKSDVNALVELNTSKNLIGSAMAGSLGGFNAHASNIVTAVFL 981

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  +  + +L  + ++P++ +G +G G  +      L  LG   
Sbjct: 982  ATGQDPAQNVESSSCITTMRNLNGNLQIAVSMPSIEVGTIGGGTILEGQSAMLEFLGVRG 1041

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1042 SHPTNPGDNARQLARIVAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1087


>gi|119495735|ref|XP_001264646.1| hmg-CoA reductase [Neosartorya fischeri NRRL 181]
 gi|119412808|gb|EAW22749.1| hmg-CoA reductase [Neosartorya fischeri NRRL 181]
          Length = 1063

 Score =  172 bits (436), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 127/343 (37%), Positives = 181/343 (52%), Gaps = 13/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID-ER 67
            + +P+   GP+ I G        +P+AT E  L  S  RG     +   G   T+I+ + 
Sbjct: 720  LPLPVGVAGPLVIDGR----NYFIPMATTEGVLVASASRGCK--AINAGGGAVTVINADG 773

Query: 68   MTRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
            MTR       +   A  A Q I   K +  +      TS+F R   L S  AG  L++R 
Sbjct: 774  MTRGPCLAFSSLSRAAEAKQWIDSDKGKKILTTAFNSTSRFARLQGLKSAQAGTYLYVRF 833

Query: 126  EFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
            +  TGDA G NM++K  +  ++ +    +S +   SV+GN C DKK+ AIN I GRGK+ 
Sbjct: 834  KSTTGDAMGMNMISKGVEKALEVMKEHGFSDMSTISVTGNYCVDKKSAAINWIDGRGKSV 893

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I     +  L+T  + ++ LNT KNL+G+ +AG I   NAH +N++ A +LATGQ
Sbjct: 894  VAEALIPGDAVRSVLKTDVDALVELNTAKNLVGSAMAGSIGGFNAHASNLVAAVFLATGQ 953

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  +++L+ S ++P + +G +G G  + A    L  LG      T
Sbjct: 954  DPAQNVESSSCITIMKNVNNNLHISVSMPCIEVGTIGGGTILEAQAAMLDLLGVRGAHAT 1013

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNAR+LA I AATVL GELS  AA    G L+ AH+   R
Sbjct: 1014 NPGDNARQLARIVAATVLAGELSTCAALA-AGHLVSAHMAHNR 1055


>gi|326473175|gb|EGD97184.1| HMG-CoA reductase [Trichophyton tonsurans CBS 112818]
          Length = 1163

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 121/347 (34%), Positives = 186/347 (53%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G      + +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 781  LPLPLGVAGPLVIDGQ----SLFIPMATTEGVLVASTSRGCK-AINAGGGATTVLTADGM 835

Query: 69   TRS--IFFETEN----AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F + +    A++ L + +  ++ KA        TS+F R   + + +AG  L+
Sbjct: 836  TRGPCVSFSSVSRAGEAKLWLDSEEGQSIMKA----AFNSTSRFARLQTMKTTLAGTNLY 891

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKKA A+N I GR
Sbjct: 892  IRFKTTTGDAMGMNMISKGVEKALSVMANEAGFEDMQTISVSGNFCTDKKAAAVNWIDGR 951

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 952  GKSVVAEAIIPANVVKSVLKSDVDSMVELNISKNLIGSAMAGALGGFNAHASNIVTALFL 1011

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K    +L+ S ++P++ +G +G G  +      L  LG   
Sbjct: 1012 ATGQDPAQNVESSNCITIMKNVGGNLHISVSMPSIEVGTIGGGTILEGQGAMLDLLGVRG 1071

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDN+RRLA I AA VL GELSL AA    G L+ AH+   R
Sbjct: 1072 AHPTNPGDNSRRLARIVAAAVLAGELSLCAALAA-GHLVRAHMAHNR 1117


>gi|326477641|gb|EGE01651.1| HMG-CoA reductase [Trichophyton equinum CBS 127.97]
          Length = 1160

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 121/347 (34%), Positives = 186/347 (53%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G      + +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 778  LPLPLGVAGPLVIDGQ----SLFIPMATTEGVLVASTSRGCK-AINAGGGATTVLTADGM 832

Query: 69   TRS--IFFETEN----AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F + +    A++ L + +  ++ KA        TS+F R   + + +AG  L+
Sbjct: 833  TRGPCVSFSSVSRAGEAKLWLDSEEGQSIMKA----AFNSTSRFARLQTMKTTLAGTNLY 888

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKKA A+N I GR
Sbjct: 889  IRFKTTTGDAMGMNMISKGVEKALSVMANEAGFEDMQTISVSGNFCTDKKAAAVNWIDGR 948

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 949  GKSVVAEAIIPANVVKSVLKSDVDSMVELNISKNLIGSAMAGALGGFNAHASNIVTALFL 1008

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K    +L+ S ++P++ +G +G G  +      L  LG   
Sbjct: 1009 ATGQDPAQNVESSNCITIMKNVGGNLHISVSMPSIEVGTIGGGTILEGQGAMLDLLGVRG 1068

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDN+RRLA I AA VL GELSL AA    G L+ AH+   R
Sbjct: 1069 AHPTNPGDNSRRLARIVAAAVLAGELSLCAALAA-GHLVRAHMAHNR 1114


>gi|328768424|gb|EGF78470.1| hypothetical protein BATDEDRAFT_17340 [Batrachochytrium dendrobatidis
            JAM81]
          Length = 1207

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 124/339 (36%), Positives = 176/339 (51%), Gaps = 13/339 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I   V Q    +P+AT E  L  S  RG     L   G    L  + M
Sbjct: 848  LPLPVGVAGPLTIDSEVYQ----IPMATTEGCLVASTSRGCKAISLG-GGATTVLTGDGM 902

Query: 69   TRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
             R       +A+ A  L A  +     A I    E TS+F +   L  ++AG L+F R  
Sbjct: 903  ARGPVVSFPSAKRAGELKAWLD-DEGFAIIKAAFESTSRFAKLQSLKVRLAGRLMFARFV 961

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
              TGDA G NM++K  +  +  + S++  +   ++SGN C+DKK  A+N I GRGK+ VA
Sbjct: 962  TRTGDAMGMNMISKGVEKSLAEMQSRYPDMQVIAISGNYCTDKKPAALNWIEGRGKSVVA 1021

Query: 187  EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
            E  I   I    L+T+   ++ LN  KNLIG+ +AG +   NAH AN+L A +LATGQD 
Sbjct: 1022 EAMIPGKIVTDVLKTTVAALVELNICKNLIGSAMAGSVGGFNAHAANILTAVFLATGQDP 1081

Query: 247  ANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEER 302
            A  VE S  +T  +  +D   LY SC++P + +G VG G  +      L  LG       
Sbjct: 1082 AQNVESSNCITLMESCNDGQDLYISCSMPCIEVGTVGGGTALAPQAACLDMLGVRGPHLE 1141

Query: 303  KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHL 341
            + G+NA+RLA I  A V+ GELSL AA    G L+ +H+
Sbjct: 1142 RPGENAQRLARIICAAVMAGELSLCAALAA-GHLVRSHM 1179


>gi|226287263|gb|EEH42776.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Paracoccidioides
            brasiliensis Pb18]
          Length = 1142

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 180/346 (52%), Gaps = 12/346 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  
Sbjct: 759  VGYLPLPLGLAGPLVIDGT----SYFIPMATTEGVLVASTSRGCK-AINAGGGAITVLTG 813

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   + F T     A     +    +A +      TS+F R   + + +AG  L++
Sbjct: 814  DGMTRGPCVSFPTLTRAGAAKVWLDSEEGQAVMKHAFNSTSRFARLQSMKTAMAGTNLYI 873

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
            R +  TGDA G NM++K  +  +  + ++  +  +   S+SGN C+DKK  A+N I GRG
Sbjct: 874  RFKTTTGDAMGMNMISKGVEKALQVMSTEAGFDDMTVVSISGNYCADKKPAAVNWIEGRG 933

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K  VAE  I   + +  L++  E ++ LNT KNLIG+ +AG I   NAH +N++ A ++A
Sbjct: 934  KAVVAEAIIPADVVRGVLKSDVETLVELNTSKNLIGSAMAGSIGGFNAHASNIVTALFIA 993

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  + A    L  LG    
Sbjct: 994  TGQDPAQNVESSNCITIMKNVNGNLQISVSMPSIEVGTIGGGTILEAQSAMLELLGVRGA 1053

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  GDNAR+LA I AA VL GELSL +A    G L+ AH+   R
Sbjct: 1054 HPTNPGDNARQLARIIAAAVLAGELSLCSALAA-GHLVRAHMAHNR 1098


>gi|74275567|gb|ABA02245.1| HMG-CoA reductase [Monascus pilosus]
          Length = 1052

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 125/359 (34%), Positives = 184/359 (51%), Gaps = 27/359 (7%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRG--------AHISMLCPD 57
            +  + +P+   GPM I G        +P+AT E  L  S  RG          ++ML  D
Sbjct: 706  IGYLPLPLGLAGPMVIDGQAY----FIPMATTEGVLVASASRGCKAINTGGGAVTMLKGD 761

Query: 58   GIRATLIDERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQ 115
            G         MTR       +A+ A  A +  E  +    +      TS+F R   L   
Sbjct: 762  G---------MTRGPCLGFPSAKRAAEAQRWVESPVGHQVLTDAFNATSRFARLQTLTVA 812

Query: 116  IAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAI 174
             AG  L++R    TGDA G NM++K  +  +  + +  +  ++  ++SGN C+DKK+ AI
Sbjct: 813  QAGTYLYIRFRTTTGDAMGMNMISKGVEKALQAMTAHGFPDMNTITLSGNFCADKKSAAI 872

Query: 175  NGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANM 234
            N I GRGK+ +AE TI     +K L+T  + ++ LNT KNL+G+ +AG +   NAH +N+
Sbjct: 873  NWIGGRGKSVIAEATIPADTVRKVLKTDIDALVELNTAKNLVGSAMAGSMGGFNAHASNL 932

Query: 235  LLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLT 294
            + A +LATGQD A  VE S  +T  K  D +L+ + ++P++ +G +G G  + A    L 
Sbjct: 933  VQAVFLATGQDPAQNVESSSCITTMKKIDGNLHIAVSMPSMEVGTIGGGTILEAQGAMLD 992

Query: 295  ALGCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNGE 351
             LG      T  G NARRLA I AA VL GELS  +A    G L+ AH+R  R   + E
Sbjct: 993  LLGVRGAHPTDPGANARRLARIVAAAVLAGELSTCSALAA-GHLVNAHMRHNRSAASSE 1050


>gi|294508455|ref|YP_003572513.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Salinibacter ruber
           M8]
 gi|294344783|emb|CBH25561.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Salinibacter ruber
           M8]
          Length = 514

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 111/321 (34%), Positives = 163/321 (50%), Gaps = 9/321 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+ + GP+ + G   QD V +PLAT E  L  S  RG  +  L   GI AT+  + M R
Sbjct: 184 IPLGFAGPLTVHGEHAQDDVLIPLATSEGTLVASYNRGIKVCNLS-GGIEATVSRDCMQR 242

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  +NA  A      +      I    E TS     L +   ++ +  +LR  + TG
Sbjct: 243 APVFIFDNARAARDFTHWVDDHMDAIRAEAESTSSVAELLYIDHYLSNHFAYLRFNYRTG 302

Query: 131 DASGHNMVTKAADAVMDWILSQW-SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEIT 189
           DA+G NMV +A  A   WI+ Q+   + +  +  N  +DKKA+ +N +  RGK   AE T
Sbjct: 303 DAAGQNMVGRATFAACGWIMDQYPGPIEHFYLESNFATDKKASQVNVMRTRGKRVTAEAT 362

Query: 190 INRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANI 249
           I+R    +++R  PE  +  +   + +G FL+G   +  AH  N + A ++ATGQD AN+
Sbjct: 363 IDRDTLAQHMRVEPEA-LHHHWSVSTVGAFLSGA-NNNGAHSPNAITALFIATGQDVANV 420

Query: 250 VEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNA 308
            E S G+ Y  + DD  L  S TIP+LI+   G G  +P  +  L  +GC  + K     
Sbjct: 421 SESSAGVLYTDITDDGDLDISLTIPSLIVATYGGGTGLPTQRECLEVMGCYGKGKV---- 476

Query: 309 RRLAAICAATVLCGELSLLAA 329
            + A I AA  L GELSL AA
Sbjct: 477 HKFAEIVAAATLAGELSLGAA 497


>gi|327296339|ref|XP_003232864.1| HMG-CoA reductase [Trichophyton rubrum CBS 118892]
 gi|326465175|gb|EGD90628.1| HMG-CoA reductase [Trichophyton rubrum CBS 118892]
          Length = 1129

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 121/347 (34%), Positives = 186/347 (53%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G      + +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 747  LPLPLGVAGPLVIDGQ----SLFIPMATTEGVLVASTSRGCK-AINAGGGATTVLTADGM 801

Query: 69   TRS--IFFETEN----AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F + +    A++ L + +  ++ KA        TS+F R   + + +AG  L+
Sbjct: 802  TRGPCVSFSSVSRAGEAKLWLDSEEGQSIMKA----AFNSTSRFARLQTMKTTLAGTNLY 857

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKKA A+N I GR
Sbjct: 858  IRFKTTTGDAMGMNMISKGVEKALSVMANEAGFEDMQTISVSGNFCTDKKAAAVNWIDGR 917

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 918  GKSVVAEAIIPANVVKSVLKSDVDSMVELNISKNLIGSAMAGALGGFNAHASNIVTALFL 977

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K    +L+ S ++P++ +G +G G  +      L  LG   
Sbjct: 978  ATGQDPAQNVESSNCITIMKNVGGNLHISVSMPSIEVGTIGGGTILEGQGAMLDLLGVRG 1037

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDN+RRLA I AA VL GELSL AA    G L+ AH+   R
Sbjct: 1038 AHPTNPGDNSRRLARIVAAAVLAGELSLCAALAA-GHLVRAHMAHNR 1083


>gi|240279485|gb|EER42990.1| HMG-CoA reductase [Ajellomyces capsulatus H143]
          Length = 664

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 122/347 (35%), Positives = 182/347 (52%), Gaps = 20/347 (5%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    +  + M
Sbjct: 284 LPLPLGLAGPLTIDGQ----SYFIPMATTEGVLVASTSRGCK-AINAGGGAITVITGDGM 338

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
           TR   I F T    +A     ++ L   E   V++     TS+F R   + + +AG  L+
Sbjct: 339 TRGPCIAFPT----LARAGAAKVWLDSEEGQTVMKNAFNSTSRFARLQSMKTALAGTNLY 394

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
           +R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKK  AIN I GR
Sbjct: 395 IRFKTTTGDAMGMNMISKGVEKALHIMSTEAGFEDMDTISVSGNYCTDKKPAAINWIDGR 454

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK  VAE  I   + +  L++  + ++ LN  KNL+G+ +AG I   NAH +N++ A +L
Sbjct: 455 GKAVVAEAIIPGDVVRSVLKSDVDALVELNISKNLVGSAMAGSIGGFNAHASNIVTALFL 514

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  +      L  LG   
Sbjct: 515 ATGQDPAQNVESSNCITMMKNTNGNLQISVSMPSIEVGTIGGGTILETQSAMLEMLGVRG 574

Query: 301 ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  GDNARRLA I AA VL GELSL +A    G L++AH+   R
Sbjct: 575 SHPTNPGDNARRLARIVAAAVLAGELSLCSALAA-GHLVKAHMAHNR 620


>gi|83815836|ref|YP_446521.1| hydroxymethylglutaryl-coenzyme A reductase [Salinibacter ruber DSM
           13855]
 gi|83757230|gb|ABC45343.1| Hydroxymethylglutaryl-coenzyme A reductase [Salinibacter ruber DSM
           13855]
          Length = 514

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 111/321 (34%), Positives = 163/321 (50%), Gaps = 9/321 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+ + GP+ + G   QD V +PLAT E  L  S  RG  +  L   GI AT+  + M R
Sbjct: 184 IPLGFAGPLTVHGEHAQDDVLIPLATSEGTLVASYNRGIKVCNLS-GGIEATVSRDCMQR 242

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  +NA  A      +      I    E TS     L +   ++ +  +LR  + TG
Sbjct: 243 APVFIFDNARAARDFTHWVDDHMDAIRAEAESTSSVAELLYIDHYLSNHFAYLRFNYRTG 302

Query: 131 DASGHNMVTKAADAVMDWILSQW-SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEIT 189
           DA+G NMV +A  A   WI+ Q+   + +  +  N  +DKKA+ +N +  RGK   AE T
Sbjct: 303 DAAGQNMVGRATFAACGWIMDQYPGPVEHFYLESNFATDKKASQVNVMRTRGKRVTAEAT 362

Query: 190 INRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANI 249
           I+R    +++R  PE  +  +   + +G FL+G   +  AH  N + A ++ATGQD AN+
Sbjct: 363 IDRDTLAQHMRVEPEA-LHHHWSVSTVGAFLSGA-NNNGAHSPNAITALFIATGQDVANV 420

Query: 250 VEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNA 308
            E S G+ Y  + DD  L  S TIP+LI+   G G  +P  +  L  +GC  + K     
Sbjct: 421 SESSAGVLYTDITDDGDLDISLTIPSLIVATYGGGTGLPTQRECLEVMGCYGKGKV---- 476

Query: 309 RRLAAICAATVLCGELSLLAA 329
            + A I AA  L GELSL AA
Sbjct: 477 HKFAEIVAAATLAGELSLGAA 497


>gi|157624|gb|AAA28608.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Drosophila
           melanogaster]
          Length = 916

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 129/351 (36%), Positives = 186/351 (52%), Gaps = 28/351 (7%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G    +   VP+AT E  L  S  RG     L   G+R+ + D  M
Sbjct: 557 VPIPVGYAGPLLLDG----ETYYVPMATTEGALVASTNRGCK--ALSVRGVRSVVEDVGM 610

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVI----EQTSQFTRFLQLHSQIAGNLLFLR 124
           TR+      +   A  A   I  +  E  RV+    + TS+F R    H  + G  L++R
Sbjct: 611 TRAPCVRFPSVARAAEAKSWI--ENDENYRVVKTEFDSTSRFGRLKDCHIAMDGPQLYIR 668

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG-----SVSGNICSDKKATAINGIMG 179
               TGD  G NMV+KA    + W  ++++ LH+      S+SGN C DKK  AIN I G
Sbjct: 669 FVAITGDRMGMNMVSKA----LRWPFAEFT-LHFPDMQIISLSGNFCCDKKPAAINWIKG 723

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
           RGK  V E TI+ A  +  L+T  + ++  N  KN+ G+ +AG I   NAH ANM+ A +
Sbjct: 724 RGKRVVTECTISAATLRSVLKTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTAVF 783

Query: 240 LATGQDAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTAL 296
           LATGQD A  V  S   T  +    + + LY +CT+P+L +G VG G  +P     L  L
Sbjct: 784 LATGQDPAQNVTSSNCSTAMECWAENSEDLYMTCTMPSLEVGTVGGGTGLPGQSACLEML 843

Query: 297 GC--IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G       + GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 844 GVRGAHATRPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 893


>gi|320591163|gb|EFX03602.1| hmg-reductase [Grosmannia clavigera kw1407]
          Length = 1213

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 188/351 (53%), Gaps = 22/351 (6%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  
Sbjct: 833  IGYMPIPVGVAGPLVIDGK----SYFIPMATTEGVLVASTSRGCK-AINAGGGAVTVLTA 887

Query: 66   ERMTRS--IFFET-ENAEMALTALQ----EITLKKAEIARVIEQTSQFTRFLQLHSQIAG 118
            + MTR   + FET E A  A   L     + T++KA        TS+F R  ++ + +AG
Sbjct: 888  DGMTRGPCLSFETVERAGAAKIWLDSEDGQTTMRKA-----FNSTSRFARLSEMKTALAG 942

Query: 119  NLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAING 176
              L++R +  TGDA G NM++K  +  ++ + ++  +  ++  S+SGN C DKKA AIN 
Sbjct: 943  TNLYVRFKTTTGDAMGMNMISKGVEHALNVMRNESGFEDMNIVSLSGNYCIDKKAAAINW 1002

Query: 177  IMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLL 236
            I GRGK+ VAE  I   + +  L++  + ++ LN  KNLIG+ +AG I   NAH AN++ 
Sbjct: 1003 IDGRGKSVVAEAIIPAEVVKSVLKSDVDSLVELNISKNLIGSAMAGAIGGFNAHAANIVA 1062

Query: 237  AYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTAL 296
            A Y+ATGQD A +VE +  +T  K    SL  S ++P++ +G +G G  +      L  L
Sbjct: 1063 AIYIATGQDPAQVVESANCITIMKNLRGSLQISVSMPSIEVGTLGGGTILEPQGAMLDML 1122

Query: 297  GCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G      T  G+NARRLA + AA  L GELSL +A    G L++AH+   R
Sbjct: 1123 GVRGPHPTNPGENARRLARVIAAATLAGELSLCSALAA-GHLVKAHMAHNR 1172


>gi|119188881|ref|XP_001245047.1| hypothetical protein CIMG_04488 [Coccidioides immitis RS]
          Length = 1134

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 119/347 (34%), Positives = 183/347 (52%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    +  + M
Sbjct: 774  LPLPLGVAGPLTIDGQ----SFFIPMATTEGVLIASTSRGCK-AINAGGGAVTVITGDGM 828

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
            TR   + F +    +A     ++ L   E   V++     TS+F R   + + +AG  L+
Sbjct: 829  TRGPCVGFPS----LARAGAAKVWLDSEEGQTVMKNAFNSTSRFARLQSMKTALAGTYLY 884

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +      SVSGN C+DKK  A+N I GR
Sbjct: 885  IRFKTTTGDAMGMNMISKGVEKALHVMATEAGFEDMATISVSGNFCTDKKPAAVNWIDGR 944

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L+++ + ++ LN  KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 945  GKSVVAEAVIPGDVVKSVLKSNVDALVELNISKNLIGSAMAGSVGGFNAHASNIVTALFL 1004

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K  + +L+ S ++P++ +G +G G  + A    L  LG   
Sbjct: 1005 ATGQDPAQNVESSNCITIMKNVNGNLHISVSMPSIEVGTIGGGTILEAQSAMLELLGVRG 1064

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNARRLA I  A VL GELSL +A    G L+ AH+   R
Sbjct: 1065 SHPTTPGDNARRLARIVGAAVLAGELSLCSALAA-GHLVRAHMAHNR 1110


>gi|189065507|dbj|BAG35346.1| unnamed protein product [Homo sapiens]
          Length = 888

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 113/315 (35%), Positives = 169/315 (53%), Gaps = 10/315 (3%)

Query: 18  PMKITGNVIQDK--VKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ + G +  D+   +VP+AT E  L  S  RG     L   G  + ++ + MTR     
Sbjct: 537 PVGVAGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGL-GGGASSRVLADGMTRGPVVR 595

Query: 76  TENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDAS 133
              A     + A  E +   A I    + TS+F R  +LH+ IAG  L++R +  +GDA 
Sbjct: 596 LPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAM 655

Query: 134 GHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRA 193
           G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+ V E  I   
Sbjct: 656 GMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAK 715

Query: 194 ICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGS 253
           + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A GQDAA  V  S
Sbjct: 716 VVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSS 775

Query: 254 QGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNA 308
             +T  +     ++ LY SCT+P++ +G VG G N+   +  L  LG     K   G+NA
Sbjct: 776 NCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENA 835

Query: 309 RRLAAICAATVLCGE 323
           R+LA I   TV+ GE
Sbjct: 836 RQLARIVCGTVMAGE 850


>gi|301763681|ref|XP_002917257.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like
           isoform 2 [Ailuropoda melanoleuca]
          Length = 835

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 100/255 (39%), Positives = 150/255 (58%), Gaps = 6/255 (2%)

Query: 100 IEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG 159
            + TS+F R  +LH  +AG  L++R +  +GDA G NM++K  +  +  +   +  +   
Sbjct: 569 FDSTSRFARLQKLHMSMAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQIL 628

Query: 160 SVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTF 219
           +VSGN C+DKK  AIN I GRGK+ V E  I   + ++ L+T+ E +I +N  KNL+G+ 
Sbjct: 629 AVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSA 688

Query: 220 LAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLI 276
           +AG I   NAH AN++ A Y+A GQDAA  V  S  +T  +     ++ LY SCT+P++ 
Sbjct: 689 MAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIE 748

Query: 277 LGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAAICAATVLCGELSLLAAQTNPG 334
           +G VG G N+   +  L  LG     K   G+NAR+LA I   TV+ GELSL+AA    G
Sbjct: 749 IGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALA-AG 807

Query: 335 ELMEAHLRLERMHLN 349
            L+++H+   R  +N
Sbjct: 808 HLVKSHMIHNRSKIN 822


>gi|8886086|gb|AAF80374.1|AF159136_1 HMG-CoA reductase [Dendroctonus jeffreyi]
 gi|8886084|gb|AAF80373.1| HMG-CoA reductase [Dendroctonus jeffreyi]
          Length = 846

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 182/349 (52%), Gaps = 18/349 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+ + GP+ + G     ++ +P+AT E  L  S  RG     L   G+ ++++ 
Sbjct: 486 IGYMPIPVGYAGPLLLDGR----ELYIPMATTEGCLVASTNRGCR--ALKVSGVTSSVVA 539

Query: 66  ERMTRSIFFETENAEMALTALQEI----TLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
           + MTR       +      A+Q I      KK  I    + +S+F R  +L  +IAG  L
Sbjct: 540 DGMTRGPVVRFPSIVRTSQAMQWIQDPDNFKK--IKEQFDSSSRFARLQRLTLKIAGRFL 597

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           F+R    TGDA G NM++K  +  +  +   +  +   S+SGN C+DKK  AIN I GRG
Sbjct: 598 FIRFIATTGDAMGMNMLSKGTEYSLKLVQQVFYDMEILSLSGNFCTDKKPAAINWIEGRG 657

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K+ V E  +   I    L+T+   ++ +N  +  +G+ +AG I   NAH AN++ A +LA
Sbjct: 658 KSVVCEAIVPAKIISSILKTNVHALVDVNNIQEHVGSAVAGSIGGFNAHAANIVTAIFLA 717

Query: 242 TGQDAANIVEGSQGLTYAK---LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           TGQD A  V  S  +T  +      + LY SCT+P++ +G +G G  +PA    L  LG 
Sbjct: 718 TGQDPAQNVSSSNCMTLMEPWGPDGEDLYISCTMPSIEIGTIGGGTILPAQSACLDILGV 777

Query: 299 --IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                   G NA +LA I   TVL GELSL++A T  G L+++HLR  R
Sbjct: 778 KGSNRENPGANACQLAKIVCGTVLAGELSLMSALT-AGHLVKSHLRHNR 825


>gi|255570|gb|AAB23278.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase, HMGR {active site}
           [tomatoes, cultivar VFNT cherry LA1221, Peptide Partial,
           249 aa]
          Length = 249

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/248 (39%), Positives = 147/248 (59%), Gaps = 5/248 (2%)

Query: 102 QTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSV 161
           ++S+F R   +   IAG  L++R   +TGDA G NMV+K    V+D++ S++  +    +
Sbjct: 3   KSSRFARLQGIQCAIAGKNLYMRFSCSTGDAMGMNMVSKGVQNVLDYLQSEYPDMDVIGI 62

Query: 162 SGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLA 221
           SGN CSDKK  A+N I GRGK+ V E  I   + +K L+T    ++ LN  KNL G+ +A
Sbjct: 63  SGNFCSDKKPAAVNWIEGRGKSVVCEAIIKEDVVKKVLKTEVAALVELNMLKNLTGSAMA 122

Query: 222 GGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGC 279
           G +   NAH +N++ A YLATGQD A  VE S  +T  +  +D   L+ S T+P++ +G 
Sbjct: 123 GALGGFNAHASNIVSAVYLATGQDPAQNVESSHCITMMEAVNDGKDLHISVTMPSIEVGT 182

Query: 280 VGNGKNIPAIKNNLTALGCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELM 337
           VG G  + +    L  LG     +   G NAR LA I A +VL GELSL++A  + G+L+
Sbjct: 183 VGGGTQLASQSACLNLLGVKGANRDAPGSNARLLATIVAGSVLAGELSLMSA-ISAGQLV 241

Query: 338 EAHLRLER 345
           ++H++  R
Sbjct: 242 KSHMKYNR 249


>gi|296810928|ref|XP_002845802.1| HMG-CoA reductase [Arthroderma otae CBS 113480]
 gi|238843190|gb|EEQ32852.1| HMG-CoA reductase [Arthroderma otae CBS 113480]
          Length = 1138

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 182/345 (52%), Gaps = 16/345 (4%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G      + +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 756  LPLPLGVAGPLVIDGQ----SLFIPMATTEGVLVASTSRGCK-AINAGGGATTVLTADGM 810

Query: 69   TRSIFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLFLR 124
            TR       +   A  A  ++ L   E   V++     TS+F R   + + +AG  L++R
Sbjct: 811  TRGPCVSFSSVSRAGEA--KVWLDSEEGQSVMKAAFNSTSRFARLQTMKTVLAGTNLYIR 868

Query: 125  LEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGK 182
             +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKKA A+N I GRGK
Sbjct: 869  FKTTTGDAMGMNMISKGVEKALSVMANEAGFEDMQTISVSGNFCTDKKAAAVNWIDGRGK 928

Query: 183  NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
            + VAE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH +N++ A +LAT
Sbjct: 929  SVVAEAVIPANVVKSVLKSDVDSMVELNISKNLIGSAMAGALGGFNAHASNIVTALFLAT 988

Query: 243  GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            GQD A  VE S  +T  K    +L+ S ++P++ +G +G G  +      L  LG     
Sbjct: 989  GQDPAQNVESSNCITIMKNVGGNLHISVSMPSIEVGTIGGGTILEGQGAMLDLLGVRGAH 1048

Query: 303  KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             T  GDN+RRLA I AA VL GELSL AA    G L+ AH+   R
Sbjct: 1049 PTSPGDNSRRLARIVAAAVLAGELSLCAALAA-GHLVRAHMAHNR 1092


>gi|261251134|ref|ZP_05943708.1| hydroxymethylglutaryl-CoA reductase [Vibrio orientalis CIP 102891]
 gi|260938007|gb|EEX93995.1| hydroxymethylglutaryl-CoA reductase [Vibrio orientalis CIP 102891]
          Length = 419

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 176/344 (51%), Gaps = 14/344 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G   +D   +PLAT E  L  S  RGA + +    G  A LI+
Sbjct: 86  IGTVKIPVGLAGPLRVNGLHAKDDYLIPLATTEAALVASYNRGAQL-ITAAGGASAMLIN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  E+   A   +  +  +     R+ E T+   +   ++  I GN ++L  
Sbjct: 145 EGVTRTPVFLFESLIDAGQFVAWVVTQYDHFKRIAESTTSHGQLHDINVNIEGNHVYLIF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYL-HYGSVSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A + V  +IL    +      + GN+  DKKA +      RGK  
Sbjct: 205 EYRTGDASGQNMVTIATNEVFHYILENSPHTPDEAFLDGNLSGDKKANSHTLRHVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ I R + +KYL T+PE +     Q    G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 TAEVHIERTLVEKYLHTTPESMSRFG-QVTTTGAALSGSI-GVNAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSC-TIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++      ++C T+PNL++G VG G  +P+ K       C+E   
Sbjct: 323 DAACVAESAVGITRMEVSKTGGLYACVTLPNLMVGTVGGGTRLPSQK------ACLELMN 376

Query: 304 TGDN--ARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              N  A+ LA + A   L GELS++ A    G    AH +L R
Sbjct: 377 LHGNGKAKSLAEVAAVLCLAGELSIVGAFC-AGHFSRAHQKLAR 419


>gi|294462020|gb|ADE76565.1| unknown [Picea sitchensis]
          Length = 305

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 162/294 (55%), Gaps = 7/294 (2%)

Query: 58  GIRATLIDERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQ 115
           G  + L+ E MTR+  + F T      L    E       ++ +   TS+F R   +   
Sbjct: 4   GATSVLLREGMTRAPVVRFPTTKRATDLKFYIEDINNSENLSVIFNSTSRFARLQGIRCA 63

Query: 116 IAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAIN 175
           IAG  L++R    TGDA G NMV+K    V+D++ +++  +   SVSGN C+DKK TA+N
Sbjct: 64  IAGRNLYMRFSCFTGDAMGMNMVSKGVQNVLDFLQNEFHDMDVISVSGNFCADKKPTAVN 123

Query: 176 GIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANML 235
            I GRGK+ V E  I  A+  K L+T+   ++ LN  KNL G+ LAG +   NAH +N++
Sbjct: 124 WIEGRGKSVVCEAVIPEAVVSKVLKTTVPALLELNMLKNLTGSALAGAVGGFNAHASNIV 183

Query: 236 LAYYLATGQDAANIVEGSQGLTYAKLHD--DSLYFSCTIPNLILGCVGNGKNIPAIKNNL 293
            A ++ATGQD A  VE S  +T  +  +    L+ S T+P + +G VG G  + +    L
Sbjct: 184 SAIFIATGQDPAQNVESSHCITMMEASNGGKDLHVSVTMPCIEVGTVGGGTQLASQAACL 243

Query: 294 TALGC--IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             LG      +  G N++RLA I A  VL GELSL++A    G+L+++H++  R
Sbjct: 244 NLLGVKGANAQSPGANSQRLARIVAGAVLAGELSLMSALA-AGQLVKSHMKYNR 296


>gi|303323501|ref|XP_003071742.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase, putative
            [Coccidioides posadasii C735 delta SOWgp]
 gi|240111444|gb|EER29597.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase, putative
            [Coccidioides posadasii C735 delta SOWgp]
 gi|320035119|gb|EFW17061.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Coccidioides
            posadasii str. Silveira]
          Length = 1134

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 119/347 (34%), Positives = 183/347 (52%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    +  + M
Sbjct: 774  LPLPLGVAGPLTIDGQ----SFFIPMATTEGVLIASTSRGCK-AINAGGGAVTVITGDGM 828

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
            TR   + F +    +A     ++ L   E   V++     TS+F R   + + +AG  L+
Sbjct: 829  TRGPCVGFPS----LARAGAAKVWLDSEEGQTVMKNAFNSTSRFARLQSMKTALAGTYLY 884

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +      SVSGN C+DKK  A+N I GR
Sbjct: 885  IRFKTTTGDAMGMNMISKGVEKALHVMATEAGFEDMATISVSGNFCTDKKPAAVNWIDGR 944

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L+++ + ++ LN  KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 945  GKSVVAEAVIPGDVVKSVLKSNVDALVELNISKNLIGSAMAGSVGGFNAHASNIVTALFL 1004

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K  + +L+ S ++P++ +G +G G  + A    L  LG   
Sbjct: 1005 ATGQDPAQNVESSNCITIMKNVNGNLHISVSMPSIEVGTIGGGTILEAQSAMLELLGVRG 1064

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNARRLA I  A VL GELSL +A    G L+ AH+   R
Sbjct: 1065 SHPTTPGDNARRLARIVGAAVLAGELSLCSALAA-GHLVRAHMAHNR 1110


>gi|88604232|ref|YP_504410.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Methanospirillum
           hungatei JF-1]
 gi|88189694|gb|ABD42691.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanospirillum
           hungatei JF-1]
          Length = 401

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 122/341 (35%), Positives = 181/341 (53%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +I +P+   GP++I G      + +PLAT E  L  SV RG  + +    G    ++ 
Sbjct: 65  IGTIQVPLGVAGPVRIKGEYADGTMYLPLATTEGALIASVNRGCSL-ITAAGGADVRILK 123

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F  ++   A      I   + EI    E T++F +   +    AG  +F+RL
Sbjct: 124 DGMTRAPVFAADSIVHAKAVCDWIHAHEGEIRAEAESTTRFGKLTGIEMTTAGTSVFVRL 183

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F TGDA G NMVT A+    D I S+ +     ++SGN C+DKK  A+N +MGRGK   
Sbjct: 184 SFVTGDAMGMNMVTIASAKAADLI-SRETGARLIALSGNWCTDKKPAAVNVVMGRGKTVS 242

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A + +++ +  K L+T    ++ +NT+KNL+G+  AG     NAH AN++ A ++A GQD
Sbjct: 243 AGVLLSQELISKVLKTDAASLLEVNTRKNLVGSARAGSF-GFNAHAANIIAAMFIACGQD 301

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
            A++VEGS  +T      + +Y S T+P L +G VG G ++      L  LG        
Sbjct: 302 PAHVVEGSLCITTVDPAHEGVYVSVTLPALPIGTVGGGTSVETQAECLRMLGVSGSGDPP 361

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G +AR+LA I A+ VL GELSLL A      L  AH  L R
Sbjct: 362 GSHARKLAEIVASGVLAGELSLLGALAAQ-HLARAHSTLGR 401


>gi|313675727|ref|YP_004053723.1| 3-hydroxy-3-methylglutaryl-coenzyme a reductase [Marivirga
           tractuosa DSM 4126]
 gi|312942425|gb|ADR21615.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Marivirga
           tractuosa DSM 4126]
          Length = 425

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 126/343 (36%), Positives = 183/343 (53%), Gaps = 22/343 (6%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P   IGP+++ G+V Q    VPLAT E  L  S +RGA    L        LI E + R
Sbjct: 95  VPTGMIGPVRVVGSVAQGDFYVPLATTEGALVASYQRGAKACTLSGGATSICLI-ESVKR 153

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           S  F+ +N       L     +  ++  +++++S+F +   + S I GN L L  EF TG
Sbjct: 154 SPVFKFDNLGDLGGFLVWFYNQTDQLHELVKKSSRFAQLQDISSNIEGNHLILTFEFQTG 213

Query: 131 DASGHNMVTKAADAVMDWILS-------QWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           DASG NMVT   D +  +IL+       +W       V GN   DKKAT+++    RGK 
Sbjct: 214 DASGQNMVTICTDQICQFILAKSPIKPKKW------YVEGNYSGDKKATSLSFSSVRGKK 267

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
              EIT+  +I +  L++SP+++     + + +GT  +G I  A  H+AN L A +LATG
Sbjct: 268 VTTEITLPVSIVKDVLKSSPKQMEEY-WKTSTLGTIQSGAI-GAQGHYANGLTALFLATG 325

Query: 244 QDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           QD A I E + G+T  +++++  LY S T+PNLI+G +G G  +P  K  L  + C  E 
Sbjct: 326 QDVACIAEAAVGITRMEVNENGDLYASVTLPNLIVGTIGGGTGLPTQKECLELMDCYGEG 385

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           K    AR+ A IC A VL GELS+ AA  + G    AH +L R
Sbjct: 386 K----ARKFAEICGAVVLAGELSIAAA-LSVGHFTSAHQKLGR 423


>gi|46134115|ref|XP_389373.1| hypothetical protein FG09197.1 [Gibberella zeae PH-1]
          Length = 1210

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 179/343 (52%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 763  MPLPVGVAGPLVIDGQ----SYFIPMATTEGVLVASASRGCK-AINAGGGAVTVLTADGM 817

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + FET     A     +       + +    TS+F R   + + +AG  L++R +
Sbjct: 818  TRGPCVAFETLERAGAAKLWLDSEAGSDIMKKAFNSTSRFARLQSMKTALAGTNLYIRFK 877

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKKA A+N I GRGK  
Sbjct: 878  TTTGDAMGMNMISKGVEHALSVMSNEAGFDDMQIVSVSGNYCTDKKAAALNWIDGRGKGV 937

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH AN++ A +LATGQ
Sbjct: 938  VAEAIIPGDVVRSVLKSDVDALVELNISKNLIGSAMAGSVGGFNAHAANIVAAIFLATGQ 997

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A +VE +  +T  K    +L  S ++P+L +G +G G  +      L  LG      T
Sbjct: 998  DPAQVVESANCITIMKNLRGALQISVSMPSLEVGTLGGGTILEPQSAMLDLLGVRGSHPT 1057

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDN+RRLA I  A+VL GELSL +A    G L+ AH++  R
Sbjct: 1058 NPGDNSRRLARIIGASVLAGELSLCSALAA-GHLVRAHMQHNR 1099


>gi|255943163|ref|XP_002562350.1| Pc18g05230 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211587083|emb|CAP94747.1| Pc18g05230 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 1126

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 186/347 (53%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG+  ++    G    L  + M
Sbjct: 764  LPLPLGVAGPINIDGQ----NYFIPMATTEGVLVASTSRGSK-AINAGGGAVTVLTGDGM 818

Query: 69   TRS--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A  A  ++ +   E    I      TS+F R   L + +AG  L+
Sbjct: 819  TRGPCVTFPT----LARAAAAKVWIDSEEGRNIITAAFNSTSRFARLQSLKTALAGTYLY 874

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +D +  +  +  +   S+SGN C+DKK+ AIN   GR
Sbjct: 875  IRFKTTTGDAMGMNMISKGCEKALDVMHKECGFEDMSIISLSGNFCTDKKSAAINWTDGR 934

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 935  GKSVVAEAIIPGDVVKSVLKSDVDALVELNVSKNLIGSAMAGSLGGFNAHASNIVSAIFL 994

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K ++ +L  + ++P++ +G +G G  + A    L  LG   
Sbjct: 995  ATGQDPAQNVESSSCITTMKNNNGNLQIAVSMPSIEVGTIGGGTILEAQGAMLDLLGVRG 1054

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  G+NAR+L+ I AA+VL GELSL AA    G L++AH+   R
Sbjct: 1055 AHSTSPGENARQLSRIIAASVLAGELSLCAALAA-GHLVKAHMAHNR 1100


>gi|88706521|ref|ZP_01104225.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase)
           [Congregibacter litoralis KT71]
 gi|88699233|gb|EAQ96348.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMG-CoA reductase)
           [Congregibacter litoralis KT71]
          Length = 394

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 115/343 (33%), Positives = 178/343 (51%), Gaps = 13/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G   Q +  VP+AT E  +  S  RG  + +    G+  T++ + M
Sbjct: 57  VQVPIGVAGPLLVNGEHAQGEFYVPMATVEGTMLASYNRGMKV-IREAGGVMTTVVGQAM 115

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
            R+  F   N+  A    Q +     +I  V E T+   +  ++    A N ++ R +++
Sbjct: 116 QRAPCFVFRNSRDARDFEQWLVENFPKIKEVAESTTSVGKLDEIEHYCAHNFVYTRFDYS 175

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA+G NM ++A     +WI   +  L    +SGN  ++K+ +++N +  RGK   AEI
Sbjct: 176 TGDAAGQNMTSRATFVACEWIRENYPALKNYLLSGNFDTEKRTSSVNLLKNRGKRVTAEI 235

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
           TI R + ++ LR +PE  +        I +FL     +A AH AN L A YLATGQD AN
Sbjct: 236 TIPREVLERNLRITPEA-MHYGQGITTIASFLTNSSNNA-AHPANGLAALYLATGQDIAN 293

Query: 249 IVEGSQGLTYAKLHDDSLY-FSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307
           I E +Q  TY ++  +  Y FS T+P +I+   G G N+P  +  L  + C  + K    
Sbjct: 294 IGESNQCTTYNRVTREGDYHFSITLPCVIVASYGGGTNLPTQRECLKMMDCHGQGK---- 349

Query: 308 ARRLAAICAATVLCGELSLLAA-----QTNPGELMEAHLRLER 345
           A +LA I AA V+ GELSL AA     +T   E ++AH RL R
Sbjct: 350 ALKLAEIAAALVVAGELSLGAATRVDKKTRQNEWVDAHERLGR 392


>gi|164656058|ref|XP_001729157.1| hypothetical protein MGL_3624 [Malassezia globosa CBS 7966]
 gi|159103047|gb|EDP41943.1| hypothetical protein MGL_3624 [Malassezia globosa CBS 7966]
          Length = 1144

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 128/347 (36%), Positives = 186/347 (53%), Gaps = 13/347 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GP+ I G +      +P+AT E  L  S  RG  + +    G+   L  
Sbjct: 757  VGYMPLPLGIAGPLVIDGCM----TPIPMATTEGTLVASTSRGCKV-LNANGGVTTVLTQ 811

Query: 66   ERMTRSIFFETENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR    E      A  A + I       EI    + TS+F R   LH+ +AG  L++
Sbjct: 812  DAMTRGPVIEFPTLTSAARAKRWIDSGHGADEIKAAFDSTSRFARLTSLHTVLAGRTLYV 871

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGK 182
            R   +TGDA G NM++K  +A +  +  + +  +   S+SGN C DKK  AIN I GRGK
Sbjct: 872  RFATSTGDAMGMNMISKGVEAALGMMKDKHFPEMELLSLSGNYCIDKKPAAINWIEGRGK 931

Query: 183  NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
            + VAE  I     +  L+ + E ++ LNT+KNL+G+ +AG I   NAH AN+L A Y+AT
Sbjct: 932  SVVAEAVIRGDSVRSILKCTVEDLVRLNTKKNLVGSAMAGSIGGFNAHAANILTAMYIAT 991

Query: 243  GQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI- 299
            GQD A  VE S  +T  +  +D   L  S ++P++ +G VG G  +   ++ L  LG   
Sbjct: 992  GQDPAQNVESSNCMTLMEAVNDGKDLLVSVSMPSVEVGTVGGGTGLAPQRSMLELLGVQG 1051

Query: 300  EERKT-GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              R T G NA+RLA I AA V+ GELSL+ A +  G L++AH+   R
Sbjct: 1052 PNRDTPGANAQRLARIIAAAVMAGELSLMGALSA-GHLIKAHMAHNR 1097


>gi|325092615|gb|EGC45925.1| HMG-CoA reductase [Ajellomyces capsulatus H88]
          Length = 1135

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 183/350 (52%), Gaps = 20/350 (5%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    +  
Sbjct: 752  IGYLPLPLGLAGPLTIDGQ----SYFIPMATTEGVLVASTSRGCK-AINAGGGAITVITG 806

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGN 119
            + MTR   I F T    +A     ++ L   E   V++     TS+F R   + + +AG 
Sbjct: 807  DGMTRGPCIAFPT----LARAGAAKVWLDSEEGQTVMKNAFNSTSRFARLQSMKTALAGT 862

Query: 120  LLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGI 177
             L++R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKK  AIN I
Sbjct: 863  NLYIRFKTTTGDAMGMNMISKGVEKALHIMSTEAGFEDMDTISVSGNYCTDKKPAAINWI 922

Query: 178  MGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA 237
             GRGK  VAE  I   + +  L++  + ++ LN  KNL+G+ +AG I   NAH +N++ A
Sbjct: 923  DGRGKAVVAEAIIPGDVVRSVLKSDVDALVELNISKNLVGSAMAGSIGGFNAHASNIVTA 982

Query: 238  YYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
             +LATGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  +      L  LG
Sbjct: 983  LFLATGQDPAQNVESSNCITMMKNTNGNLQISVSMPSIEVGTIGGGTILETQSAMLEMLG 1042

Query: 298  CIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                  T  GDNARRLA I AA VL GELSL +A    G L++AH+   R
Sbjct: 1043 VRGSHPTNPGDNARRLARIVAAAVLAGELSLCSALA-AGHLVKAHMAHNR 1091


>gi|145614090|ref|XP_364130.2| hypothetical protein MGG_08975 [Magnaporthe oryzae 70-15]
 gi|145021066|gb|EDK05195.1| hypothetical protein MGG_08975 [Magnaporthe oryzae 70-15]
          Length = 1201

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 120/345 (34%), Positives = 180/345 (52%), Gaps = 14/345 (4%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 805  MPLPVGVAGPLVIDGQ----SYFIPMATTEGVLVASASRGCK-AINAGGGAVTVLTGDGM 859

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + FET     A     +  + +A + +    TS+F R   + + IAG  L++R  
Sbjct: 860  TRGPCVGFETLERAGAAKNWLDSDVGQAFMTKAFNSTSRFARLESMKTAIAGTNLYIRFR 919

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ----WSYLHYGSVSGNICSDKKATAINGIMGRGK 182
              TGDA G NM++K  +  +  + +     ++ +   ++SGN CSDKK  AIN I GRGK
Sbjct: 920  TTTGDAMGMNMISKGVEEALRAMAAPDEGGFTDMQILTLSGNYCSDKKPAAINWIEGRGK 979

Query: 183  NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
            + VAE  I   I +  L+   + ++ +N  KNLIG+ +AG +   NAH AN++ A +LAT
Sbjct: 980  SVVAEAIIPGDIVRSVLKIDVDSLVEMNISKNLIGSAMAGAMGGFNAHAANIVAAVFLAT 1039

Query: 243  GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            GQD A +VE +  +T  +    +L  S ++P++ +G +G G  +      L  LG     
Sbjct: 1040 GQDPAQVVESANCITIMRNLRGNLQISVSMPSIEVGTLGGGTILEPQSAMLDLLGVRGSH 1099

Query: 303  KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             T  GDNARRLA I AA VL GELSL +A    G L++AH+   R
Sbjct: 1100 PTTPGDNARRLARIIAAAVLAGELSLCSALAA-GHLVKAHMAHNR 1143


>gi|455459|gb|AAA21720.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Oryza sativa
           Indica Group]
          Length = 509

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 122/346 (35%), Positives = 185/346 (53%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  SV R      L   G  + L+ 
Sbjct: 160 VGYVQLPVGVAGPLLLDGR----EYHVPMATTEGCLVASVNRRVQ-GHLVSGGAFSVLLR 214

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + M+R+  +          L A  E       +A V  ++S+F R   +   +AG  L++
Sbjct: 215 DAMSRAPAVKLPCPMRAAELKAFAEAPANFELLAAVFNRSSRFGRLQDIRCALAGRNLYM 274

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R    TGDA G NMV+K  + V+ ++ + +  +   SVSGN CSDKK TA+N I GRGK+
Sbjct: 275 RFSCITGDAMGMNMVSKGVENVLGYLQNVFPDMDVISVSGNYCSDKKPTAVNWIEGRGKS 334

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+ EK++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 335 VVCEAIIKGDVVQKVLKTTVEKLVELNIIKNLAGSAVAGALGGFNAHASNIVTALFIATG 394

Query: 244 QDAANIVEGSQGLT-YAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE SQ +T   +++D D L+ S T+P++ +G +G G  + +    L  LG    
Sbjct: 395 QDPAQNVESSQCITMLEEVNDGDDLHISVTMPSIEVGTIGGGTCLASQAACLNLLGVKGS 454

Query: 300 EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                G NA RLA I A +V+ G   LLAA  + G L+++H+   R
Sbjct: 455 NHGSPGANAGRLATIVAGSVVAGRALLLAALAS-GHLVKSHMMYNR 499


>gi|225562680|gb|EEH10959.1| HMG-CoA reductase [Ajellomyces capsulatus G186AR]
          Length = 1160

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 183/350 (52%), Gaps = 20/350 (5%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    +  
Sbjct: 777  IGYLPLPLGLAGPLTIDGQ----SYFIPMATTEGVLVASTSRGCK-AINAGGGAITVITG 831

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGN 119
            + MTR   I F T    +A     ++ L   E   V++     TS+F R   + + +AG 
Sbjct: 832  DGMTRGPCIAFPT----LARAGAAKVWLDSEEGQTVMKNAFNSTSRFARLQSMKTALAGT 887

Query: 120  LLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGI 177
             L++R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKK  AIN I
Sbjct: 888  NLYIRFKTTTGDAMGMNMISKGVEKALHVMSTEAGFEDMDTISVSGNYCTDKKPAAINWI 947

Query: 178  MGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA 237
             GRGK  VAE  I   + +  L++  + ++ LN  KNL+G+ +AG I   NAH +N++ A
Sbjct: 948  DGRGKAVVAEAIIPGDVVRSVLKSDVDALVELNISKNLVGSAMAGSIGGFNAHASNIVTA 1007

Query: 238  YYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
             +LATGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  +      L  LG
Sbjct: 1008 LFLATGQDPAQNVESSNCITMMKNTNGNLQISVSMPSIEVGTIGGGTILETQSAMLEMLG 1067

Query: 298  CIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                  T  GDNARRLA I AA VL GELSL +A    G L++AH+   R
Sbjct: 1068 VRGSHPTNPGDNARRLARIVAAAVLAGELSLCSALAA-GHLVKAHMAHNR 1116


>gi|257387548|ref|YP_003177321.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Halomicrobium
           mukohataei DSM 12286]
 gi|257169855|gb|ACV47614.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Halomicrobium
           mukohataei DSM 12286]
          Length = 403

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 121/341 (35%), Positives = 179/341 (52%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +  +PM  +GP+ + G+    +  +PLAT E  L  SV RG   ++    G  A ++ 
Sbjct: 67  IGAAQLPMGVVGPLPVDGSAADGEHYLPLATTEGALVASVNRGVS-TIRRAGGATARVLK 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F  E+   A      +     ++A   E T+       +   + G+ +FLR 
Sbjct: 126 SGMTRAPVFRVEDVAAAGEVSAWVREHVEDLAEAAEATTGHGELQDVTPYVVGDNVFLRF 185

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NM T A +A  + I+ + +     ++SGN+CSDKK  AIN + GRG+   
Sbjct: 186 SYDTKDAMGMNMATIATEAACE-IVERETPAELVALSGNLCSDKKPAAINAVEGRGRTVA 244

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++ I     ++ L T+ E I   NT+KNL+G+  AG +   NAH AN++ A +LATGQD
Sbjct: 245 ADVLIPHEQVEERLGTTTEAIAEANTRKNLVGSAKAGAL-GFNAHAANVVAAAFLATGQD 303

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG-CIEERKT 304
           AA +VEG+  +T     +D LY S T+ +L +G VG G ++P     L  LG        
Sbjct: 304 AAQVVEGANAITTVDAREDGLYASVTLASLEVGTVGGGTSLPTQAEGLDVLGYAGGGDPA 363

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA  LA + AA  L GELSLLAA ++   L  AH  L R
Sbjct: 364 GSNADALAEVIAAGALAGELSLLAALSSR-HLSSAHEDLGR 403


>gi|254569712|ref|XP_002491966.1| One of two isozymes of HMG-CoA reductase that catalyzes the
           conversion of HMG-CoA to mevalonate [Pichia pastoris
           GS115]
 gi|238031763|emb|CAY69686.1| One of two isozymes of HMG-CoA reductase that catalyzes the
           conversion of HMG-CoA to mevalonate [Pichia pastoris
           GS115]
 gi|328351539|emb|CCA37938.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Pichia pastoris CBS 7435]
          Length = 986

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 179/344 (52%), Gaps = 13/344 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G+   L  + M
Sbjct: 624 MPLPVGVAGPLIIDGK----PYHIPMATTEGCLVASTMRGCK-AINSGGGVETVLTADGM 678

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR   + F + +   A     +    +  I      TS+F R   + + +AG LLF+R +
Sbjct: 679 TRGPCVSFPSLSRAGAAKMWLDSEEGQKTIKGAFNSTSRFARLQHVKTTLAGTLLFIRFK 738

Query: 127 FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
             TGDA G NM++K  +  + ++  +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 739 TTTGDAMGMNMISKGVEYSLKFMSEECDWPDMEVISVSGNYCTDKKVAAINWIEGRGKSV 798

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           VAE  I   + +  L++  E ++ LN  KNLIG+ +AG I   NA  AN++ A YLATGQ
Sbjct: 799 VAEARIPADVVRSVLKSDVEALVELNVSKNLIGSAMAGSIGGFNAQAANLVTAVYLATGQ 858

Query: 245 DAANIVEGSQGLTYA-KLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           D A  VE S  +T   KL +  L  S ++P++ +G +G G  +    + L  LG      
Sbjct: 859 DPAQNVESSNCITLMNKLPNGDLQISVSMPSIEVGTIGGGTVLEPQGSMLELLGVKGPHP 918

Query: 304 T--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           T  G N+R+LA I A+ VL  ELSL +A    G L+++H+   R
Sbjct: 919 TNPGANSRQLAKIVASAVLAAELSLCSALAA-GHLVQSHMTHNR 961


>gi|322792961|gb|EFZ16767.1| hypothetical protein SINV_11276 [Solenopsis invicta]
          Length = 681

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 116/345 (33%), Positives = 187/345 (54%), Gaps = 13/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+  +GP+ I G +      VP+AT E  L  S  RG+    L   G+   +  
Sbjct: 338 IGYMPVPIGIVGPLLIDGQLYH----VPMATTEGCLIASTNRGSR--ALLKYGVTTRVTA 391

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR    +  +   A  A+  I   +   E+    +QTS F    +++S+I+G  L L
Sbjct: 392 DGMTREPVVQFPDIVRACEAILWIEQPQNFQELKNSFDQTSHFASLKKIYSRISGRDLHL 451

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
                TGDA G NM+++  +  +  + + +  +   S+SGN+C+DKK   +N I GRGK+
Sbjct: 452 CFVATTGDAMGTNMLSQGTEKSLQTLQTYFPDMEIISLSGNLCTDKKPATVNWIEGRGKS 511

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   +  + L+TS  ++I LN ++NLIG+ L G I   NAH A+++ A ++ATG
Sbjct: 512 VVCEAIIPADLVARVLKTSVPELIKLNNKRNLIGSALTGSIGGFNAHAASIVTAIFIATG 571

Query: 244 QDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER- 302
           QD A  +  S  LT  +     L+ +CT+P++ +G +G    +PA +  L  LG I+ R 
Sbjct: 572 QDPAQNIGSSNCLTLMESWGVDLHMTCTMPSIEIGTIGGDTVLPAHRACLRMLG-IKGRH 630

Query: 303 --KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             + G NA++ A I  ATVL GELSL+ A+    +L+++HLR  R
Sbjct: 631 PIEPGQNAQKFARIVCATVLAGELSLM-AELASEDLIKSHLRHNR 674


>gi|241948603|ref|XP_002417024.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1, putative; HMG-coA
            reductase 1, putative [Candida dubliniensis CD36]
 gi|223640362|emb|CAX44612.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1, putative [Candida
            dubliniensis CD36]
          Length = 1065

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 119/350 (34%), Positives = 182/350 (52%), Gaps = 16/350 (4%)

Query: 11   MPMRWIGPMKITGNVIQDK--VKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            MP+    P+ + G +I D+    +P+AT E  L  S  RG   ++    G+   L  + M
Sbjct: 683  MPL----PVGVAGPLIIDEKPYHIPMATTEGCLVASTMRGCK-AINAGGGVETVLTRDGM 737

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +A I +    TS+F R   + + +AG  LF+R  
Sbjct: 738  TRGPCVRFPTLKRAGAAKLWIDSEQGQATIKKAFNSTSRFARLQHIQTALAGTSLFIRFR 797

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  + +++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 798  TTTGDAMGMNMISKGVEYSLKYMVEECGWDDMEIVSVSGNYCTDKKPAAINWIEGRGKSI 857

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VA   I   +  K L++  + ++ LN  KNL+G+ +AG +   NAH AN++ A YLA GQ
Sbjct: 858  VAAARIPADVVTKVLKSDVDALVELNISKNLVGSAMAGSVGGFNAHAANLVTAVYLACGQ 917

Query: 245  DAANIVEGSQGLTYAKLHDDS--LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            D A  VE S  +T  +   ++  L  S ++P++ +G +G G  +      L  LG     
Sbjct: 918  DPAQNVESSNCITLMEKDKETGDLNVSVSMPSIEVGTIGGGTILEPQGAMLDLLGVRGPH 977

Query: 303  KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLNG 350
             T  G+NAR+LA I A+ VL  ELSL +A    G L+++H++  R    G
Sbjct: 978  PTNPGENARQLAKIVASAVLAAELSLCSALA-AGHLVQSHMQHNRSKAPG 1026


>gi|325969798|ref|YP_004245990.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Vulcanisaeta
           moutnovskia 768-28]
 gi|323709001|gb|ADY02488.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Vulcanisaeta
           moutnovskia 768-28]
          Length = 416

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 127/342 (37%), Positives = 189/342 (55%), Gaps = 6/342 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +  +P+   GP+++ G+       +PLAT E  L  SV RG  I +    G R+ +I+
Sbjct: 72  IGAAQIPVGIAGPLRVIGDYANGLYYIPLATTEGALVASVNRGTKI-VTEAGGARSKVIN 130

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+      +   A+  +  I     EI  V E TS+  + + +   I GN ++LR 
Sbjct: 131 DGMTRAPVIAVPSVIDAVELVNWINEHFNEIKGVAESTSRHAKLVSIQPFIVGNNVWLRF 190

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           +F T DA G NMVT A D  +  ILS +      ++SGN+C DKKA A+N ++GRGK  +
Sbjct: 191 KFTTSDAMGMNMVTIATDKAIKHILSNFPRARLVALSGNMCVDKKANAVNFLLGRGKTVI 250

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           +E  I R+  +++  T+ E +  +N +KNL+G+ LA      NAHFAN++ A ++ATGQD
Sbjct: 251 SETVIPRSTLERWGVTA-EDVAEVNNRKNLLGSALAHSY-GFNAHFANIIAAIFIATGQD 308

Query: 246 AANIVEGSQGLTYAK-LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERK 303
            A +VE S G+T+ + L +  LY S T+P+L +G VG G  +P  +  L  LG       
Sbjct: 309 VAQVVESSMGITWMEPLDNGDLYVSVTLPSLEVGTVGGGTGLPTQRETLQMLGVYGSGNP 368

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G NA R A I AA VL GE++L+ A     EL  AH  L R
Sbjct: 369 PGINALRFAEIVAAAVLSGEVNLILALARD-ELARAHEMLGR 409


>gi|258576019|ref|XP_002542191.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Uncinocarpus reesii
            1704]
 gi|237902457|gb|EEP76858.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Uncinocarpus reesii
            1704]
          Length = 1133

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 117/343 (34%), Positives = 179/343 (52%), Gaps = 12/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ + G        +P+AT E  L  S  RG   ++    G    +  + M
Sbjct: 774  LPLPLGVAGPLTVDGQ----SYFIPMATTEGVLVASTSRGCK-AINAGGGASTVVTGDGM 828

Query: 69   TRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR       +   A  A   I  ++ +  +      TS+F R   + + +AG  L++R +
Sbjct: 829  TRGPCVGFPSLARAGAAKVWIDSEEGQTVMKNAFNSTSRFARLQHMKTALAGTYLYIRFK 888

Query: 127  FATGDASGHNMVTKAADAVMDWILSQWSYLHYG--SVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  +  + ++  +      SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 889  TTTGDAMGMNMISKGVEKALHVMKTEAGFDDMATISVSGNFCTDKKPAAINWIDGRGKSV 948

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I   + +  L+++ + ++ LN  KNLIG+ +AG +   NAH +N++ A +LATGQ
Sbjct: 949  VAEAIIPGDVVKNVLKSNVDALVELNISKNLIGSAMAGSVGGFNAHASNIVTALFLATGQ 1008

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  D +L+ S ++P++ +G +G G  + A    L  LG      T
Sbjct: 1009 DPAQNVESSNCITIMKNVDGNLHISVSMPSIEVGTIGGGTILEAQSAMLDILGVRGPHPT 1068

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNAR LA I  A VL GELSL +A    G L++AH+   R
Sbjct: 1069 NPGDNARHLARIVGAAVLAGELSLCSALAA-GHLVQAHMAHNR 1110


>gi|254514725|ref|ZP_05126786.1| Hydroxymethylglutaryl-coenzyme A reductase [gamma proteobacterium
           NOR5-3]
 gi|219676968|gb|EED33333.1| Hydroxymethylglutaryl-coenzyme A reductase [gamma proteobacterium
           NOR5-3]
          Length = 394

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 114/343 (33%), Positives = 178/343 (51%), Gaps = 13/343 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G   + +  VP+AT E  +  S  RG  + +    G+  T++ + M
Sbjct: 57  VQVPIGLAGPLLVNGEHAKGEFYVPMATVEGTMLASYNRGMKV-IRESGGVLTTVVGQAM 115

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
            R+  F   N+  A    Q +     +I  V E T+   +  ++    A N ++ R +++
Sbjct: 116 QRAPCFVFRNSRDARDFEQWLVENFPQIKTVAESTTSIGKLDEIEHYCAHNFVYTRFDYS 175

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA+G NM ++A     +WI   +  L    +SGN  ++K+ +++N +  RGK   AEI
Sbjct: 176 TGDAAGQNMTSRATFVACEWIRENYPALKNYLLSGNFDTEKRTSSVNLLKNRGKRVTAEI 235

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
           T+ R + ++ LR +PE  +        I +FL     +A AH AN L A YLATGQD AN
Sbjct: 236 TVPREVLERNLRITPEA-MHYGQGITTIASFLTNSSNNA-AHPANGLAALYLATGQDIAN 293

Query: 249 IVEGSQGLTYAKLHDDSLY-FSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307
           I E +Q  TY ++  +  Y FS T+P LI+   G G N+P  +  L  + C  + K    
Sbjct: 294 IGESNQCTTYNRVTREGDYHFSITLPALIVASYGGGTNLPTQRECLKIMDCHGQGK---- 349

Query: 308 ARRLAAICAATVLCGELSLLAA-----QTNPGELMEAHLRLER 345
           A +LA I AA V+ GELSL AA     +T   E ++AH RL R
Sbjct: 350 ALKLAEIAAALVVAGELSLGAATRVDKKTRQNEWVDAHERLGR 392


>gi|83772698|dbj|BAE62826.1| unnamed protein product [Aspergillus oryzae]
          Length = 599

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 117/347 (33%), Positives = 184/347 (53%), Gaps = 20/347 (5%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  + M
Sbjct: 236 LPLPLGVAGPLTIDGQ----SYFIPMATTEGVLVASASRGAK-AINAGGGAVTVLTGDGM 290

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
           TR   + F T    +A  A  ++ +   E   +++     TS+F R   + + +AG  L+
Sbjct: 291 TRGPCVGFPT----LARAAAAKVWIDSEEGQSIMKAAFNSTSRFARLQTMKTALAGTYLY 346

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSV--SGNICSDKKATAINGIMGR 180
           +R +  TGDA G NM++K  +  +  + ++  +    ++  SGN C+DKK+ A+N I GR
Sbjct: 347 IRFKTTTGDAMGMNMISKGVEKALHVMSTECGFDDMATITISGNFCTDKKSAALNWIDGR 406

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ VAE  I   + +  L+++ + ++ LNT KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 407 GKSVVAEAIIPGDVVKSVLKSNVDALVELNTSKNLIGSAMAGSLGGFNAHASNIVTAIFL 466

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           ATGQD A  VE S  +T  +  +  L  S ++P++ +G +G G  +      L  LG   
Sbjct: 467 ATGQDPAQNVESSSCITTMRNLNGDLQISVSMPSIEVGTIGGGTILEGQSAMLDLLGVRG 526

Query: 301 ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  GDNAR+LA I AA  L GELSL +A    G L+ AH+   R
Sbjct: 527 SHPTNPGDNARQLARIVAAATLAGELSLCSALA-AGHLVRAHMAHNR 572


>gi|262164917|ref|ZP_06032655.1| hydroxymethylglutaryl-CoA reductase [Vibrio mimicus VM223]
 gi|262403770|ref|ZP_06080328.1| hydroxymethylglutaryl-CoA reductase [Vibrio sp. RC586]
 gi|262027297|gb|EEY45964.1| hydroxymethylglutaryl-CoA reductase [Vibrio mimicus VM223]
 gi|262350274|gb|EEY99409.1| hydroxymethylglutaryl-CoA reductase [Vibrio sp. RC586]
          Length = 417

 Score =  169 bits (428), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 119/342 (34%), Positives = 186/342 (54%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A LI+
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLIN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++ILS        + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFILSHSPVTPTQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PEK++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 TAEVHLSSELVKKYLHTTPEKMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+ +  L+ +G   +  
Sbjct: 321 DAACVAESAIGMTRMEIHPKGGLYASVTLPNLMVGTVGGGTSLPSQQACLSLMGLAGQ-- 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 379 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|90959868|dbj|BAE92731.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Gentiana lutea]
          Length = 534

 Score =  169 bits (427), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 168/323 (52%), Gaps = 11/323 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++L   G  + L+ 
Sbjct: 200 VGYVQLPVGIAGPLFLDGR----EYMVPMATTEGCLVASTNRGCK-AILASGGATSVLLR 254

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + +TR+  + F        L    E  +    +A +  ++S+F +   +   IAG  L++
Sbjct: 255 DGITRAPVVRFGMAKRAAELKFFMEDPINFETVAVIFNKSSRFAKLQNIQCAIAGKNLYM 314

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NMV+K    V+D++LS +  +    +SGN C+DKK  AIN I GRGK+
Sbjct: 315 RFRCSTGDAMGMNMVSKGVQNVLDFLLSDFPDMEVIGISGNFCADKKPAAINWIEGRGKS 374

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I     +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATG
Sbjct: 375 VVCEAIIKEETVKKVLKTEVAALVELNMLKNLTGSAMAGSLGGFNAHASNIVSAVYIATG 434

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
           QD A  VE S  +T  +  +D   L+ S T+P + +G VG G  + +    L  LG    
Sbjct: 435 QDPAQNVESSHCITMMEPVNDGKDLHISVTMPCIEVGTVGGGTQLASQAACLNLLGVKGA 494

Query: 300 EERKTGDNARRLAAICAATVLCG 322
            +   G NAR LA I A +VL G
Sbjct: 495 SKESAGANARLLATIVAGSVLLG 517


>gi|262173936|ref|ZP_06041613.1| hydroxymethylglutaryl-CoA reductase [Vibrio mimicus MB-451]
 gi|261891294|gb|EEY37281.1| hydroxymethylglutaryl-CoA reductase [Vibrio mimicus MB-451]
          Length = 417

 Score =  169 bits (427), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 119/342 (34%), Positives = 186/342 (54%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A LI+
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLIN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++ILS        + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFILSHSPVTPTQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PEK++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 TAEVHLSTELVKKYLHTTPEKMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+ +  L+ +G   +  
Sbjct: 321 DAACVAESAIGMTRMEIHPKGGLYASVTLPNLMVGTVGGGTSLPSQQACLSLMGLAGQ-- 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 379 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|258623642|ref|ZP_05718632.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio mimicus VM573]
 gi|258584077|gb|EEW08836.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio mimicus VM573]
          Length = 417

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/342 (34%), Positives = 186/342 (54%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A LI+
Sbjct: 84  IGTVKLPVGIAGPLRVKGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLIN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++ILS        + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFILSHSPVTPTQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PEK++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 TAEVHLSAELVKKYLHTTPEKMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+ +  L+ +G   +  
Sbjct: 321 DAACVAESAIGMTRMEIHPKGGLYASVTLPNLMVGTVGGGTSLPSQQACLSLMGLAGQ-- 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 379 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|76801854|ref|YP_326862.1| hydroxymethylglutaryl-CoA reductase (NADPH) 1 [Natronomonas
           pharaonis DSM 2160]
 gi|76557719|emb|CAI49302.1| hydroxymethylglutaryl-CoA reductase (NADPH) 1 [Natronomonas
           pharaonis DSM 2160]
          Length = 402

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 175/344 (50%), Gaps = 11/344 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V +  +PM  +GP+ + G+ I  +  +PLAT E  L  SV RG   SM    G  A ++ 
Sbjct: 66  VGAAQVPMGVVGPLAVDGDAIDGEPYLPLATTEGALVASVNRGCA-SMTAAGGATARVLK 124

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F       A      +      +A   E T+       +   + G+ +FLR 
Sbjct: 125 NAMTRAPVFRVAGVAEASETAAWVRDNVESLASAAEATTSHGELRDVTPYVVGDNVFLRF 184

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NM T A +A  + + ++ +     ++SGN+CSDKK  A+N + GRG+   
Sbjct: 185 AYDTKDAMGMNMATIATEAACEVVEAE-TPAELVALSGNLCSDKKPAAVNSVEGRGRTVA 243

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++ +  ++ ++Y  T+P  I   NT+KNL+G+  AG +   NAH AN + A +LATGQD
Sbjct: 244 ADVVLPGSVVEEYFGTTPAAIAEANTRKNLVGSAKAGSL-GFNAHAANTVAAAFLATGQD 302

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTG 305
            A +VEG+  +T A + D  LY S T+ +L +G VG G  +P     L  +G    R  G
Sbjct: 303 IAQVVEGANAITTADVRDGDLYASLTLASLEVGTVGGGTKLPTQAEALDVVGV---RGGG 359

Query: 306 D----NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           D    NA  LA   A   L GELSLL A  +   L  AH  L R
Sbjct: 360 DPAGSNADALAEAIATAALGGELSLLGALAS-NHLASAHEELGR 402


>gi|209809064|ref|YP_002264602.1| putative 3-hydroxy-3-methylglutaryl coenzyme a reductase
           [Aliivibrio salmonicida LFI1238]
 gi|208010626|emb|CAQ81007.1| putative 3-hydroxy-3-methylglutaryl coenzyme a reductase
           [Aliivibrio salmonicida LFI1238]
          Length = 419

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 123/347 (35%), Positives = 187/347 (53%), Gaps = 20/347 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G   +    VPLAT E  L  S  RGA +   C  G  A L++
Sbjct: 86  IGTVKIPVGLAGPLRVNGLFAKGDYLVPLATTEAALVASYNRGAQLITAC-GGASAMLLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   N   A   +     +     ++ E T+   +   ++  I GN ++L  
Sbjct: 145 EGVTRTPAFAFYNLAEAGQFVTWAVTQYDTFKQLAEATTSHGKLSDINISIEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWIL------SQWSYLHYGSVSGNICSDKKATAINGIMG 179
           EF TGDASG NMVT A +A+ ++I+      S+ +YL      GN+  DKKA++ +    
Sbjct: 205 EFLTGDASGQNMVTIATNAIFNYIIDNSPIASENAYL-----DGNLSGDKKASSQSLRSV 259

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
           RGK   AE+ +   + +KYL T+PEK++   TQ + +G  L+G I   NAH+AN L A Y
Sbjct: 260 RGKKVTAEVHVPAELVKKYLHTTPEKMMQF-TQMSTVGATLSGTI-GINAHYANALAALY 317

Query: 240 LATGQDAANIVEGSQGLTYAKLH-DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           +A GQDAA + E + G+T  +++ D  LY S T+PNL+LG VG G  +P+ K  L  +G 
Sbjct: 318 IACGQDAACVAESAVGMTRIEVNRDGGLYASVTLPNLMLGTVGGGTGLPSQKACLELMGL 377

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               K+    + LA +CA   L GELS++ A    G    AH +L R
Sbjct: 378 YGSGKS----QALAEVCATLCLAGELSIVGAFC-AGHFSRAHHKLAR 419


>gi|238499573|ref|XP_002381021.1| HMG-CoA reductase [Aspergillus flavus NRRL3357]
 gi|220692774|gb|EED49120.1| HMG-CoA reductase [Aspergillus flavus NRRL3357]
          Length = 1125

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 117/347 (33%), Positives = 184/347 (53%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  + M
Sbjct: 762  LPLPLGVAGPLTIDGQ----SYFIPMATTEGVLVASASRGAK-AINAGGGAVTVLTGDGM 816

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A  A  ++ +   E   +++     TS+F R   + + +AG  L+
Sbjct: 817  TRGPCVGFPT----LARAAAAKVWIDSEEGQSILKAAFNSTSRFARLQTMKTALAGTYLY 872

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSV--SGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +    ++  SGN C+DKK+ A+N I GR
Sbjct: 873  IRFKTTTGDAMGMNMISKGVEKALHVMSTECGFDDMATITISGNFCTDKKSAALNWIDGR 932

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L+++ + ++ LNT KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 933  GKSVVAEAIIPGDVVKSVLKSNVDALVELNTSKNLIGSAMAGSLGGFNAHASNIVTAIFL 992

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  +  +  L  S ++P++ +G +G G  +      L  LG   
Sbjct: 993  ATGQDPAQNVESSSCITTMRNLNGDLQISVSMPSIEVGTIGGGTILEGQSAMLDLLGVRG 1052

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNAR+LA I AA  L GELSL +A    G L+ AH+   R
Sbjct: 1053 SHPTNPGDNARQLARIVAAATLAGELSLCSALAA-GHLVRAHMAHNR 1098


>gi|317150339|ref|XP_001823959.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aspergillus oryzae
            RIB40]
          Length = 1125

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 117/347 (33%), Positives = 184/347 (53%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RGA  ++    G    L  + M
Sbjct: 762  LPLPLGVAGPLTIDGQ----SYFIPMATTEGVLVASASRGAK-AINAGGGAVTVLTGDGM 816

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A  A  ++ +   E   +++     TS+F R   + + +AG  L+
Sbjct: 817  TRGPCVGFPT----LARAAAAKVWIDSEEGQSIMKAAFNSTSRFARLQTMKTALAGTYLY 872

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSV--SGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +    ++  SGN C+DKK+ A+N I GR
Sbjct: 873  IRFKTTTGDAMGMNMISKGVEKALHVMSTECGFDDMATITISGNFCTDKKSAALNWIDGR 932

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L+++ + ++ LNT KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 933  GKSVVAEAIIPGDVVKSVLKSNVDALVELNTSKNLIGSAMAGSLGGFNAHASNIVTAIFL 992

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  +  +  L  S ++P++ +G +G G  +      L  LG   
Sbjct: 993  ATGQDPAQNVESSSCITTMRNLNGDLQISVSMPSIEVGTIGGGTILEGQSAMLDLLGVRG 1052

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNAR+LA I AA  L GELSL +A    G L+ AH+   R
Sbjct: 1053 SHPTNPGDNARQLARIVAAATLAGELSLCSALAA-GHLVRAHMAHNR 1098


>gi|258623937|ref|ZP_05718890.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio mimicus VM603]
 gi|258583731|gb|EEW08527.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio mimicus VM603]
          Length = 417

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/342 (34%), Positives = 186/342 (54%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A LI+
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLIN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++ILS        + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFILSHSPVTPTQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PEK++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 TAEVHLSTELVKKYLHTTPEKMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+ +  L+ +G   +  
Sbjct: 321 DAACVAESAIGMTRMEIHPKGGLYASVTLPNLMVGTVGGGTSLPSQQACLSLMGLAGK-- 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 379 --GHARALAEVAAALCLAGELSIVGAFCV-GHFSRAHHKLAR 417


>gi|261196964|ref|XP_002624885.1| HMG-CoA reductase [Ajellomyces dermatitidis SLH14081]
 gi|239596130|gb|EEQ78711.1| HMG-CoA reductase [Ajellomyces dermatitidis SLH14081]
          Length = 1149

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 181/347 (52%), Gaps = 20/347 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    +  + M
Sbjct: 776  LPLPLGLAGPLTIDGQ----SYFIPMATTEGVLVASTSRGCK-AINAGGGAITVITGDGM 830

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A     ++ L   E   V++     TS+F R   + + +AG  L+
Sbjct: 831  TRGPCVAFPT----LARAGAAKVWLDSEEGQTVMKNAFNSTSRFARLQSMKTAMAGTNLY 886

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKK  AIN I GR
Sbjct: 887  IRFKTTTGDAMGMNMISKGVEKALHVMSTEAGFEDMDTISVSGNYCTDKKPAAINWIDGR 946

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK  VAE  I   + +  L++  + ++ LN  KNL+G+ +AG I   NAH +N++ A ++
Sbjct: 947  GKAVVAEAIIPGDVVRSVLKSDVDALVELNISKNLVGSAMAGSIGGFNAHASNIVTALFI 1006

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  +      L  LG   
Sbjct: 1007 ATGQDPAQNVESSNCITMMKNVNGNLQISVSMPSIEVGTIGGGTILETQSAMLELLGVRG 1066

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               T  GDNARRLA I AA VL GELSL  A    G L++AH+   R
Sbjct: 1067 PHPTNPGDNARRLARIVAAAVLAGELSLCGALAA-GHLVKAHMAHNR 1112


>gi|149243751|ref|XP_001526520.1| hypothetical protein LELG_01348 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146448914|gb|EDK43170.1| hypothetical protein LELG_01348 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 940

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 116/345 (33%), Positives = 177/345 (51%), Gaps = 11/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ I G     +  +P+AT E  L  S  RG     L   G++  L  
Sbjct: 592 IGYMPLPVGVAGPLVIDGK----EYFLPMATTEGCLVASTMRGCKAINLG-GGVQTVLTK 646

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR   + F T           +    +A +      TS+F R   + + +AG LL++
Sbjct: 647 DGMTRGPCVRFPTLKIAGEAKVWMDSEEGQASMKEAFNSTSRFARLQHIQTALAGTLLYV 706

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           R    TGDA G NM++K  +  +  +  + +  +   SVSGN C+DKK+ AIN I GRGK
Sbjct: 707 RFRTTTGDAMGMNMISKGVEHTLKQLKEERFPDMEVVSVSGNYCTDKKSAAINWINGRGK 766

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + VAE  I   +  + L+   + ++ +N  KNLIG+ LAG I   NAH AN++ A +LA 
Sbjct: 767 SVVAEARIPEQVISQVLKCDVDSLVEVNVSKNLIGSALAGSIGGFNAHAANLVAALFLAL 826

Query: 243 GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           GQD A +VEGS  LT        L  S ++P + +G +G G  +    + L  LG     
Sbjct: 827 GQDPAQVVEGSNCLTLIDRVGTELVISVSMPCIEVGTIGGGTILDPQGSMLDLLGLRGPH 886

Query: 303 KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            T  G NA++LA + A+ VL  ELSL++A    G L++ H++  R
Sbjct: 887 PTNPGQNAQQLAKVVASAVLAAELSLISALA-AGHLVQLHMQHNR 930


>gi|213408158|ref|XP_002174850.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Schizosaccharomyces
            japonicus yFS275]
 gi|212002897|gb|EEB08557.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Schizosaccharomyces
            japonicus yFS275]
          Length = 1054

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 184/351 (52%), Gaps = 20/351 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +PLAT E  L  S  RG   ++    G    L  + M
Sbjct: 685  MPLPLGVAGPLIIDG----KSYYIPLATTEGALVASAMRGCK-AINAGGGATTILTRDEM 739

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
             R   I F T    ++     ++ L   E   V++     TS+F R   L + +AG  L+
Sbjct: 740  ARGPCITFPT----LSRAGFAKMWLDSPEGQEVVKNAFNSTSRFARLQHLKTALAGTRLY 795

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R   +TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKK  AIN I GR
Sbjct: 796  VRFCTSTGDAMGMNMISKGVEHALAVMCNEAGFEDMKVVSVSGNYCTDKKPAAINWIEGR 855

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  +     +  L+T+ + ++ LN  KNLIG+ +AG +   NAH AN++ A +L
Sbjct: 856  GKSVVAEAIVPAKAVESILKTTVDDLVQLNINKNLIGSAMAGCVGGFNAHAANLVTAIFL 915

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T     + +L  S ++P++ +G +G G  +      L  LG   
Sbjct: 916  ATGQDPAQNVESSNCITLMDNVNGNLRISVSMPSIEVGTIGGGTVLEPQAAMLDLLGVRG 975

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
               T  G NAR+LA I AA V+ GELSL +A  + G L+++H+ L R  LN
Sbjct: 976  PHPTNPGSNARQLARIVAAGVMAGELSLCSALAS-GHLVKSHIGLNRSALN 1025


>gi|169613398|ref|XP_001800116.1| hypothetical protein SNOG_09830 [Phaeosphaeria nodorum SN15]
 gi|160702716|gb|EAT83095.2| hypothetical protein SNOG_09830 [Phaeosphaeria nodorum SN15]
          Length = 1112

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 118/349 (33%), Positives = 182/349 (52%), Gaps = 12/349 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GP+ + G        +P+AT E  L  S  RGA  ++    G    +  
Sbjct: 738  VGYLPLPLGVAGPILVDGQ----NYFLPMATTEGVLVASTSRGAK-AINAGGGAITVVTG 792

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   I F++     A     +    +  +      TS+F R   + S IAG  +++
Sbjct: 793  DGMTRGPCIGFDSLTRAGAAKNWLDSDEGQKTMKDAFNSTSRFARLRSMKSAIAGTNIYV 852

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +  ++ + +   +  +   +VSGN C+DKKA AIN I GRG
Sbjct: 853  RFRATTGDAMGMNMISKGVEHALNVMANDCGFDDMRVVTVSGNYCTDKKAAAINWIDGRG 912

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K  VAE TI   +    L+   E ++ +N  KNLIG+ +AG +   NAH AN++ A +LA
Sbjct: 913  KGVVAEATIPGKVVNSVLKCEVEDLVQMNISKNLIGSAMAGAMGGFNAHAANIVAAIFLA 972

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A +VE +  +T     + +L  S ++P++ +G +G G  +      L  LG    
Sbjct: 973  TGQDPAQVVESANCITIMNNVNGNLQISVSMPSIEVGTIGGGTILEPQSAMLDLLGVRGA 1032

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHL 348
             +T  GDNAR+LA + AA VL GELSL +A    G L++AH+   R ++
Sbjct: 1033 HQTSPGDNARQLARVIAAGVLAGELSLNSALCA-GHLVKAHMAHNRSNV 1080


>gi|15790771|ref|NP_280595.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Halobacterium sp.
           NRC-1]
 gi|169236514|ref|YP_001689714.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Halobacterium
           salinarum R1]
 gi|10581320|gb|AAG20075.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Halobacterium sp.
           NRC-1]
 gi|167727580|emb|CAP14368.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Halobacterium
           salinarum R1]
          Length = 405

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 122/343 (35%), Positives = 179/343 (52%), Gaps = 19/343 (5%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ ++G     +  +P+AT E  L  SV RG   ++    G  A +    MTR
Sbjct: 74  LPLGVAGPVALSGGAADGEYYLPMATTEGALVASVNRGCS-AITAAGGANARVTKTGMTR 132

Query: 71  SIFFE----TENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           +  F     TE AE+A    Q        +A   E T+       +   + G+ ++LR  
Sbjct: 133 APVFRVADVTEGAEVA----QWADDNTDALAAAAESTTSHGELTDVTPYVVGDNVYLRFR 188

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
           + T DA G NM T A +A  + +  + +     +VSGN+C+DKK  AIN + GRG+   A
Sbjct: 189 YDTKDAMGMNMATIATEAASELVEDE-TPAELVAVSGNLCTDKKPAAINAVEGRGRTVTA 247

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           ++TI + + ++   T+P  I   NT+KNLIG+  AG +   NAH AN++ A +LATGQDA
Sbjct: 248 DVTIPQDVVEERFDTTPAAIEEANTRKNLIGSAKAGSL-GFNAHAANVVAAVFLATGQDA 306

Query: 247 ANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGD 306
           A +VEG+  +T  +  DD+LY S  + +L +G VG G  +P  +  L  LG    R  GD
Sbjct: 307 AQVVEGANAITTVEARDDALYASVNLASLEVGTVGGGTTLPTQREALDVLGV---RGGGD 363

Query: 307 ----NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               NA  LA I A   L GE++LLAA  +   L  AH  L R
Sbjct: 364 PAGANADALAEIIAVGALAGEINLLAALASR-RLSAAHADLGR 405


>gi|52790405|gb|AAU87798.1| HMGR [Salvia miltiorrhiza]
          Length = 267

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 151/257 (58%), Gaps = 5/257 (1%)

Query: 93  KAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQ 152
           +  ++ V   +S+F R  ++   IAG  L++R   +TGDA G NMV+K    V+D++++Q
Sbjct: 2   RESLSLVFNSSSRFGRLQKIKCAIAGKNLYMRFTCSTGDAMGMNMVSKGVQNVLDFLVNQ 61

Query: 153 WSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQ 212
           +  +    +SGN CSDKK  A+N I GRGK+ V E  I   +  K L+T+   ++ LN  
Sbjct: 62  FPDMDVLGISGNYCSDKKPAAVNWIEGRGKSVVCEAVIKEEVVHKVLKTNVAALVELNML 121

Query: 213 KNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHD--DSLYFSC 270
           KNL G+ +AG +   NAH +N++ A Y+ATGQD A  VE S  +T  +  +    L+ S 
Sbjct: 122 KNLTGSAIAGALGGFNAHASNIVSAVYIATGQDPAQNVESSHCITMMEAVNGGKDLHVSV 181

Query: 271 TIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAAICAATVLCGELSLLA 328
           ++P++ +G VG G  + +    L  LG     K   G N+R LA I AA+VL GELSL++
Sbjct: 182 SMPSIEVGTVGGGTQLASQSACLNLLGVKGASKEVPGANSRLLATIVAASVLAGELSLMS 241

Query: 329 AQTNPGELMEAHLRLER 345
           A    G+L+++H++  R
Sbjct: 242 A-IAAGQLVKSHMKYNR 257


>gi|261212481|ref|ZP_05926766.1| hydroxymethylglutaryl-CoA reductase [Vibrio sp. RC341]
 gi|260838412|gb|EEX65068.1| hydroxymethylglutaryl-CoA reductase [Vibrio sp. RC341]
          Length = 422

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 187/348 (53%), Gaps = 22/348 (6%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A LI+
Sbjct: 89  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLIN 147

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 148 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 207

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVS-------GNICSDKKATAINGIM 178
           E+ TGDASG NMVT A  AV ++I      LH+  V+       GN+  DKKA +     
Sbjct: 208 EYTTGDASGQNMVTIATHAVFEFI------LHHSPVTPTQAFLDGNLSGDKKANSYTLRS 261

Query: 179 GRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAY 238
            RGK   AE+ ++  + +KYL T+PEK++    Q   +G  L+G I   NAH+AN L A 
Sbjct: 262 VRGKKVTAEVHLSTELVKKYLHTTPEKMVQFG-QMTTVGGALSGAI-GVNAHYANALAAL 319

Query: 239 YLATGQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
           Y+A GQDAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+ +  L+ +G
Sbjct: 320 YIACGQDAACVAESAIGMTRMEIHPKGGLYASVTLPNLMVGTVGGGTSLPSQQACLSLMG 379

Query: 298 CIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +     +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 380 LAGQ----GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 422


>gi|239609717|gb|EEQ86704.1| HMG-CoA reductase [Ajellomyces dermatitidis ER-3]
          Length = 1135

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 180/343 (52%), Gaps = 20/343 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    +  + M
Sbjct: 762  LPLPLGLAGPLTIDGQ----SYFIPMATTEGVLVASTSRGCK-AINAGGGAITVITGDGM 816

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A     ++ L   E   V++     TS+F R   + + +AG  L+
Sbjct: 817  TRGPCVAFPT----LARAGAAKVWLDSEEGQTVMKNAFNSTSRFARLQSMKTAMAGTNLY 872

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKK  AIN I GR
Sbjct: 873  IRFKTTTGDAMGMNMISKGVEKALHVMSTEAGFEDMDTISVSGNYCTDKKPAAINWIDGR 932

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK  VAE  I   + +  L++  + ++ LN  KNL+G+ +AG I   NAH +N++ A ++
Sbjct: 933  GKAVVAEAIIPGDVVRSVLKSDVDALVELNISKNLVGSAMAGSIGGFNAHASNIVTALFI 992

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  +      L  LG   
Sbjct: 993  ATGQDPAQNVESSNCITMMKNVNGNLQISVSMPSIEVGTIGGGTILETQSAMLELLGVRG 1052

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHL 341
               T  GDNARRLA I AA VL GELSL  A    G L++AH+
Sbjct: 1053 PHPTNPGDNARRLARIVAAAVLAGELSLCGALAA-GHLVKAHM 1094


>gi|327355377|gb|EGE84234.1| HMG-CoA reductase [Ajellomyces dermatitidis ATCC 18188]
          Length = 1152

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 119/343 (34%), Positives = 180/343 (52%), Gaps = 20/343 (5%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    +  + M
Sbjct: 779  LPLPLGLAGPLTIDGQ----SYFIPMATTEGVLVASTSRGCK-AINAGGGAITVITGDGM 833

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIE----QTSQFTRFLQLHSQIAGNLLF 122
            TR   + F T    +A     ++ L   E   V++     TS+F R   + + +AG  L+
Sbjct: 834  TRGPCVAFPT----LARAGAAKVWLDSEEGQTVMKNAFNSTSRFARLQSMKTAMAGTNLY 889

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKK  AIN I GR
Sbjct: 890  IRFKTTTGDAMGMNMISKGVEKALHVMSTEAGFEDMDTISVSGNYCTDKKPAAINWIDGR 949

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK  VAE  I   + +  L++  + ++ LN  KNL+G+ +AG I   NAH +N++ A ++
Sbjct: 950  GKAVVAEAIIPGDVVRSVLKSDVDALVELNISKNLVGSAMAGSIGGFNAHASNIVTALFI 1009

Query: 241  ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            ATGQD A  VE S  +T  K  + +L  S ++P++ +G +G G  +      L  LG   
Sbjct: 1010 ATGQDPAQNVESSNCITMMKNVNGNLQISVSMPSIEVGTIGGGTILETQSAMLELLGVRG 1069

Query: 301  ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHL 341
               T  GDNARRLA I AA VL GELSL  A    G L++AH+
Sbjct: 1070 PHPTNPGDNARRLARIVAAAVLAGELSLCGALAA-GHLVKAHM 1111


>gi|323497305|ref|ZP_08102324.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio sinaloensis
           DSM 21326]
 gi|323317662|gb|EGA70654.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio sinaloensis
           DSM 21326]
          Length = 419

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 113/326 (34%), Positives = 174/326 (53%), Gaps = 9/326 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G   ++   VPLAT E  L  S  RGA + +    G  A L++
Sbjct: 86  IGTVKLPVGLAGPLRVNGLHAKEDYLVPLATTEAALVASYNRGAQL-ITAAGGASAMLLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   N   A   +  +  +     +V E T+   +   ++  + GN ++L  
Sbjct: 145 EGVTRTPVFAFSNLAQAGQFVAWVVTQYDHFKQVAESTTSHGKLHDININVEGNRVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           EF TGDASG NMVT A + V  +IL     +   S + GN+  DKK  A      RGK  
Sbjct: 205 EFHTGDASGQNMVTIATNEVYHYILEHSPVVPKTSFLDGNLSGDKKPNAHTLRHVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ + R + +KYL T+PE+++    Q    G  L+GGI   NAH+AN L A Y+A GQ
Sbjct: 265 TAEVILKRELVEKYLHTTPEQMVEFG-QMTTTGAALSGGI-GVNAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSC-TIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L D    ++C T+PN+++G VG G  +P+ K  L  +G     K
Sbjct: 323 DAACVSESAVGITRMELTDKGALYACVTLPNIMVGTVGGGTGLPSQKACLDIMGLFGNGK 382

Query: 304 TGDNARRLAAICAATVLCGELSLLAA 329
               A+ LA + A+  L GELS++ A
Sbjct: 383 ----AKALAEVAASICLAGELSIVGA 404


>gi|68484739|ref|XP_713681.1| hypothetical protein CaO19.8633 [Candida albicans SC5314]
 gi|68484830|ref|XP_713636.1| hypothetical protein CaO19.1031 [Candida albicans SC5314]
 gi|46435143|gb|EAK94531.1| hypothetical protein CaO19.1031 [Candida albicans SC5314]
 gi|46435190|gb|EAK94577.1| hypothetical protein CaO19.8633 [Candida albicans SC5314]
          Length = 1073

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 117/345 (33%), Positives = 180/345 (52%), Gaps = 16/345 (4%)

Query: 11   MPMRWIGPMKITGNVIQDK--VKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            MP+    P+ + G +I D+    +P+AT E  L  S  RG   ++    G+   L  + M
Sbjct: 689  MPL----PVGVAGPLIIDEKPYHIPMATTEGCLVASTMRGCK-AINAGGGVETVLTRDGM 743

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +A I +    TS+F R   + + +AG  LF+R  
Sbjct: 744  TRGPCVRFPTLKRAGAAKLWIDSEQGQATIKKAFNSTSRFARLQHIQTALAGTSLFIRFR 803

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  + +++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 804  TTTGDAMGMNMISKGVEYSLKYMVEECGWDDMEIVSVSGNYCTDKKPAAINWIEGRGKSI 863

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VA   I   +  K L++  + ++ LN  KNL+G+ +AG +   NAH AN++ A YLA GQ
Sbjct: 864  VAAARIPADVVTKVLKSDVDALVELNISKNLVGSAMAGSVGGFNAHAANLVTAVYLACGQ 923

Query: 245  DAANIVEGSQGLTYAKLHDDS--LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            D A  VE S  +T  +   ++  L  S ++P++ +G +G G  +      L  LG     
Sbjct: 924  DPAQNVESSNCITLMEKDKETGDLNVSVSMPSIEVGTIGGGTILEPQGAMLDLLGVRGPH 983

Query: 303  KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             T  G NA++LA I A+ VL  ELSL +A    G L+++H++  R
Sbjct: 984  PTNPGANAQQLAKIVASAVLAAELSLCSALA-AGHLVQSHMQHNR 1027


>gi|238879153|gb|EEQ42791.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Candida albicans
            WO-1]
          Length = 1071

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 117/345 (33%), Positives = 180/345 (52%), Gaps = 16/345 (4%)

Query: 11   MPMRWIGPMKITGNVIQDK--VKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            MP+    P+ + G +I D+    +P+AT E  L  S  RG   ++    G+   L  + M
Sbjct: 689  MPL----PVGVAGPLIIDEKPYHIPMATTEGCLVASTMRGCK-AINAGGGVETVLTRDGM 743

Query: 69   TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR   + F T     A     +    +A I +    TS+F R   + + +AG  LF+R  
Sbjct: 744  TRGPCVRFPTLKRAGAAKLWIDSEQGQATIKKAFNSTSRFARLQHIQTALAGTSLFIRFR 803

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
              TGDA G NM++K  +  + +++ +  W  +   SVSGN C+DKK  AIN I GRGK+ 
Sbjct: 804  TTTGDAMGMNMISKGVEYSLKYMVEECGWDDMEIVSVSGNYCTDKKPAAINWIEGRGKSI 863

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VA   I   +  K L++  + ++ LN  KNL+G+ +AG +   NAH AN++ A YLA GQ
Sbjct: 864  VAAARIPADVVTKVLKSDVDALVELNISKNLVGSAMAGSVGGFNAHAANLVTAVYLACGQ 923

Query: 245  DAANIVEGSQGLTYAKLHDDS--LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            D A  VE S  +T  +   ++  L  S ++P++ +G +G G  +      L  LG     
Sbjct: 924  DPAQNVESSNCITLMEKDKETGDLNVSVSMPSIEVGTIGGGTILEPQGAMLDLLGVRGPH 983

Query: 303  KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             T  G NA++LA I A+ VL  ELSL +A    G L+++H++  R
Sbjct: 984  PTNPGANAQQLAKIVASAVLAAELSLCSALA-AGHLVQSHMQHNR 1027


>gi|149190209|ref|ZP_01868484.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio shilonii
           AK1]
 gi|148835956|gb|EDL52918.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio shilonii
           AK1]
          Length = 419

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 122/342 (35%), Positives = 183/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ MP+   GP+++ G   Q   +VPLAT E  L  S  RGA++   C  G  A L++
Sbjct: 86  IGTLKMPVGTAGPLRVNGLFAQGDYQVPLATTEAALVASYNRGANLITAC-GGASAMLLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  ++   A   +  +  +     ++ E T+   +   ++  I GN ++L  
Sbjct: 145 EGVTRTPGFAFKSLIEAGKFVAWLVTQFDHFKQLAESTTSHGKLSDINVNIEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSY-LHYGSVSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A + V D+I+        Y  + GN+  DKKA +      RGK  
Sbjct: 205 EYLTGDASGQNMVTIATNVVFDYIMMHTPIEPDYAFLDGNLSGDKKANSQTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ I  ++ +KYL T+P K+     Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 TAEVLIPASLVEKYLHTTPTKMAQFG-QMTTVGGALSGTI-GINAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++ D   LY S T+PNL++G VG G  +P+ K  L  LG      
Sbjct: 323 DAACVAESAIGMTRMEVTDAGELYASVTLPNLMVGTVGGGTGLPSQKACLDLLGL---HG 379

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           TG N++ LA + A+  L GELS++ A    G    AH +L R
Sbjct: 380 TG-NSQALAEVAASLCLAGELSIVGAFC-AGHFSNAHHKLAR 419


>gi|154149686|ref|YP_001403304.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Candidatus
           Methanoregula boonei 6A8]
 gi|153998238|gb|ABS54661.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Methanoregula
           boonei 6A8]
          Length = 426

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 185/344 (53%), Gaps = 11/344 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ I G   +    +PLAT E  L  SV RGA  ++    G    ++ 
Sbjct: 86  IGTVQVPVGVAGPLAINGEYAKGLFWLPLATTEGALIASVNRGAG-AITKAGGAEVRILH 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F  ++   A            ++A +   T+   +   L + + G  +F+RL
Sbjct: 145 DGMTRAPVFAAKSVGHAKEIADWAEAHFDDLAAIAATTTNHGKMTGLVTFVTGTSVFIRL 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           EF T DA G NMVT A   + D I +Q +     ++SGN+CSDKK  AINGIMGRG++ V
Sbjct: 205 EFDTKDAMGMNMVTIAGAKIADEI-AQATGARLIALSGNMCSDKKPAAINGIMGRGRSVV 263

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A + ++     K L+T    ++ +N +KNL+G+  AG +   NAH AN++ A ++A GQD
Sbjct: 264 AGVALSHEQIAKILKTDAATMVEVNYRKNLVGSARAGAM-GFNAHAANVVAAMFIACGQD 322

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-EERKT 304
           AA+ ++GS  +T     +  +Y + T+P+L +G VG G ++   +  L  LG        
Sbjct: 323 AAHAIDGSTCMTTIDATESGVYVAVTLPSLPVGTVGGGTSVDTQQECLKILGVAGGGSPA 382

Query: 305 GDNARRLAAICAATVLCGELSL---LAAQTNPGELMEAHLRLER 345
           G NAR+LA I AA VL GELSL   LAAQ     L  AH  L R
Sbjct: 383 GANARKLAEIIAAGVLAGELSLIGALAAQ----HLARAHQELGR 422


>gi|134058328|emb|CAK38517.1| unnamed protein product [Aspergillus niger]
          Length = 674

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 184/357 (51%), Gaps = 35/357 (9%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAH--------ISMLCPD 57
           V  + +P+ + GP+ I G        +P+AT E  L  S  RG+         ++ML  D
Sbjct: 329 VGYMPVPVGFAGPLVIDGR----SYFIPMATTEGVLVASASRGSKAINAGGGAVTMLTAD 384

Query: 58  G------IRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQ 111
           G      +    +D      I+ ++E  +         T++KA        T++F R   
Sbjct: 385 GMTRGPCVSFPTLDRAGAAKIWLDSEEGQ--------TTMQKA-----FNSTTRFGRLQS 431

Query: 112 LHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKK 170
           + + IAG  L++R +  TGDA G NM++K  +  ++ + S  +  +   ++SGN C+DKK
Sbjct: 432 MTTAIAGTNLYIRFKSTTGDAMGMNMISKGVEYALEVMKSAGFEDMKIITLSGNFCADKK 491

Query: 171 ATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAH 230
             AIN I GRGK+ VAE  I   + +  L++  + ++ L   KN+IG+ +AG I   NAH
Sbjct: 492 PAAINWIEGRGKSVVAEAIIPGDVVKSVLKSDVDSMVELFVAKNMIGSAMAGSIGGYNAH 551

Query: 231 FANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIK 290
            ANM+ A ++ATGQD A +VE +  +T  K    SL  S ++P++ +G +G G  +    
Sbjct: 552 AANMVAAIFIATGQDPAQVVESANCITIMKNLHGSLQISVSMPSIEVGTLGGGTILEPQS 611

Query: 291 NNLTALGCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             L +LG      T  G NAR+LA I AA  L  ELSL AA    G L++AH++  R
Sbjct: 612 AMLDSLGIRGSHPTEPGANARQLARIIAAATLAAELSLCAALAA-GHLVKAHMQHNR 667


>gi|317038444|ref|XP_001401425.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aspergillus niger
           CBS 513.88]
          Length = 879

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 184/357 (51%), Gaps = 35/357 (9%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAH--------ISMLCPD 57
           V  + +P+ + GP+ I G        +P+AT E  L  S  RG+         ++ML  D
Sbjct: 534 VGYMPVPVGFAGPLVIDGR----SYFIPMATTEGVLVASASRGSKAINAGGGAVTMLTAD 589

Query: 58  G------IRATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQ 111
           G      +    +D      I+ ++E  +         T++KA        T++F R   
Sbjct: 590 GMTRGPCVSFPTLDRAGAAKIWLDSEEGQ--------TTMQKA-----FNSTTRFGRLQS 636

Query: 112 LHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKK 170
           + + IAG  L++R +  TGDA G NM++K  +  ++ + S  +  +   ++SGN C+DKK
Sbjct: 637 MTTAIAGTNLYIRFKSTTGDAMGMNMISKGVEYALEVMKSAGFEDMKIITLSGNFCADKK 696

Query: 171 ATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAH 230
             AIN I GRGK+ VAE  I   + +  L++  + ++ L   KN+IG+ +AG I   NAH
Sbjct: 697 PAAINWIEGRGKSVVAEAIIPGDVVKSVLKSDVDSMVELFVAKNMIGSAMAGSIGGYNAH 756

Query: 231 FANMLLAYYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIK 290
            ANM+ A ++ATGQD A +VE +  +T  K    SL  S ++P++ +G +G G  +    
Sbjct: 757 AANMVAAIFIATGQDPAQVVESANCITIMKNLHGSLQISVSMPSIEVGTLGGGTILEPQS 816

Query: 291 NNLTALGCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             L +LG      T  G NAR+LA I AA  L  ELSL AA    G L++AH++  R
Sbjct: 817 AMLDSLGIRGSHPTEPGANARQLARIIAAATLAAELSLCAALAA-GHLVKAHMQHNR 872


>gi|190348200|gb|EDK40614.2| hypothetical protein PGUG_04712 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 1024

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 115/345 (33%), Positives = 178/345 (51%), Gaps = 20/345 (5%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ I G        +P+AT E  L  S  RG   ++    G+   L  + MTR
Sbjct: 654 IPVGVAGPLNIDGK----SYHIPMATTEGCLVASTMRGCK-AINAGGGVSTVLTQDGMTR 708

Query: 71  S--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLFLR 124
              + F T    +A     ++ L   E    I +    TS+F R   + + +AG LLF+R
Sbjct: 709 GPCVSFPT----LARAGAAKLWLDSEEGQKTIKKAFNSTSRFARLQHIKTALAGTLLFIR 764

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGK 182
               TGDA G NM++K  +  +  ++ +  +  +   SVSGN C+DKK +AIN I GRGK
Sbjct: 765 FRTTTGDAMGMNMISKGVEYCLKHMVEECGFKDMTVISVSGNYCTDKKPSAINWIEGRGK 824

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + VAE  I   + +  L++  + ++ LN  KNL+G+ +AG +   NA  AN++ A +LA 
Sbjct: 825 SVVAEARIPADVVKNVLKSDVDALVELNVSKNLVGSAMAGSVGGFNAQAANLVTAVFLAC 884

Query: 243 GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           GQD A  VE S  +T     D  L  S ++P++ +G +G G  +      L  L      
Sbjct: 885 GQDPAQNVESSNCITLVNKVDGDLVISVSMPSIEVGTIGGGTILEPQGAMLDLLRVKGPH 944

Query: 303 KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            T  G+NAR+LA + A+ VL  ELSL +A    G L+++H++  R
Sbjct: 945 PTNPGENARQLARVVASAVLAAELSLCSALA-AGHLVQSHMQHNR 988


>gi|146413573|ref|XP_001482757.1| hypothetical protein PGUG_04712 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 1024

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 115/347 (33%), Positives = 179/347 (51%), Gaps = 20/347 (5%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G+   L  + M
Sbjct: 652 MPIPVGVAGPLNIDGK----SYHIPMATTEGCLVASTMRGCK-AINAGGGVSTVLTQDGM 706

Query: 69  TRS--IFFETENAEMALTALQEITLKKAE----IARVIEQTSQFTRFLQLHSQIAGNLLF 122
           TR   + F T    +A     ++ L   E    I +    TS+F R   + + +AG LLF
Sbjct: 707 TRGPCVSFPT----LARAGAAKLWLDSEEGQKTIKKAFNSTSRFARLQHIKTALAGTLLF 762

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
           +R    TGDA G NM++K  +  +  ++ +  +  +   SVSGN C+DKK +AIN I GR
Sbjct: 763 IRFRTTTGDAMGMNMISKGVEYCLKHMVEECGFKDMTVISVSGNYCTDKKPSAINWIEGR 822

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK+ VAE  I   + +  L++  + ++ LN  KNL+G+ +AG +   NA  AN++ A +L
Sbjct: 823 GKSVVAEARIPADVVKNVLKSDVDALVELNVSKNLVGSAMAGSVGGFNAQAANLVTAVFL 882

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
           A GQD A  VE S  +T     D  L  S ++P++ +G +G G  +      L  L    
Sbjct: 883 ACGQDPAQNVESSNCITLVNKVDGDLVISVSMPSIEVGTIGGGTILEPQGAMLDLLRVKG 942

Query: 301 ERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              T  G+NAR+LA + A+ VL  ELSL +A    G L+++H++  R
Sbjct: 943 PHPTNPGENARQLARVVASAVLAAELSLCSALA-AGHLVQSHMQHNR 988


>gi|70995466|ref|XP_752488.1| HMG-CoA reductase [Aspergillus fumigatus Af293]
 gi|66850123|gb|EAL90450.1| HMG-CoA reductase [Aspergillus fumigatus Af293]
          Length = 1062

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 177/343 (51%), Gaps = 13/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID-ER 67
            + +P+   GP+ I G        +P+AT E  L  S  RG     +   G   T+I+ + 
Sbjct: 719  LPLPVGAAGPLVIDGR----NYFIPMATTEGVLVASASRGCK--AINAGGGAVTVINADG 772

Query: 68   MTRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
            MTR       +   A  A Q I   + +  +A     TS+F R   L S  AG  L++R 
Sbjct: 773  MTRGPCLAFSSVSRAAEAKQWIDSDEGKKILATAFNSTSRFARLQGLKSAQAGTYLYVRF 832

Query: 126  EFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
            +  TGDA G NM++K  +  ++ +    +S +   SV+GN C DKK  AIN I GRGK+ 
Sbjct: 833  KSTTGDAMGMNMISKGVEKALEVMKGHGFSDMSTISVTGNYCVDKKPAAINWIDGRGKSV 892

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I     +  L+T  + ++ LNT KNL+G+ +AG I   N H +N++ A  LATGQ
Sbjct: 893  VAEALIPADAVRSVLKTDVDALVELNTAKNLVGSAMAGSIGGFNVHASNLVAAVLLATGQ 952

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  +++L+ S ++P + +G +G G  +      L  LG      T
Sbjct: 953  DPAQNVESSSCITIMKNVNNNLHISVSMPCIEVGTIGGGTILEPQAAMLDLLGVRGAHAT 1012

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNAR+LA I AA VL GELS  AA    G L+ AH+   R
Sbjct: 1013 NPGDNARQLARIVAAAVLAGELSTCAALA-AGHLVSAHMAHNR 1054


>gi|159131243|gb|EDP56356.1| HMG-CoA reductase [Aspergillus fumigatus A1163]
          Length = 1062

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 177/343 (51%), Gaps = 13/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID-ER 67
            + +P+   GP+ I G        +P+AT E  L  S  RG     +   G   T+I+ + 
Sbjct: 719  LPLPVGAAGPLVIDGR----NYFIPMATTEGVLVASASRGCK--AINAGGGAVTVINADG 772

Query: 68   MTRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
            MTR       +   A  A Q I   + +  +A     TS+F R   L S  AG  L++R 
Sbjct: 773  MTRGPCLAFSSVSRAAEAKQWIDSDEGKKILATAFNSTSRFARLQGLKSAQAGTYLYVRF 832

Query: 126  EFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
            +  TGDA G NM++K  +  ++ +    +S +   SV+GN C DKK  AIN I GRGK+ 
Sbjct: 833  KSTTGDAMGMNMISKGVEKALEVMKGHGFSDMSTISVTGNYCVDKKPAAINWIDGRGKSV 892

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I     +  L+T  + ++ LNT KNL+G+ +AG I   N H +N++ A  LATGQ
Sbjct: 893  VAEALIPADAVRSVLKTDVDALVELNTAKNLVGSAMAGSIGGFNVHASNLVAAVLLATGQ 952

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  +++L+ S ++P + +G +G G  +      L  LG      T
Sbjct: 953  DPAQNVESSSCITIMKNVNNNLHISVSMPCIEVGTIGGGTILEPQAAMLDLLGVRGAHAT 1012

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNAR+LA I AA VL GELS  AA    G L+ AH+   R
Sbjct: 1013 NPGDNARQLARIVAAAVLAGELSTCAALA-AGHLVSAHMAHNR 1054


>gi|41581201|emb|CAE47850.1| 3-hydroxy-3-methylglutaryl-coenzyme a reductase, putative
            [Aspergillus fumigatus]
          Length = 1067

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 177/343 (51%), Gaps = 13/343 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID-ER 67
            + +P+   GP+ I G        +P+AT E  L  S  RG     +   G   T+I+ + 
Sbjct: 724  LPLPVGAAGPLVIDGR----NYFIPMATTEGVLVASASRGCK--AINAGGGAVTVINADG 777

Query: 68   MTRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
            MTR       +   A  A Q I   + +  +A     TS+F R   L S  AG  L++R 
Sbjct: 778  MTRGPCLAFSSVSRAAEAKQWIDSDEGKKILATAFNSTSRFARLQGLKSAQAGTYLYVRF 837

Query: 126  EFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
            +  TGDA G NM++K  +  ++ +    +S +   SV+GN C DKK  AIN I GRGK+ 
Sbjct: 838  KSTTGDAMGMNMISKGVEKALEVMKGHGFSDMSTISVTGNYCVDKKPAAINWIDGRGKSV 897

Query: 185  VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            VAE  I     +  L+T  + ++ LNT KNL+G+ +AG I   N H +N++ A  LATGQ
Sbjct: 898  VAEALIPADAVRSVLKTDVDALVELNTAKNLVGSAMAGSIGGFNVHASNLVAAVLLATGQ 957

Query: 245  DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            D A  VE S  +T  K  +++L+ S ++P + +G +G G  +      L  LG      T
Sbjct: 958  DPAQNVESSSCITIMKNVNNNLHISVSMPCIEVGTIGGGTILEPQAAMLDLLGVRGAHAT 1017

Query: 305  --GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              GDNAR+LA I AA VL GELS  AA    G L+ AH+   R
Sbjct: 1018 NPGDNARQLARIVAAAVLAGELSTCAALA-AGHLVSAHMAHNR 1059


>gi|170035703|ref|XP_001845707.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Culex
           quinquefasciatus]
 gi|167878013|gb|EDS41396.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Culex
           quinquefasciatus]
          Length = 907

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 183/344 (53%), Gaps = 14/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G     +  VP+AT E  L  S  RG     +   G+ + + D  M
Sbjct: 545 VQIPVGYAGPLILDGR----RFYVPMATTEGALVASTNRGCK--AISVRGVTSFVEDIGM 598

Query: 69  TRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      N   A  A +  E +   A I +  + TS+F R  ++H  + G +L+ R  
Sbjct: 599 TRAPCIRFPNVLRAAQAKRWMETSENFAVIKKAFDSTSRFARLQEVHIAMDGPVLYARFR 658

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV+K ++  +  +   +  +   S+SGN C+DKK  AIN I GRGK  V 
Sbjct: 659 ALTGDAMGMNMVSKGSEMALREVQRVFPEMQIISLSGNFCADKKPAAINWIKGRGKRVVC 718

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  I     +  L+T+   ++  N  KN+ G+ +AG I   NAH ANM+ A Y+ATGQD 
Sbjct: 719 EAIIPADKVRSILKTNARTLVQCNKLKNMTGSAVAGSIGGNNAHAANMVTAIYIATGQDP 778

Query: 247 ANIVEGSQGLTYAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           A  V  S   T  + + D+   LY +CT+P+L +G VG G  +P   + L  LG      
Sbjct: 779 AQNVTSSNCSTNMEPYGDNGEDLYMTCTMPSLEVGTVGGGTGLPGQGSCLDMLGVRGAHP 838

Query: 304 T--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           T   +N+++LA +  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 839 THPAENSKQLARVICATVMAGELSLMAALVN-SDLVKSHMRHNR 881


>gi|115387635|ref|XP_001211323.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aspergillus
           terreus NIH2624]
 gi|114195407|gb|EAU37107.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aspergillus
           terreus NIH2624]
          Length = 450

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 114/335 (34%), Positives = 177/335 (52%), Gaps = 10/335 (2%)

Query: 18  PMKITG--NVIQDKVKVPLATYEYPLWHSVKRGAH-ISMLCPDGIRATLIDERMTRSIFF 74
           P+ + G  NV +  V +PLAT E  L  SV RG   I+M    G    +  + MTR+   
Sbjct: 115 PVGLAGQLNVDETTVYLPLATTEGALVASVSRGCKAINM--SGGATTAITSDAMTRAPCL 172

Query: 75  ETENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDA 132
              +   A+ A + I   +    +     Q+S   R + +   + GN ++ R + +TGDA
Sbjct: 173 RLPSLSRAVEAKRWIESSEGFKALQDTFRQSSNHCRLIGVSVHVVGNHIYPRFQASTGDA 232

Query: 133 SGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINR 192
            G NM+T +    +  + ++++ L   S+SGN+C+DKK  A+N + GRGK  +A+  ++ 
Sbjct: 233 MGMNMITHSIRNSISMMQNRFNDLEIISLSGNLCADKKPAAVNWVEGRGKGVIAQCRLSS 292

Query: 193 AICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEG 252
           A     L+T  +++  LNT KN +G+ +AG     NA  +N++ A YLATGQD A  VE 
Sbjct: 293 ATMSNLLKTDAKQLAGLNTMKNHVGSAMAGASGGFNAQASNIVTAMYLATGQDVAQNVES 352

Query: 253 SQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGDNARR 310
           SQ +T  +   D L  S T+P+L +G VG G  +      L  LG     +   G NA++
Sbjct: 353 SQCITTMEEAGDDLVVSVTMPSLEVGTVGGGTQLKPQAAMLDLLGVRGPNDEAPGGNAQQ 412

Query: 311 LAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           LA I A  VL GE+SL +A  +  +L+ +HL L R
Sbjct: 413 LARIIATAVLAGEISLCSALAS-DDLVRSHLALNR 446


>gi|73669472|ref|YP_305487.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Methanosarcina barkeri
           str. Fusaro]
 gi|72396634|gb|AAZ70907.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Methanosarcina barkeri
           str. Fusaro]
          Length = 418

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 121/344 (35%), Positives = 193/344 (56%), Gaps = 8/344 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   G +K+ G     +  +PLAT E  L   V RG  + +    G    + +
Sbjct: 76  IGAVQIPLGIAGLLKVNGEYANSEYYIPLATTEGALVAGVNRGCSV-ITKSGGANVRVFE 134

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  F+ E+   A    + +   +   ++  V E+T++F + L +   + G  ++L
Sbjct: 135 DEMTRAPVFKLESLSRAKEFYEWVKCPEIFEKMKVVAEKTTRFGKLLSVRPFVTGTYVYL 194

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R  + T DA G NMVT A DAVM  I  ++   H  ++SGN+C DKK  +I+ I+GRGK 
Sbjct: 195 RFSYDTKDAMGMNMVTIATDAVMHLIQDEFG-AHPVTLSGNMCIDKKPASISTILGRGKT 253

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            VAE+TI + I ++ L+ +PE +  +N  KNL+G+  AG +   NAH AN++ A YLA G
Sbjct: 254 VVAEVTIPKEIVKETLKCTPESMFEVNYSKNLLGSARAGAL-GFNAHAANIIAAIYLACG 312

Query: 244 QDAANIVEGSQGLTYAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           QDAA++VEGS  +T  +L   + +  S T+P+L +G VG G  +   ++ L  LG     
Sbjct: 313 QDAAHVVEGSTAITSMELTKYEEIQCSVTLPSLPVGTVGGGSGLGTQRDCLNILGVAGAG 372

Query: 303 KT-GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G N+++ A I A+ VL GE++L+ AQ   G L  AH +L R
Sbjct: 373 DVPGINSKKFAEIVASAVLAGEVNLIGAQA-AGHLARAHAQLGR 415


>gi|189026969|emb|CAQ55980.1| hydroxymethylglutaryl-coenzyme A reductase [Aphanomyces euteiches]
          Length = 425

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/321 (33%), Positives = 176/321 (54%), Gaps = 12/321 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+K+ G    + V +P+AT E  L  S  RG  +  +   G+ + ++ 
Sbjct: 108 VGYVPLPVGLAGPIKVNG----ENVFLPMATTEGCLIASTNRGCKVLNM-GGGVDSIVLA 162

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + +TR+  + F       AL A  +      E+A     T+++ R   + +  +G   ++
Sbjct: 163 DSITRAPCVRFARAVDAAALKAYLDNKNNFEELAAEFNSTTRYGRMTAIKTVQSGRNCYV 222

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R+    G+A G NMV+K   AV+ ++ +++  +   ++SGN+C+DKK+ AIN + GRGK+
Sbjct: 223 RIACNAGNAMGMNMVSKGTLAVLTFLKAKFPLMELVALSGNVCTDKKSAAINWLEGRGKS 282

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            VA+  +   I  K LRTS + ++ LN QKNLIG+ +AG +   NA  AN+L A +LATG
Sbjct: 283 VVADAVVKADIVTKVLRTSVDALVDLNIQKNLIGSAMAGSLGGFNAQAANILTAIFLATG 342

Query: 244 QDAANIVEGSQGL-TYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           QD A  VE S  + T  K  D  LY S T+P++ +G VG G ++   K+ L  +GC   +
Sbjct: 343 QDPAQNVESSSCMTTMEKTSDGDLYISVTMPSIEVGTVGGGTHLAPPKSCLGLMGCASHQ 402

Query: 303 --KTG--DNARRLAAICAATV 319
             K G    +RRLA   +A V
Sbjct: 403 THKEGHESGSRRLAFAISAGV 423


>gi|304320098|ref|YP_003853741.1| hydroxymethylglutaryl-CoA reductase (NADPH) 1 [Parvularcula
           bermudensis HTCC2503]
 gi|303299001|gb|ADM08600.1| hydroxymethylglutaryl-CoA reductase (NADPH) 1 [Parvularcula
           bermudensis HTCC2503]
          Length = 394

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 114/336 (33%), Positives = 169/336 (50%), Gaps = 9/336 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP++I G   +    +PLAT E  L  S  RG  + +    G++ T+I+  M R
Sbjct: 64  VPIGLAGPLEIDGEHAKGPFYIPLATTEGTLVASYNRGMRL-LSEVGGVKTTVIERYMQR 122

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F   NA  A    + +   +A+I    E T+   +   +       + FLR  + TG
Sbjct: 123 APVFHFANARDARAFGEWVADHEADIRTAAEATTTVGQLHHIQRFQVAQMCFLRFNYLTG 182

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DA+G NM  KA  A  +WI        + ++SG I +DKK + +N +  RG   VAE+TI
Sbjct: 183 DAAGQNMSGKATYAACEWIAEHAPGQPWYTLSGAIDTDKKHSHMNMLHSRGARVVAEVTI 242

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
             A+ Q  +  S  K+       N  G  LAG + +   H AN L A ++ATGQD ANI 
Sbjct: 243 PDAVMQAMMGPSNAKLFRGRLVSN-AGGMLAGTVNNG-MHAANGLTALFIATGQDVANIS 300

Query: 251 EGSQGLTYAK-LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNAR 309
           E    +T+ + L +   Y+S TIP+LI+   G G  +P  +  L  LGC  + K      
Sbjct: 301 ESHAAITFVELLPNGDYYWSITIPSLIVATYGGGTGLPTQRECLEMLGCYGKGKV----E 356

Query: 310 RLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           + A ICAATVL GE+SL AA  + G+ + +H R  R
Sbjct: 357 KFAEICAATVLAGEISLAAAVQH-GDWVSSHDRYGR 391


>gi|226468252|emb|CAX69803.1| 3-hydroxy-3-methylglutaryl CoA reductase [Schistosoma japonicum]
          Length = 952

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 115/343 (33%), Positives = 182/343 (53%), Gaps = 16/343 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           I +P+  IGP+ + G        VPLAT E  L  S  RG   ++    G+++ +  ++M
Sbjct: 549 IPIPVGKIGPLLLDGR----SHYVPLATTEGCLVASTNRGCR-AIFLAGGVKSVVYRDQM 603

Query: 69  TRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+  ++F +    +   A  +       +    ++TS     L + +  AG  + +R  
Sbjct: 604 TRAPVVWFPSIADSVKCIAFIDSEEGFQILKSAFDKTSAHANLLSVFASPAGRYVHIRFA 663

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G N+V+KA D+ +  +   +S +   S+SGN+C+DKK   IN I+GRGK+ +A
Sbjct: 664 ARTGDAMGMNLVSKATDSALHCLQKYFSSMQVISLSGNMCTDKKPATINTILGRGKSVIA 723

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAG--GIRSANAHFANMLLAYYLATGQ 244
           E  I   +  + L T+ +++  L   KN IG+ +AG  G+   NAH AN++   + ATGQ
Sbjct: 724 EAHIPSCVLVQVLHTNAQRLARLTHAKNWIGSAMAGCPGMMGCNAHAANIIAGMFAATGQ 783

Query: 245 DAANIVEGSQGLTYAKLH--DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
           D A +V+ S  LT  ++   DDSL  S T+P L +G +G G  +P  +  L  L    +R
Sbjct: 784 DLAQVVDSSSCLTQLEVDSSDDSLIASVTMPCLEVGTIGGGTRLPGQRACLDLLDLSIDR 843

Query: 303 KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                A  L+ I AATVL  ELSL+AA  +  +L++AH+   R
Sbjct: 844 P----AEHLSRIIAATVLAAELSLMAA-LDTDDLVKAHMHFNR 881


>gi|157122019|ref|XP_001659923.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aedes aegypti]
 gi|108874612|gb|EAT38837.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aedes aegypti]
          Length = 930

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 182/344 (52%), Gaps = 14/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G     +  VP+AT E  L  S  RG     +   G+ + + D  M
Sbjct: 550 VQIPVGYAGPLILDGV----RYYVPMATTEGALVASTNRGC--KAISTRGVTSFVEDIGM 603

Query: 69  TRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+   +  N   A  A +  E     A I +  + TS+F R  +LH  + G +L+ R  
Sbjct: 604 TRAPCIKFPNVLRAAQAKRWMETPENFAVIKKAFDSTSRFARLQELHIAMDGPILYARFR 663

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NMV+K ++  +  +   +  +   S+SGN CSDKK  AIN I GRGK  + 
Sbjct: 664 ALTGDAMGMNMVSKGSEMALREVHRSFPDMQIISLSGNFCSDKKPAAINWIKGRGKRVIC 723

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E  +     +  L+T+   ++  N  KN+ G+ +AG I   NAH ANM+ A Y+ATGQD 
Sbjct: 724 EAIVPADKLRTILKTNARTLVQCNKLKNMTGSAVAGSIGGNNAHAANMVTAIYIATGQDP 783

Query: 247 ANIVEGSQGLTYAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           A  V  S   T  + + D+   LY +CT+P+L +G VG G  +P     L  LG      
Sbjct: 784 AQNVTSSNCSTNMEPYGDNGEDLYMTCTMPSLEVGTVGGGTGLPGQGACLDMLGVRGAHP 843

Query: 304 T--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           T   +N+++LA +  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 844 THPAENSKQLARVICATVMAGELSLMAALVN-SDLVKSHMRHNR 886


>gi|86144332|ref|ZP_01062664.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio sp. MED222]
 gi|85837231|gb|EAQ55343.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio sp. MED222]
          Length = 419

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 180/342 (52%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G   +    VPLAT E  L  S  RG+ +   C  G  A L++
Sbjct: 86  IGTVKVPVGISGPLRVNGLFAKGDYLVPLATTEAALVASYNRGSKLITAC-GGASAMLLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  +    A   +     +  +   + E T+   +   ++  I GN ++L  
Sbjct: 145 EGVTRTPGFAFQGLVEAGQFVAWAVTQYDQFKTLAESTTSHGKLTDINVNIEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSY-LHYGSVSGNICSDKKATAINGIMGRGKNF 184
           EF TGDASG NMVT A +AV ++I+        +  + GN+  DKKA        RGK  
Sbjct: 205 EFLTGDASGQNMVTIATNAVFEYIIENTPVKPDHAFLDGNLSGDKKANTQTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ I+  +  KYL T+PEK++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 TAEVNISAELVAKYLHTTPEKMVQFG-QMTTVGGALSGTI-GINAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L+ +  LY S T+PNL+LG VG G  +P+ K  L  LG     K
Sbjct: 323 DAACVAESAIGMTRMELNKEGGLYASVTLPNLMLGTVGGGTGLPSQKACLDLLGLHGNGK 382

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +    + LA +CAA  L GELS++ A    G    AH +L R
Sbjct: 383 S----QALAEVCAALCLAGELSIVGAFC-AGHFSRAHHKLAR 419


>gi|312211364|emb|CBX91449.1| hypothetical protein [Leptosphaeria maculans]
          Length = 1539

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 122/353 (34%), Positives = 184/353 (52%), Gaps = 20/353 (5%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GP+ + G        +P+AT E  L  S  RGA  ++    G    +  
Sbjct: 1158 VGYLPLPLGVAGPILVDGQ----NYFLPMATTEGVLVASTSRGAK-AINAGGGAVTVVTG 1212

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQ----TSQFTRFLQLHSQIAGN 119
            + MTR   I FE+    +A     +  L   E  R ++     TS+F R   + S IAG 
Sbjct: 1213 DGMTRGPCIGFES----LARAGAAKNWLDSDEGQRTMKDAFNSTSRFARLQSMKSAIAGT 1268

Query: 120  LLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGI 177
             +++R    TGDA G NM++K  +  ++ + +   +  +   +VSGN C+DKKA AIN I
Sbjct: 1269 NIYVRFRATTGDAMGMNMISKGVEHALNVMANDAGFDDMRVVTVSGNYCTDKKAAAINWI 1328

Query: 178  MGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA 237
             GRGK  VAE  I  A+ +  L+   E ++ +N  KNLIG+ +AG +   NAH AN++ A
Sbjct: 1329 DGRGKGVVAEAIIPGAVVRSVLKCEVEDLVQMNISKNLIGSAMAGAMGGFNAHAANIVAA 1388

Query: 238  YYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
             +LATGQD A +VE +  +T        L  S ++P++ +G +G G  +      L  LG
Sbjct: 1389 IFLATGQDPAQVVESANCITIMNNIRGDLQVSVSMPSIEVGTIGGGTILEPQSAMLDLLG 1448

Query: 298  CIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHL 348
                  T  GDNAR+LA + AA VL GELSL +A    G L++AH+   R ++
Sbjct: 1449 VRGAHPTSPGDNARQLARVIAAGVLAGELSLNSALCA-GHLVKAHMAHNRSNV 1500


>gi|300176419|emb|CBK23730.2| Hydroxymethylglutaryl-CoA reductase [Blastocystis hominis]
          Length = 401

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 158/281 (56%), Gaps = 15/281 (5%)

Query: 16  IGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           +GP+ + G    ++  +P+AT E  L  S  RGA  ++    G+ + ++D+ MTR+  F+
Sbjct: 114 VGPILVNG----ERHYIPMATTEGALIASTNRGAR-AITESGGVTSVVVDDGMTRAPVFK 168

Query: 76  TENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDAS 133
            E+   A    Q +   +  + +     QT++  +   +   ++GN L +RL+   GDA 
Sbjct: 169 CESVLQAAKVKQFVESPEGFSLVFNAFSQTTKHGKLESIKCFVSGNRLHMRLKANAGDAM 228

Query: 134 GHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRA 193
           G NM+TK ++ V D ++SQ+  L   S+SGN+C+DKK +AIN ++GRGK+   E+ I   
Sbjct: 229 GMNMLTKGSNKVADALISQFPTLKLESLSGNLCTDKKPSAINWLLGRGKSVTCEVRIPER 288

Query: 194 ICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGS 253
           I +  L+     I+ LNT KNL+G+ LAG +   NAH AN++   +LATGQD A +VE S
Sbjct: 289 IMRSVLKCRVHDIVQLNTAKNLVGSSLAGTLGGNNAHAANIVAGIFLATGQDMAQVVESS 348

Query: 254 QGLTY--------AKLHDDSLYFSCTIPNLILGCVGNGKNI 286
             L Y         +  + +LY S T+P++ +G +G G  +
Sbjct: 349 HCLDYMEEEEEEGEEGQEKTLYMSVTMPSIEVGTIGGGTGL 389


>gi|289582578|ref|YP_003481044.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Natrialba magadii
           ATCC 43099]
 gi|289532131|gb|ADD06482.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Natrialba magadii
           ATCC 43099]
          Length = 410

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 120/349 (34%), Positives = 182/349 (52%), Gaps = 16/349 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +  +PM  +GP+ ++G+    +  +P+AT E  L  SV RG  + +   DG  A +  
Sbjct: 69  IGAAQIPMGVVGPVDVSGSAADGEHYLPMATTEGALLASVNRGLSV-IRSADGADARVTK 127

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F  E    A   ++ +      +    E T+     L + + + G+ +FLR 
Sbjct: 128 NGMTRAPVFRVEGVAEAAETVEWVDDNVDALREAAESTTSHGELLAVDTYVVGDSVFLRF 187

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NMVT A     + + ++ +     +VSGN+CSDKK  AIN + GRG++  
Sbjct: 188 AYDTKDAMGMNMVTIATGEACELVEAE-TPASLVAVSGNLCSDKKPAAINAVEGRGRSVT 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++ I   + ++ L T+ + I   NT+KNL G+  AG +   NAH AN++ A +LATGQD
Sbjct: 247 ADVLIPGELVEERLHTTADAIAEANTRKNLTGSAKAGSL-GFNAHAANVIAAAFLATGQD 305

Query: 246 AANIVEGSQGLTY--AKLHDD---SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            A +VEG+  +T   A+  +D    LY + ++ +L +G VG G  +P     L  LG   
Sbjct: 306 EAQVVEGANAITTMEAREREDGTTDLYAAVSLASLEVGTVGGGTKLPTQAEALEILGL-- 363

Query: 301 ERKTGD----NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            R  GD    NA  LA I A   L GELSLLAA ++   L  AH  L R
Sbjct: 364 -RGGGDPAGSNADALAEIIAVGALAGELSLLAALSSR-HLASAHEDLGR 410


>gi|221131064|ref|XP_002157911.1| PREDICTED: similar to 3-hydroxy-3-methylglutaryl-coenzyme A
           reductase [Hydra magnipapillata]
          Length = 687

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 125/362 (34%), Positives = 183/362 (50%), Gaps = 55/362 (15%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ + G    ++  VP+AT E  L  S  RG   ++    G+ + L+ + MTR
Sbjct: 337 IPVGVAGPLVLDG----EEYFVPMATTEGCLVASTNRGCS-ALRASGGVSSYLLGDGMTR 391

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
                  +A++A                       +     +   +AG LLF+R +  TG
Sbjct: 392 GPVLRLPSAKLA----------------------WYANLNSVKCAVAGRLLFVRFKAFTG 429

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DA G NMV+K A+  +  +  ++  +   SVSGN C+DKKA AIN I GRGK+ V E  I
Sbjct: 430 DAMGMNMVSKGAEYALKLLQMEFPEIEVVSVSGNYCTDKKAAAINWIDGRGKSVVCEAVI 489

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ------ 244
           ++ I +K L+TS   +I +NT KNL+G+ L G I   NAH AN++ A ++ATGQ      
Sbjct: 490 SQDIVKKVLKTSVPALIDVNTSKNLVGSALVGTIGGQNAHAANVVTAIFIATGQIKCAIK 549

Query: 245 ---------------DAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNI 286
                          D A  V  S  +T  +      + LY SC++P+L  G VG G  +
Sbjct: 550 NYEKLIPGKAKGDPKDPAQNVVSSNCITLLETTGEKGEDLYISCSMPSLETGTVGGGTGL 609

Query: 287 PAIKNNLTALGCIEER---KTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRL 343
           P  K  L    C + R   +TG+NA+RLA I  ATVL GELSLL+A      L+ +H++L
Sbjct: 610 PGQKACLKVKSCEQIRNKFQTGENAQRLARIICATVLAGELSLLSALA-ADHLVNSHMKL 668

Query: 344 ER 345
            R
Sbjct: 669 NR 670


>gi|62945913|gb|AAY22199.1| HMG CoA reductase [Datura inoxia]
          Length = 253

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 140/238 (58%), Gaps = 5/238 (2%)

Query: 112 LHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKA 171
           +   IAG  L++R   +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK 
Sbjct: 4   IQCAIAGKNLYMRFSCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKP 63

Query: 172 TAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHF 231
            A+N I GRGK+ V E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH 
Sbjct: 64  AAVNWIEGRGKSVVCEAIIKEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHA 123

Query: 232 ANMLLAYYLATGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAI 289
           +N++ A YLATGQD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + + 
Sbjct: 124 SNIVSAIYLATGQDPAQNVESSHCITMMEPVNDGKDLHVSVTMPSIEVGTVGGGTQLASQ 183

Query: 290 KNNLTALGC--IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              L  LG         G NAR LA I A +VL GELSL++A  + G+L+++H++  R
Sbjct: 184 SACLNLLGVKGANREAPGSNARLLATIVAGSVLAGELSLMSA-ISAGQLVKSHMKYNR 240


>gi|218676235|ref|YP_002395054.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio splendidus
           LGP32]
 gi|218324503|emb|CAV25968.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio splendidus
           LGP32]
          Length = 429

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 179/342 (52%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G   +    VPLAT E  L  S  RG+ +   C  G  A L++
Sbjct: 96  IGTVKVPVGISGPLRVNGLFAKGDYLVPLATTEAALVASYNRGSKLITAC-GGASAMLLN 154

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  +    A   +     +  +   + E T+   +   ++  I GN ++L  
Sbjct: 155 EGVTRTPGFAFQGLVEAGQFVAWAVTQYDQFKTLAESTTSHGKLTDININIEGNHVYLVF 214

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSY-LHYGSVSGNICSDKKATAINGIMGRGKNF 184
           EF TGDASG NMVT A +AV ++I+        +  + GN+  DKKA        RGK  
Sbjct: 215 EFLTGDASGQNMVTIATNAVFEYIIEHTPVKPDHAFLDGNLSGDKKANTQTLRSVRGKKV 274

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ I+  +  KYL T+PEK++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 275 TAEVNISAELVAKYLHTTPEKMVQFG-QMTTVGGALSGTI-GINAHYANALAALYIACGQ 332

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L  +  LY S T+PNL+LG VG G  +P+ K  L  LG     K
Sbjct: 333 DAACVAESAIGMTRMELSKEGGLYASVTLPNLMLGTVGGGTGLPSQKACLDLLGLHGNGK 392

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +    + LA +CAA  L GELS++ A    G    AH +L R
Sbjct: 393 S----QALAEVCAALCLAGELSIVGAFC-AGHFSRAHHKLAR 429


>gi|327485732|gb|AEA80138.1| Hydroxymethylglutaryl-CoA reductase [Vibrio cholerae LMA3894-4]
          Length = 417

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 116/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  V + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEVAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFIMRHSPVTPVQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 321 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 379 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|260773903|ref|ZP_05882818.1| hydroxymethylglutaryl-CoA reductase [Vibrio metschnikovii CIP
           69.14]
 gi|260610864|gb|EEX36068.1| hydroxymethylglutaryl-CoA reductase [Vibrio metschnikovii CIP
           69.14]
          Length = 419

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 109/343 (31%), Positives = 180/343 (52%), Gaps = 12/343 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G    D   +PLAT E  L  S  RG  + +    G    L++
Sbjct: 86  IGTVKVPVGMAGPLRVNGLHANDDFLIPLATTEAALVASYHRGCKL-ITAAGGTSVMLLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  ++   A   +  +T +     ++ + T+   +   ++  + GN ++L  
Sbjct: 145 EGVTRTPVFAFDHLAQAGQFIAWVTTQYEHFKQLAQATTAHGQLHDINVTMEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSY-LHYGSVSGNICSDKKATAINGIMGRGKNF 184
           ++ TGDA G NMVT A +AV ++I+        +  + GN+  DKKA +      RGK  
Sbjct: 205 DYLTGDACGQNMVTIATNAVFEFIVHHSPIKPRHAFLDGNLSGDKKANSHVLRHVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE ++    +   IG  L+G +   NAH+AN L A+ +A GQ
Sbjct: 265 TAEVHLSAELIKKYLHTTPETMVKF-AEMTTIGGVLSGSV-GINAHYANALTAFSIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSC-TIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           D A + E + G+T  +L+     ++C T+PNL++G VG G ++P+ K  L  LG      
Sbjct: 323 DPACVAESAVGITRMELNSQGGLYACVTLPNLMVGTVGGGTSLPSQKACLALLGL----- 377

Query: 304 TGD-NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           TG  NAR LA + A   L GELS +A   + G    AH +L R
Sbjct: 378 TGSGNARALAEVVAGLCLAGELS-IAGAFSAGHFSRAHHKLAR 419


>gi|302502993|ref|XP_003013457.1| HMG-CoA reductase [Arthroderma benhamiae CBS 112371]
 gi|291177021|gb|EFE32817.1| HMG-CoA reductase [Arthroderma benhamiae CBS 112371]
          Length = 1182

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 123/369 (33%), Positives = 188/369 (50%), Gaps = 42/369 (11%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G      + +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 778  LPLPLGVAGPLVIDGQ----SLFIPMATTEGVLVASTSRGCK-AINAGGGATTVLTADGM 832

Query: 69   TRS--IFFETEN----AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F + +    A++ L + +  ++ KA        TS+F R   + + +AG  L+
Sbjct: 833  TRGPCVSFSSVSRAGEAKLWLDSEEGQSIMKA----AFNSTSRFARLQTMKTTLAGTNLY 888

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKKA A+N I GR
Sbjct: 889  IRFKTTTGDAMGMNMISKGVEKALSVMANEAGFEDMQTISVSGNFCTDKKAAAVNWIDGR 948

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 949  GKSVVAEAIIPANVVKSVLKSDVDSMVELNISKNLIGSAMAGALGGFNAHASNIVTALFL 1008

Query: 241  ATGQDAANIVEGSQGLTYAK-------LHDD---------------SLYFSCTIPNLILG 278
            ATGQD A  VE S  +T  K       LH                 +L+ S ++P++ +G
Sbjct: 1009 ATGQDPAQNVESSNCITIMKKYVSPIPLHPSWRLFAITNLLFSVGGNLHISVSMPSIEVG 1068

Query: 279  CVGNGKNIPAIKNNLTALGCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGEL 336
             +G G  +      L  LG      T  GDN+RRLA I AA VL GELSL AA    G L
Sbjct: 1069 TIGGGTILEGQGAMLDLLGVRGAHPTNPGDNSRRLARIVAAAVLAGELSLCAALAA-GHL 1127

Query: 337  MEAHLRLER 345
            + AH+   R
Sbjct: 1128 VRAHMAHNR 1136


>gi|84390459|ref|ZP_00991470.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio splendidus
           12B01]
 gi|84376719|gb|EAP93595.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio splendidus
           12B01]
          Length = 419

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 121/342 (35%), Positives = 179/342 (52%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G        VPLAT E  L  S  RG+ +   C  G  A L++
Sbjct: 86  IGTVKVPVGISGPLRVNGLFATGDYLVPLATTEAALVASYNRGSKLITAC-GGASAMLLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  +    A   +     +  +   + E T+   +   ++  I GN ++L  
Sbjct: 145 EGVTRTPGFAFQGLVEAGQFVAWAVTQYDQFKTLAESTTSHGKLTDININIEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSY-LHYGSVSGNICSDKKATAINGIMGRGKNF 184
           EF TGDASG NMVT A +AV ++I+        +  + GN+  DKKA        RGK  
Sbjct: 205 EFLTGDASGQNMVTIATNAVFEYIIENTPVKPDHAFLDGNLSGDKKANTQTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ I+  +  KYL T+PEK++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 TAEVNISAELVAKYLHTTPEKMVQFG-QMTTVGGALSGTI-GINAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L+ +  LY S T+PNL+LG VG G  +P+ K  L  LG     K
Sbjct: 323 DAACVAESAIGMTRMELNKEGGLYASVTLPNLMLGTVGGGTGLPSQKACLDLLGLHGNGK 382

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +    + LA +CAA  L GELS++ A    G    AH +L R
Sbjct: 383 S----QALAEVCAALCLAGELSIVGAFC-AGHFSRAHHKLAR 419


>gi|254482961|ref|ZP_05096197.1| Hydroxymethylglutaryl-coenzyme A reductase [marine gamma
           proteobacterium HTCC2148]
 gi|214036833|gb|EEB77504.1| Hydroxymethylglutaryl-coenzyme A reductase [marine gamma
           proteobacterium HTCC2148]
          Length = 394

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 111/341 (32%), Positives = 172/341 (50%), Gaps = 13/341 (3%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ + G   Q +  VP+AT E  L  S  RG  + +    G+  T++ E M R
Sbjct: 59  VPIGVAGPLLVNGEHAQGEFYVPMATIEGTLIASYNRGMRV-IRESGGVTTTVMSEAMQR 117

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  ++A  A      +      I    E T+   + L++      N+++ R +++TG
Sbjct: 118 APVFFFKDARDAREFCHWLVDSIDVIRAQAESTTSVGKLLEIEQYPVHNMVYTRFDYSTG 177

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DA+G NM   A     +WI + +  L    +SG + ++KK + +N + GRG+   AEITI
Sbjct: 178 DAAGQNMTGGATFVACEWIRANYPKLRTYGLSGGMDTEKKTSFVNSLKGRGRKVTAEITI 237

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R +    LRT+PE  +  +T  N +  FL G   +A AH AN L A Y+ATGQD ANI 
Sbjct: 238 PRQVLADVLRTTPEN-LRNSTGINTLAAFLTGASNNA-AHPANGLAALYMATGQDMANIG 295

Query: 251 EGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNAR 309
           E +Q   Y+ +     LY+S T+P LI+   G G  +   +  L  + C  +    D A 
Sbjct: 296 EANQCSVYSYVTKTGDLYYSITLPALIMATYGGGTGLATQRECLELMDCYGQ----DKAY 351

Query: 310 RLAAICAATVLCGELSLLAA-----QTNPGELMEAHLRLER 345
           +L  I A  V+ GELSL++A      T   E ++AH +L R
Sbjct: 352 KLIEIAAGLVVAGELSLVSAARTDKATGTNEWVDAHEKLGR 392


>gi|302667155|ref|XP_003025168.1| HMG-CoA reductase [Trichophyton verrucosum HKI 0517]
 gi|291189258|gb|EFE44557.1| HMG-CoA reductase [Trichophyton verrucosum HKI 0517]
          Length = 1088

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 123/369 (33%), Positives = 188/369 (50%), Gaps = 42/369 (11%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G      + +P+AT E  L  S  RG   ++    G    L  + M
Sbjct: 684  LPLPLGVAGPLVIDGQ----SLFIPMATTEGVLVASTSRGCK-AINAGGGATTVLTADGM 738

Query: 69   TRS--IFFETEN----AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            TR   + F + +    A++ L + +  ++ KA        TS+F R   + + +AG  L+
Sbjct: 739  TRGPCVSFSSVSRAGEAKLWLDSEEGQSIMKA----AFNSTSRFARLQTMKTTLAGTNLY 794

Query: 123  LRLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGR 180
            +R +  TGDA G NM++K  +  +  + ++  +  +   SVSGN C+DKKA A+N I GR
Sbjct: 795  IRFKTTTGDAMGMNMISKGVEKALSVMANEAGFEDMQTISVSGNFCTDKKAAAVNWIDGR 854

Query: 181  GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
            GK+ VAE  I   + +  L++  + ++ LN  KNLIG+ +AG +   NAH +N++ A +L
Sbjct: 855  GKSVVAEAIIPANVVKSVLKSDVDSMVELNISKNLIGSAMAGALGGFNAHASNIVTALFL 914

Query: 241  ATGQDAANIVEGSQGLTYAK-------LHDD---------------SLYFSCTIPNLILG 278
            ATGQD A  VE S  +T  K       LH                 +L+ S ++P++ +G
Sbjct: 915  ATGQDPAQNVESSNCITIMKKYVSPIPLHPSWRLFAITNLLSSVGGNLHISVSMPSIEVG 974

Query: 279  CVGNGKNIPAIKNNLTALGCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGEL 336
             +G G  +      L  LG      T  GDN+RRLA I AA VL GELSL AA    G L
Sbjct: 975  TIGGGTILEGQGAMLDLLGVRGAHPTNPGDNSRRLARIVAAAVLAGELSLCAALAA-GHL 1033

Query: 337  MEAHLRLER 345
            + AH+   R
Sbjct: 1034 VRAHMAHNR 1042


>gi|229514175|ref|ZP_04403636.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae TMA 21]
 gi|229348155|gb|EEO13113.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae TMA 21]
          Length = 436

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 116/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 103 IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 161

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  V + T+   +   +   I GN ++L  
Sbjct: 162 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEVAQSTTAHGKLKDIQVNIEGNHVYLVF 221

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 222 EYTTGDASGQNMVTIATHAVFEFIMRHSPVTPVQAFLDGNLSGDKKANSYTLRSVRGKKV 281

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 282 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 339

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 340 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 397

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 398 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 436


>gi|229528400|ref|ZP_04417791.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae 12129(1)]
 gi|229334762|gb|EEO00248.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae 12129(1)]
          Length = 436

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 116/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 103 IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 161

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  V + T+   +   +   I GN ++L  
Sbjct: 162 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEVAQSTTAHGKLKDIQVNIEGNHVYLVF 221

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 222 EYTTGDASGQNMVTIATHAVFEFIMRHSPVTPVQAFLDGNLSGDKKANSYTLRSVRGKKV 281

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 282 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 339

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 340 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 397

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 398 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 436


>gi|254285746|ref|ZP_04960709.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae AM-19226]
 gi|150424243|gb|EDN16181.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae AM-19226]
          Length = 436

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 116/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 103 IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 161

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  V + T+   +   +   I GN ++L  
Sbjct: 162 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEVAQSTTAHGKLKDIQVNIEGNHVYLVF 221

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 222 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKV 281

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 282 SAEVHLSADLVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 339

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 340 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 397

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 398 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 436


>gi|153820209|ref|ZP_01972876.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae NCTC
           8457]
 gi|126509249|gb|EAZ71843.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae NCTC
           8457]
          Length = 404

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 71  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 129

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 130 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 189

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 190 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKV 249

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 250 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 307

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 308 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 365

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 366 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 404


>gi|153824465|ref|ZP_01977132.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae MZO-2]
 gi|149742019|gb|EDM56048.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae MZO-2]
          Length = 417

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 117/348 (33%), Positives = 186/348 (53%), Gaps = 22/348 (6%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVS-------GNICSDKKATAINGIM 178
           E+ TGDASG NMVT A  AV ++I      +H+  V+       GN+  DKKA +     
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFI------MHHSPVAPVQAFLDGNLSGDKKANSYTLRS 256

Query: 179 GRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAY 238
            RGK   AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A 
Sbjct: 257 VRGKKVSAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAAL 314

Query: 239 YLATGQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
           Y+A GQDAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G
Sbjct: 315 YIACGQDAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMG 374

Query: 298 CIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +     +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 375 LAGQ----GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|296818377|ref|XP_002849525.1| hmg-CoA reductase [Arthroderma otae CBS 113480]
 gi|238839978|gb|EEQ29640.1| hmg-CoA reductase [Arthroderma otae CBS 113480]
          Length = 622

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 112/342 (32%), Positives = 176/342 (51%), Gaps = 11/342 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G     ++ +P+AT E  L  S  RG   ++    G+   L+ + M
Sbjct: 286 MPLPVGVAGPLNVDGT----RIFIPMATTEGALVASTNRGC-AAINSGGGVVTALLADGM 340

Query: 69  TRSIFFETENAEMALTALQEITLKKA--EIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR       N + A  A   +  +     I      TS+F R     S I G+ LF+R +
Sbjct: 341 TRGPTVRFRNLQRASEAKAWLDSEHGYRSIEAAFNSTSRFGRLQSARSVIVGSELFIRFK 400

Query: 127 FATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             TGDA G NM++K  +  +  +    +  +H  S+SGN C+DKK+  +N + GRGK+  
Sbjct: 401 SFTGDAMGMNMMSKGVEKALAAMAENGFEDMHVTSLSGNYCTDKKSAGVNWVEGRGKSIS 460

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A+ TI   + +  L+T  + ++ LN  KNL G+ +AG I   NAH AN++ A ++ATGQD
Sbjct: 461 AQATIPGEVVRTALKTDVDTLVDLNRSKNLTGSAVAGSIGGFNAHAANIVTAIFIATGQD 520

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERK 303
            A  V  S  LT      + L  S  +P++ +G VG G  +   +  L  +G    +E  
Sbjct: 521 PAQNVASSSCLTTMTKVGEDLQISVYMPSIEVGTVGGGTILAPQQAMLDLMGVRGSKEES 580

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G+NA++LA I A+ VL GELSL +A    G L+ +H+   R
Sbjct: 581 PGENAQKLARIVASGVLAGELSLCSALA-AGSLVRSHMAHNR 621


>gi|59714024|ref|YP_206799.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio fischeri
           ES114]
 gi|59482272|gb|AAW87911.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio fischeri
           ES114]
          Length = 419

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 126/347 (36%), Positives = 184/347 (53%), Gaps = 20/347 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G    D   VPLAT E  L  S  RGA + +    G  A L++
Sbjct: 86  IGTVKLPVGLAGPLRVNGLFANDDYLVPLATTEAALVASYNRGAQL-LTASGGASAMLLN 144

Query: 66  ERMTRS---IFFETENAE--MALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           E +TR+    FF    A   +A    Q  T K+     + E T+   +   ++  I GN 
Sbjct: 145 EGVTRTPAFAFFGLAEAGQFVAWAVTQYDTFKQ-----LAESTTSHGKLSDINISIEGNH 199

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMG 179
           ++L  EF TGDASG NMVT A +AV  +I+         + + GN+  DKKA++      
Sbjct: 200 VYLVFEFLTGDASGQNMVTIATNAVFSYIMENSPITPENAYLDGNLSGDKKASSQTLRSV 259

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
           RGK   AE  I   + +KYL T+PEK++   TQ + +G  L+G I   NAH+AN L A Y
Sbjct: 260 RGKKVTAEAHIPAKLVKKYLHTTPEKMMQF-TQMSTVGATLSGTI-GINAHYANALAALY 317

Query: 240 LATGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           +A GQDAA + E + G+T  ++  +  LY S T+PNL+LG VG G  +P+ K  L  +G 
Sbjct: 318 IACGQDAACVAESAIGMTRIEVDRNGDLYASVTLPNLMLGTVGGGTGLPSQKACLELMGL 377

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               K+    + LA +CAA  L GELS++ A    G    AH +L R
Sbjct: 378 HGAGKS----QALAEVCAALCLAGELSIVGAFC-AGHFSRAHHKLAR 419


>gi|262192594|ref|ZP_06050741.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae CT 5369-93]
 gi|262031513|gb|EEY50104.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae CT 5369-93]
          Length = 417

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 321 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 379 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|72390553|ref|XP_845571.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Trypanosoma brucei
           TREU927]
 gi|62358804|gb|AAX79257.1| 3-hydroxy-3-methylglutaryl-CoA reductase, putative [Trypanosoma
           brucei]
 gi|70802106|gb|AAZ12012.1| 3-hydroxy-3-methylglutaryl-CoA reductase, putative [Trypanosoma
           brucei brucei strain 927/4 GUTat10.1]
 gi|261328977|emb|CBH11955.1| 3-hydroxy-3-methylglutaryl-CoA reductase,putative [Trypanosoma
           brucei gambiense DAL972]
          Length = 434

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 115/332 (34%), Positives = 176/332 (53%), Gaps = 6/332 (1%)

Query: 18  PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75
           P+ + G +I D  +  +P+AT E  L  S  RGA  ++    G +  ++ E M+R+   E
Sbjct: 103 PLGMAGPIIMDGCEYPIPMATTEGALVASTHRGAR-AISQSGGCKTLILGEGMSRAPVVE 161

Query: 76  TENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGH 135
            E+ E A            EI    E T++F +   L   I G   ++R    TGDA G 
Sbjct: 162 VESLEEAGRLHNFCVENFTEIKAAFESTTRFGKLQSLKCVIIGRKAYIRFRATTGDAMGM 221

Query: 136 NMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAIC 195
           NM+TK  D  ++ I   +  +   ++SGN C+DKK +A+N I GRGK  VAE  +   + 
Sbjct: 222 NMITKGVDKALELIKQNFPSMKVIALSGNYCTDKKPSAVNWIEGRGKTVVAEALVRGELV 281

Query: 196 QKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQG 255
           ++ L+ + E ++ LN  KNL+G+ +AG +   NA  AN++ A ++ATGQD A +VE S  
Sbjct: 282 ERTLKCTVEDLVSLNIDKNLVGSAVAGSVGGFNAQAANVVAAIFIATGQDPAQVVESSTC 341

Query: 256 LTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TGDNARRLAA 313
           +T      + L  S  +P++ +G VG G  +PA    L  +GC    K   G NA+ L+ 
Sbjct: 342 ITTMSKVGNDLLISVAMPSIEVGTVGGGTGLPAQSGCLDMIGCAGSNKEAPGANAQLLSR 401

Query: 314 ICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           + AA VL  ELSL++     G L+ AH+RL R
Sbjct: 402 LVAAGVLSAELSLMSGLA-AGHLLSAHMRLNR 432


>gi|197336771|ref|YP_002158520.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio fischeri MJ11]
 gi|197314023|gb|ACH63472.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio fischeri MJ11]
          Length = 419

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 126/347 (36%), Positives = 184/347 (53%), Gaps = 20/347 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G    D   VPLAT E  L  S  RGA + +    G  A L++
Sbjct: 86  IGTVKLPVGLAGPLRVNGLFANDDYLVPLATTEAALVASYNRGAQL-LTASGGASAMLLN 144

Query: 66  ERMTRS---IFFETENAE--MALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNL 120
           E +TR+    FF    A   +A    Q  T K+     + E T+   +   ++  I GN 
Sbjct: 145 EGVTRTPAFAFFGLAEAGQFVAWAVTQYDTFKQ-----LAESTTSHGKLSDINISIEGNH 199

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMG 179
           ++L  EF TGDASG NMVT A +AV  +I+         + + GN+  DKKA++      
Sbjct: 200 VYLVFEFLTGDASGQNMVTIATNAVFSYIMENSPITPENAYLDGNLSGDKKASSQTLRSV 259

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
           RGK   AE  I   + +KYL T+PEK++   TQ + +G  L+G I   NAH+AN L A Y
Sbjct: 260 RGKKVTAEAHIPAELVKKYLHTTPEKMMQF-TQMSTVGATLSGTI-GINAHYANALAALY 317

Query: 240 LATGQDAANIVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           +A GQDAA + E + G+T  ++  +  LY S T+PNL+LG VG G  +P+ K  L  +G 
Sbjct: 318 IACGQDAACVAESAIGMTRIEVDRNGDLYASVTLPNLMLGTVGGGTGLPSQKACLELMGL 377

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               K+    + LA +CAA  L GELS++ A    G    AH +L R
Sbjct: 378 HGAGKS----QALAEVCAALCLAGELSIVGAFC-AGHFSRAHHKLAR 419


>gi|153820654|ref|ZP_01973321.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae B33]
 gi|255746515|ref|ZP_05420462.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholera CIRS 101]
 gi|262158898|ref|ZP_06030011.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae INDRE 91/1]
 gi|126521697|gb|EAZ78920.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae B33]
 gi|255736269|gb|EET91667.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholera CIRS 101]
 gi|262029471|gb|EEY48122.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae INDRE 91/1]
          Length = 417

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 321 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 379 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|15601479|ref|NP_233110.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae O1 biovar
           eltor str. N16961]
 gi|153820714|ref|ZP_01973381.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae B33]
 gi|227812290|ref|YP_002812300.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae M66-2]
 gi|229506119|ref|ZP_04395628.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae BX 330286]
 gi|229510024|ref|ZP_04399504.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae B33]
 gi|229516415|ref|ZP_04405862.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae RC9]
 gi|229605650|ref|YP_002876354.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae MJ-1236]
 gi|254225195|ref|ZP_04918808.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae V51]
 gi|254849881|ref|ZP_05239231.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae MO10]
 gi|298499520|ref|ZP_07009326.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae MAK
           757]
 gi|9658143|gb|AAF96622.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|125622294|gb|EAZ50615.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae V51]
 gi|126521757|gb|EAZ78980.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae B33]
 gi|227011432|gb|ACP07643.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae M66-2]
 gi|229346296|gb|EEO11267.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae RC9]
 gi|229352469|gb|EEO17409.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae B33]
 gi|229356470|gb|EEO21388.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae BX 330286]
 gi|229372136|gb|ACQ62558.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae MJ-1236]
 gi|254845586|gb|EET24000.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae MO10]
 gi|297541501|gb|EFH77552.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae MAK
           757]
          Length = 436

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 103 IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 161

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 162 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 221

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 222 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKV 281

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 282 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 339

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 340 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 397

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 398 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 436


>gi|229522287|ref|ZP_04411703.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae TM 11079-80]
 gi|229340272|gb|EEO05278.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae TM 11079-80]
          Length = 436

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 103 IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 161

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 162 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 221

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 222 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKV 281

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 282 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANSLAALYIACGQ 339

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 340 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 397

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 398 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 436


>gi|19075735|ref|NP_588235.1| 3-hydroxy-3-methylglutaryl-CoA reductase Hmg1 [Schizosaccharomyces
            pombe 972h-]
 gi|12644403|sp|Q10283|HMDH_SCHPO RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
            Short=HMG-CoA reductase
 gi|3218399|emb|CAA19589.1| 3-hydroxy-3-methylglutaryl-CoA reductase Hmg1 [Schizosaccharomyces
            pombe]
          Length = 1053

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 124/349 (35%), Positives = 185/349 (53%), Gaps = 16/349 (4%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  ++M
Sbjct: 687  MPLPLGVAGPLIIDGK----PFYIPMATTEGALVASTMRGCK-AINAGGGAVTVLTRDQM 741

Query: 69   TRSIFFETENAEMALTALQEITLKKAEIARVIEQ----TSQFTRFLQLHSQIAGNLLFLR 124
            +R       N   A  A  +I L   E   V+++    TS+F R   + + +AG  LF+R
Sbjct: 742  SRGPCVAFPNLTRAGRA--KIWLDSPEGQEVMKKAFNSTSRFARLQHIKTALAGTRLFIR 799

Query: 125  LEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGK 182
               +TGDA G NM++K  +  +  + +   +  +   SVSGN C+DKK  AIN I GRGK
Sbjct: 800  FCTSTGDAMGMNMISKGVEHALVVMSNDAGFDDMQVISVSGNYCTDKKPAAINWIDGRGK 859

Query: 183  NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
            + +AE  I     +  L+T+ E ++ LN  KNLIG+ +AG +   NAH AN++ A YLAT
Sbjct: 860  SVIAEAIIPGDAVKSVLKTTVEDLVKLNVDKNLIGSAMAGSVGGFNAHAANIVTAVYLAT 919

Query: 243  GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            GQD A  VE S  +T     D +L  S ++P++ +G +G G  +      L  LG     
Sbjct: 920  GQDPAQNVESSNCITLMDNVDGNLQLSVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGAH 979

Query: 303  KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             T  GDN+R+LA + AA V+ GELSL +A  + G L+++H+ L R  LN
Sbjct: 980  MTSPGDNSRQLARVVAAAVMAGELSLCSALAS-GHLVKSHIGLNRSALN 1027


>gi|222641836|gb|EEE69968.1| hypothetical protein OsJ_29860 [Oryza sativa Japonica Group]
          Length = 494

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 99/254 (38%), Positives = 152/254 (59%), Gaps = 5/254 (1%)

Query: 96  IARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSY 155
           +A V  ++S+F R  ++   +AG  L++R   +TGDA G NMV+K    V+D++   +  
Sbjct: 232 LAMVFNRSSRFARLQRVKCAVAGRNLYMRFSCSTGDAMGMNMVSKGVQNVLDYLQDDFPD 291

Query: 156 LHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNL 215
           +   S+SGN CSDKK+ A+N I GRGK+ V E  I   + +K L+T+ + ++ LN  KNL
Sbjct: 292 MDVISISGNFCSDKKSAAVNWIEGRGKSVVCEAVIKEEVVKKVLKTNVQSLVELNVIKNL 351

Query: 216 IGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIP 273
            G+ +AG +   NAH +N++ A ++ATGQD A  VE SQ +T  +  +D   L+ S T+P
Sbjct: 352 AGSAVAGALGGFNAHASNIVTAIFIATGQDPAQNVESSQCITMLEAVNDGKDLHISVTMP 411

Query: 274 NLILGCVGNGKNIPAIKNNLTALGC--IEERKTGDNARRLAAICAATVLCGELSLLAAQT 331
           ++ +G VG G  + +    L  LG         G NAR LAA+ A  VL GELSL++AQ 
Sbjct: 412 SIEVGTVGGGTQLASQSACLDLLGVKGANRESPGSNARLLAAVVAGAVLAGELSLISAQA 471

Query: 332 NPGELMEAHLRLER 345
             G L+++H++  R
Sbjct: 472 -AGHLVQSHMKYNR 484


>gi|297580256|ref|ZP_06942183.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae RC385]
 gi|297535902|gb|EFH74736.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae RC385]
          Length = 436

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 183/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 103 IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 161

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 162 EGVTRTPVFAFLSLAQAGQFVGWVTNQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 221

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYL-HYGSVSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+           + GN+  DKKA +      RGK  
Sbjct: 222 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPEQAFLDGNLSGDKKANSYTLRSVRGKKV 281

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 282 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 339

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 340 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 397

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 398 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 436


>gi|229526769|ref|ZP_04416173.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae bv. albensis
           VL426]
 gi|229336927|gb|EEO01945.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae bv. albensis
           VL426]
          Length = 436

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT +  L  S  RG+ + +    G  A L++
Sbjct: 103 IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTDAALVASYHRGSQL-ITAAGGASALLLN 161

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  V + T+   +   +   I GN ++L  
Sbjct: 162 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEVAQSTTAHGKLKDIQVNIEGNHVYLVF 221

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 222 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKV 281

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 282 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 339

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 340 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 397

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 398 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 436


>gi|121585616|ref|ZP_01675412.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae
           2740-80]
 gi|121550233|gb|EAX60247.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae
           2740-80]
          Length = 417

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 114/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A +++
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALVLN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 321 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 379 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|302308176|ref|NP_985010.2| AER152Wp [Ashbya gossypii ATCC 10895]
 gi|299789330|gb|AAS52834.2| AER152Wp [Ashbya gossypii ATCC 10895]
          Length = 1028

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 179/342 (52%), Gaps = 12/342 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            +  + +P+  IGP+ I G        +P+AT E  L  S  RG   ++    G+   L  
Sbjct: 672  IGYMPLPVGVIGPLVIDGVAYH----IPMATTEGCLVASAMRGCK-AINAGGGVTTVLTK 726

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   + F +     A     +    +A + R    TS+F R   + + +AG+LLF+
Sbjct: 727  DGMTRGPCVRFPSLARAGACKLWLDSEEGQARVKRAFNSTSRFARLQHVQTALAGDLLFI 786

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +  +  + ++  W  +   +VSGN C+DKK  AIN I GRG
Sbjct: 787  RFRTTTGDAMGMNMISKGVEFALHQMGAEFGWHDMEIVAVSGNYCTDKKPAAINWIEGRG 846

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K+ VAE T+   + +K L++    ++ +N  KNL+G+ +AG +   NAH +N++ A YLA
Sbjct: 847  KSVVAEATVPADVVRKVLKSDVAALVDVNISKNLVGSAMAGAVGGFNAHASNLVTALYLA 906

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--I 299
             GQD A  VE S  +T  +     L  S ++P++ +G +G G  +      L  LG    
Sbjct: 907  LGQDPAQNVESSNCITLMRDVGGDLRVSVSMPSIEVGTIGGGTILGPQSAMLDLLGVRGP 966

Query: 300  EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHL 341
                 G NAR+LA I A+ VL GELSL +A    G L+++H+
Sbjct: 967  HPSAPGTNARQLAKIVASAVLAGELSLCSALAA-GHLVQSHM 1007


>gi|330915869|ref|XP_003297205.1| hypothetical protein PTT_07524 [Pyrenophora teres f. teres 0-1]
 gi|311330267|gb|EFQ94705.1| hypothetical protein PTT_07524 [Pyrenophora teres f. teres 0-1]
          Length = 1167

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 115/349 (32%), Positives = 180/349 (51%), Gaps = 12/349 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GP+ + G        +P+AT E  L  S  RGA  ++    G    +  
Sbjct: 785  VGYLPLPVGVAGPILVDGQ----NYFLPMATTEGVLVASTSRGAK-AINAGGGAVTVVTG 839

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   I F++     A     +    +  +      TS+F R   + S IAG  +++
Sbjct: 840  DGMTRGPCIGFDSLVRAGAAKNWLDSEEGQRTMKDAFNSTSRFARLQSMKSAIAGTNIYV 899

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +  ++ + +   +  +   +VSGN C+DKK+ AIN I GRG
Sbjct: 900  RFRATTGDAMGMNMISKGVEHALNVMANDCGFDDMRVVTVSGNYCTDKKSAAINWIDGRG 959

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K  VAE  I   + +  L+   E ++ +N  KN IG+ +AG +   NAH AN++ A +LA
Sbjct: 960  KGVVAEAVIPGHVVKSVLKCEVEDLVQMNISKNFIGSAMAGAMGGFNAHAANIVAAMFLA 1019

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A +VE +  +T     + +L  S ++P++ +G +G G  +      L  LG    
Sbjct: 1020 TGQDPAQVVESANCITIMHNVNGNLQISVSMPSIEVGTIGGGTILEPQSAMLDLLGVRGA 1079

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHL 348
              T  GDNAR+LA + AA VL GELSL +A    G L++AH+   R ++
Sbjct: 1080 HPTSPGDNARQLARVIAAGVLAGELSLNSALCA-GHLVKAHMAHNRSNV 1127


>gi|189209407|ref|XP_001941036.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pyrenophora
            tritici-repentis Pt-1C-BFP]
 gi|187977129|gb|EDU43755.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Pyrenophora
            tritici-repentis Pt-1C-BFP]
          Length = 1164

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 115/349 (32%), Positives = 180/349 (51%), Gaps = 12/349 (3%)

Query: 6    VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
            V  + +P+   GP+ + G        +P+AT E  L  S  RGA  ++    G    +  
Sbjct: 782  VGYLPLPVGVAGPILVDGQ----NYFLPMATTEGVLVASTSRGAK-AINAGGGAVTVITG 836

Query: 66   ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
            + MTR   I F++     A     +    +  +      TS+F R   + S IAG  +++
Sbjct: 837  DGMTRGPCIGFDSLVRAGAAKNWLDSEEGQRTMKDAFNSTSRFARLQSMKSAIAGTNIYV 896

Query: 124  RLEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRG 181
            R    TGDA G NM++K  +  ++ + +   +  +   +VSGN C+DKK+ AIN I GRG
Sbjct: 897  RFRATTGDAMGMNMISKGVEHALNVMANDCGFDDMRVVTVSGNYCTDKKSAAINWIDGRG 956

Query: 182  KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
            K  VAE  I   + +  L+   E ++ +N  KN IG+ +AG +   NAH AN++ A +LA
Sbjct: 957  KGVVAEAVIPGHVVKSVLKCEVEDLVQMNISKNFIGSAMAGAMGGFNAHAANIVAAMFLA 1016

Query: 242  TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
            TGQD A +VE +  +T     + +L  S ++P++ +G +G G  +      L  LG    
Sbjct: 1017 TGQDPAQVVESANCITIMHNVNGNLQISVSMPSIEVGTIGGGTILEPQSAMLDLLGVRGA 1076

Query: 302  RKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHL 348
              T  GDNAR+LA + AA VL GELSL +A    G L++AH+   R ++
Sbjct: 1077 HPTSPGDNARQLARVIAAGVLAGELSLNSALCA-GHLVKAHMAHNRSNV 1124


>gi|1374961|gb|AAB39277.1| hydroxymethylglutaryl CoA reductase [Schizosaccharomyces pombe]
          Length = 1053

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 123/349 (35%), Positives = 185/349 (53%), Gaps = 16/349 (4%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        +P+AT E  L  S  RG   ++    G    L  ++M
Sbjct: 687  MPLPLGVAGPLIIDGK----PFYIPMATTEGALVASTMRGCK-AINAGGGAVTVLTRDQM 741

Query: 69   TRSIFFETENAEMALTALQEITLKKAEIARVIEQ----TSQFTRFLQLHSQIAGNLLFLR 124
            +R       +   A  A  +I L   E   V+++    TS+F R   + + +AG  LF+R
Sbjct: 742  SRGPCVAFPDLTRAGRA--KIWLDSPEGQEVMKKAFNSTSRFARLQHIKTALAGTRLFIR 799

Query: 125  LEFATGDASGHNMVTKAADAVMDWILSQWSY--LHYGSVSGNICSDKKATAINGIMGRGK 182
               +TGDA G NM++K  +  +  + +   +  +   SVSGN C+DKK  AIN I GRGK
Sbjct: 800  FCTSTGDAMGMNMISKGVEHALVVMSNDAGFDDMQVISVSGNYCTDKKPAAINWIDGRGK 859

Query: 183  NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
            + +AE  I     +  L+T+ E ++ LN  KNLIG+ +AG +   NAH AN++ A YLAT
Sbjct: 860  SVIAEAIIPGDAVKSVLKTTVEDLVKLNVDKNLIGSAMAGSVGGFNAHAANIVTAVYLAT 919

Query: 243  GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            GQD A  VE S  +T     D +L  S ++P++ +G +G G  +      L  LG     
Sbjct: 920  GQDPAQNVESSNCITLMDNVDGNLQLSVSMPSIEVGTIGGGTVLEPQGAMLDLLGVRGAH 979

Query: 303  KT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
             T  GDN+R+LA + AA V+ GELSL +A  + G L+++H+ L R  LN
Sbjct: 980  MTSPGDNSRQLARVVAAAVMAGELSLCSALAS-GHLVKSHIGLNRSALN 1027


>gi|121725961|ref|ZP_01679261.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae V52]
 gi|121631726|gb|EAX64094.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae V52]
          Length = 417

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 114/342 (33%), Positives = 184/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A +++
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALVLN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 SAEVHLSAELVKKYLHTTPEQMMQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   +  
Sbjct: 321 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ-- 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 379 --GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|256076373|ref|XP_002574487.1| HMG-CoA reductase; hydroxymethylglutaryl-CoA reductase (NADPH)
           [Schistosoma mansoni]
 gi|238659693|emb|CAZ30720.1| HMG-CoA reductase [Schistosoma mansoni]
          Length = 769

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 179/341 (52%), Gaps = 16/341 (4%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+  IGP+ + G        +PLAT E  L  S  RG   ++    GI++ +  ++MTR
Sbjct: 365 IPVGKIGPLLLDGR----SHYIPLATTEGCLVASTNRGCR-AIFLAGGIKSVVYRDQMTR 419

Query: 71  S--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           +  ++F +    +   A  +       +    ++TS     L + +  AG  + +R    
Sbjct: 420 APVVWFPSIIDSVKCIAWIDSEEGFQTLKSAFDKTSAHVNLLSVFACPAGRYIHIRFAAR 479

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NMV+KA D+ +  +   +S +   S+SGN+C+DKK   IN I+GRGK+ +AE 
Sbjct: 480 TGDAMGMNMVSKATDSALHCLKKYFSNMQVISLSGNMCTDKKPATINTILGRGKSVIAEA 539

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAG--GIRSANAHFANMLLAYYLATGQDA 246
            ++  +  + L T+ +++  L   KN IG+ +AG  G+   NAH AN++   + ATGQD 
Sbjct: 540 HLSADVLAQVLHTNAQRLARLTHSKNWIGSAMAGCPGMMGCNAHAANIIAGMFAATGQDL 599

Query: 247 ANIVEGSQGLTY--AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           A +V+ S  LT     L DDSL  S T+P L +G VG G  +   +  L  L    +R T
Sbjct: 600 AQVVDSSSCLTQLEVDLSDDSLVASVTMPCLEVGTVGGGTRLSGQRACLDLLDLSVDRPT 659

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                 L+ I A TVL  ELSL+AA  +  +L++AH+   R
Sbjct: 660 ----EHLSRIIAGTVLAAELSLMAA-LDTDDLVKAHMHFNR 695


>gi|323491807|ref|ZP_08096982.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio
           brasiliensis LMG 20546]
 gi|323313942|gb|EGA67031.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio
           brasiliensis LMG 20546]
          Length = 419

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 116/342 (33%), Positives = 176/342 (51%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G    D   +PLAT E  L  S  RGA + +    G  A LI+
Sbjct: 86  IGTVKVPVGVAGPLRVNGLYANDDFLIPLATTEAALVASYNRGAQL-ITAAGGASAMLIN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  ++   A   +  +  +     R+ E T+   +   ++  I  + ++L  
Sbjct: 145 EGVTRTPVFSFDSLANAGQFVAWVVTQYDHFKRIAESTTSHGKLHDINVNIEASQVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A + V  +IL         + + GN+  DKK  A      RGK  
Sbjct: 205 EYHTGDASGQNMVTIATNEVYHYILEHSPITPTEAFLDGNLSGDKKPNANTLRHVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ +++ + +KYL TSPEK++    Q    G  L+GGI   NAH+AN L A Y+A GQ
Sbjct: 265 TAEVHLSKELVEKYLHTSPEKMVRFG-QVTTTGAALSGGI-GVNAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T   L++   L+ S T+PNL++G VG G  +P  K  L  +G      
Sbjct: 323 DAACVAESAVGITRMVLNEQGGLHASVTLPNLMVGTVGGGTGLPTQKACLDIMGL----H 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              NA+ LA + A   L GELS++ A         AH +L R
Sbjct: 379 GSGNAKSLAEVAACLCLAGELSIVGAFC-ADHFSRAHQKLAR 419


>gi|116624804|ref|YP_826960.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116227966|gb|ABJ86675.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 511

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 108/325 (33%), Positives = 157/325 (48%), Gaps = 8/325 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V    +P+   GP+ + G   Q    +PLAT E  L  S  RG  +  LC  G++ T++ 
Sbjct: 177 VGVAQVPIGIAGPLHVRGEHAQGNFLIPLATSEGTLVASYNRGMKVLNLC-GGVKVTVVG 235

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + M R+  F  E+A         +    A I    E TS   +   + + +A   ++LR 
Sbjct: 236 DAMQRAPAFIFEDARAGRDFSIWVQDNLATIRAQAEATSSVAKLQYIDTYLASKFVYLRF 295

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            F+TGDA+G NMV +A  A  +WIL  +  +    +  N  +DKKA+ IN +  RGK   
Sbjct: 296 NFSTGDAAGQNMVGRATLAACEWILEHYHGIVSFYLESNFATDKKASDINRLRTRGKRVT 355

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           AE  I R +   ++R  PE++       N +G  L+G   +   H AN + A ++ATGQD
Sbjct: 356 AEAVIQRDVLIGHMRVEPEQLTHHYGVAN-VGALLSGA-NNNGGHSANGIAAMFIATGQD 413

Query: 246 AANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           AAN+ E S  + Y +L     LY S TIP+LI+   G G  +   +  L  L C      
Sbjct: 414 AANVAESSAAVLYTELTPQRDLYISLTIPSLIVATHGGGTGLATQRECLEILRCYGR--- 470

Query: 305 GDNARRLAAICAATVLCGELSLLAA 329
            D   RLA I     L GE+SL AA
Sbjct: 471 -DRVNRLAEIIGGVALAGEISLGAA 494


>gi|119504856|ref|ZP_01626934.1| Hydroxymethylglutaryl-coenzyme A reductase [marine gamma
           proteobacterium HTCC2080]
 gi|119459461|gb|EAW40558.1| Hydroxymethylglutaryl-coenzyme A reductase [marine gamma
           proteobacterium HTCC2080]
          Length = 398

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 111/342 (32%), Positives = 171/342 (50%), Gaps = 14/342 (4%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ + G   Q +  VP+AT E  +  S  RG  + +    G+  T+  E M R
Sbjct: 62  IPIGVAGPLLVNGEHAQGEFYVPMATVEGTMLASYNRGMKV-IRESGGVTTTVSAESMQR 120

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F   +A  A      +      I    E T+   + L++ +  A N +  R +++TG
Sbjct: 121 APVFIFADARDARDFQVWLRANFDAIKAQAESTTSVGKLLEIENYHAHNFIATRFDYSTG 180

Query: 131 DASGHNMVTKAADAVMDWILSQW-SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEIT 189
           DA+G NM ++A     +WI   +   +    +SGN  ++KK +++N + GRG+   AEIT
Sbjct: 181 DAAGQNMTSRATFFACEWIRENYPGNMRNYMLSGNFDTEKKTSSVNMLKGRGRRVTAEIT 240

Query: 190 INRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANI 249
           I R +    LR +PE+ +    Q + +  F++    +A +H AN L A YLATGQD ANI
Sbjct: 241 IPRKVLMDNLRITPEQ-MQYGYQVSTLAAFMSNSSNNA-SHPANGLAALYLATGQDIANI 298

Query: 250 VEGSQGLTYAK-LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNA 308
            E +Q   Y +   D   YFS T+P++I+   G G N+P     L  + C  +    D A
Sbjct: 299 GESNQCTVYQRATRDGDHYFSITLPSIIMASYGGGTNLPTQSECLKMMDCFGQ----DKA 354

Query: 309 RRLAAICAATVLCGELSLLAAQ-----TNPGELMEAHLRLER 345
            +L  I A  V+ GELSL AA      T   E ++AH RL R
Sbjct: 355 LKLCEIAAGLVVAGELSLAAATRIDKATRTNEWVDAHERLGR 396


>gi|153211962|ref|ZP_01947809.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae 1587]
 gi|124117038|gb|EAY35858.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae 1587]
          Length = 417

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 115/342 (33%), Positives = 183/342 (53%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G+  Q    VPLAT E  L  S  RG+ + +    G  A L++
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVASYHRGSQL-ITAAGGASALLLN 142

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++L  
Sbjct: 143 EGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVF 202

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RGK  
Sbjct: 203 EYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKV 262

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 263 SAEVHLSAELVKKYLHTTPEQMVQFG-QMTTVGGALSGAI-GVNAHYANALAALYIACGQ 320

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +    E  
Sbjct: 321 DAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLM----ELA 376

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 377 GQGHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 417


>gi|239993058|ref|ZP_04713582.1| Hydroxymethylglutaryl-coenzyme A reductase [Alteromonas macleodii
           ATCC 27126]
          Length = 514

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 110/314 (35%), Positives = 159/314 (50%), Gaps = 8/314 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+KI G   Q +  VPLAT E  L  S  RG  +  +   G+ AT++D+ M R
Sbjct: 185 VPIGIAGPLKINGEHAQGEFVVPLATTEGTLVASYNRGMKLLNMS-GGVTATVVDDAMQR 243

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  ENA  A   ++ I     +I    E TS   +   +   ++    FLR  F TG
Sbjct: 244 APVFIFENARGARDFVKWIKANFEKIKEEAEATSSVAKLTYIDHFLSNKFAFLRFNFKTG 303

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DA+G NMV +A  A   WIL  +  +    +  N  +DKKA+ IN +  RGK   AE TI
Sbjct: 304 DAAGQNMVGRATFAACGWILDHYEGIENFYLESNFATDKKASQINIMRTRGKRVTAEATI 363

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R    + +R  P++I   + +   +G+FL+ G+ +   H  N + A ++ATGQD AN+ 
Sbjct: 364 KREHLLEVMRVDPKQID-YHGRVAGVGSFLS-GVNNTGLHSPNGITAMFIATGQDVANVS 421

Query: 251 EGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNAR 309
           E S  + Y++L DD  LY S TIP+LI+   G G  I   +  L  L C       D   
Sbjct: 422 ESSAAMMYSELTDDGDLYVSITIPSLIVATYGGGTGIGTQRECLELLDCYGR----DRVY 477

Query: 310 RLAAICAATVLCGE 323
           + A I A+ VL GE
Sbjct: 478 KFAEIVASVVLAGE 491


>gi|329896147|ref|ZP_08271360.1| Hydroxymethylglutaryl-CoA reductase [gamma proteobacterium
           IMCC3088]
 gi|328921966|gb|EGG29331.1| Hydroxymethylglutaryl-CoA reductase [gamma proteobacterium
           IMCC3088]
          Length = 394

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 109/343 (31%), Positives = 176/343 (51%), Gaps = 17/343 (4%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+ + G   Q +  VP+AT E  +  S  RG  + +    G+  T+ D  M R
Sbjct: 59  VPVGIAGPLLVNGEYAQGEYFVPMATVEGTMLASYNRGMKV-IRESGGVLTTVTDVVMQR 117

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  ++A  A      +     EI    E T+   +  ++      N+++ R +++TG
Sbjct: 118 APCFVFKDARQARDFTLWLDQNFLEIKARAETTTSVGKLNEIERYHVHNMVYTRFDYSTG 177

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DA+G NM ++A     +WI  Q  ++ +  +SG+  ++K+ +++N + GRG+   AEITI
Sbjct: 178 DAAGQNMTSRATFVACEWIREQNPHMSHYLLSGSFDTEKRTSSVNLLKGRGRRVTAEITI 237

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSAN--AHFANMLLAYYLATGQDAAN 248
            R + +++L+ +PE +         I T  A    S+N  AH AN L A YLATGQD AN
Sbjct: 238 PREVMKQHLKVTPEAMHY----GQGISTLAALLTNSSNNAAHPANGLAALYLATGQDIAN 293

Query: 249 IVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307
           I E +Q  TY K+  +   Y+S T+P+LI+   G G ++   +  L  + C       D 
Sbjct: 294 IGESNQCTTYNKVTRNGDYYYSITLPSLIVATYGGGTSLATQRECLEIMDCY----GADK 349

Query: 308 ARRLAAICAATVLCGELSLLAA-----QTNPGELMEAHLRLER 345
           A + A I A  V+ GELSL AA     +T   + ++AH RL R
Sbjct: 350 AMKFAEIAAGLVVAGELSLAAATRTDKETRTNDWVDAHERLGR 392


>gi|123345|sp|P16237|HMDH_SCHMA RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase;
           Short=HMG-CoA reductase
 gi|161021|gb|AAA29896.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Schistosoma
           mansoni]
          Length = 948

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 179/341 (52%), Gaps = 16/341 (4%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+  IGP+ + G        +PLAT E  L  S  RG   ++    GI++ +  ++MTR
Sbjct: 544 IPVGKIGPLLLDGR----SHYIPLATTEGCLVASTNRGCR-AIFLAGGIKSVVYRDQMTR 598

Query: 71  S--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           +  ++F +    +   A  +       +    ++TS     L + +  AG  + +R    
Sbjct: 599 APVVWFPSIIDSVKCIAWIDSEEGFQTLKSAFDKTSAHVNLLSVFACPAGRYIHIRFAAR 658

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NMV+KA D+ +  +   +S +   S+SGN+C+DKK   IN I+GRGK+ +AE 
Sbjct: 659 TGDAMGMNMVSKATDSALHCLKKYFSNMQVISLSGNMCTDKKPATINTILGRGKSVIAEA 718

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAG--GIRSANAHFANMLLAYYLATGQDA 246
            ++  +  + L T+ +++  L   KN IG+ +AG  G+   NAH AN++   + ATGQD 
Sbjct: 719 HLSADVLAQVLHTNAQRLARLTHSKNWIGSAMAGCPGMMGCNAHAANIIAGMFAATGQDL 778

Query: 247 ANIVEGSQGLTY--AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           A +V+ S  LT     L DDSL  S T+P L +G VG G  +   +  L  L    +R T
Sbjct: 779 AQVVDSSSCLTQLEVDLSDDSLVASVTMPCLEVGTVGGGTRLSGQRACLDLLDLSVDRPT 838

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                 L+ I A TVL  ELSL+AA  +  +L++AH+   R
Sbjct: 839 ----EHLSRIIAGTVLAAELSLMAA-LDTDDLVKAHMHFNR 874


>gi|312382349|gb|EFR27840.1| hypothetical protein AND_05003 [Anopheles darlingi]
          Length = 829

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 119/344 (34%), Positives = 178/344 (51%), Gaps = 14/344 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+ + GP+ + G     +  VP+AT E  L  S  RG     +   G+ + + D  M
Sbjct: 493 VQIPVGYAGPLLLDGQ----RFYVPMATTEGALVASTNRGCK--AISTRGVTSFVEDIGM 546

Query: 69  TRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      N   A  A + +  ++    I    + TS++ R   LH  I G +L++R  
Sbjct: 547 TRAPCVRFPNVLQAAQAKRWMESEEHFKRIKNAFDSTSRYARLQDLHIAIDGPVLYIRFR 606

Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186
             TGDA G NM++K  +  +  I + +  +   S+SGN CSDKK  AIN I GRGK  V 
Sbjct: 607 AFTGDAMGMNMLSKGTERALRDIQAVFPDMVIISLSGNFCSDKKPAAINWIKGRGKRVVC 666

Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246
           E TI     +   +T+   ++  N  KN+ G+ +AG I   NAH ANM+ A Y+ATGQD 
Sbjct: 667 ETTIPADKLESIFKTNARTLVQCNKLKNMTGSAVAGSIGGNNAHAANMVTAIYIATGQDP 726

Query: 247 ANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           A  V  S   T  +      + LY +CT+P+L +G +G G  +P     L  LG      
Sbjct: 727 AQNVTSSNCSTNMETSGEDGEDLYVTCTMPSLEVGTLGGGTGLPGQSACLDMLGVRGSHP 786

Query: 304 T--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           T   +N+++LA I  ATV+ GELSLLAA     +L+++H+R  R
Sbjct: 787 THPAENSKQLARIICATVMAGELSLLAALVT-SDLVKSHMRHNR 829


>gi|322823239|gb|EFZ29034.1| 3-hydroxy-3-methylglutaryl-CoA reductase, putative [Trypanosoma
           cruzi]
          Length = 435

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 115/339 (33%), Positives = 178/339 (52%), Gaps = 8/339 (2%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G     +  +P+AT E  L  S  RGA  ++    G +  L+ E M
Sbjct: 100 VPIPLGVAGPILIDGK----EFPIPMATTEGALVASTHRGAR-AITRSGGCKTLLLGEGM 154

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           TR+   E  + E A    +        I    E T+Q+ +   L   +AG   +LR    
Sbjct: 155 TRAPVVELPSLEEAGRLHKYCNENFLSIKEAFESTTQYGKLNSLKCVLAGRKAYLRFRAT 214

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NM+TK  D  +  +   +  +   ++SGN C+DKK +A+N I GRGK+ VAE 
Sbjct: 215 TGDAMGMNMITKGVDKALSVLQQHFPSMEILALSGNYCTDKKPSAVNWIDGRGKSVVAEA 274

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
           T+   + +  L+ + + ++ LN  KNL+G+ +AG +   NA  AN + A ++ATGQD A 
Sbjct: 275 TLLADVVEDTLKCTVDSLVSLNIDKNLVGSAMAGSVGGFNAQAANAVAAIFIATGQDPAQ 334

Query: 249 IVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGD 306
           +VE S  +T      + L  S T+P++ +G VG G  + A +  L  +GC    +   G 
Sbjct: 335 VVESSMCITTMSKVGNDLLISVTMPSIEVGVVGGGTGLAAQRGCLELIGCGGPSKESPGT 394

Query: 307 NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           NA+ L+ + AA VL  ELSL++     G L+ AH+RL R
Sbjct: 395 NAQLLSRVVAAGVLSAELSLMSGLA-AGHLLSAHMRLNR 432


>gi|71414242|ref|XP_809229.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Trypanosoma cruzi strain
           CL Brener]
 gi|70873581|gb|EAN87378.1| 3-hydroxy-3-methylglutaryl-CoA reductase, putative [Trypanosoma
           cruzi]
          Length = 435

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 115/339 (33%), Positives = 178/339 (52%), Gaps = 8/339 (2%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G     +  +P+AT E  L  S  RGA  ++    G +  L+ E M
Sbjct: 100 VPIPLGVAGPILIDGK----EYPIPMATTEGALVASTHRGAR-AITRSGGCKTLLLGEGM 154

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           TR+   E  + E A    +        +    E T+Q+ +   L   +AG   +LR    
Sbjct: 155 TRAPVVELPSLEEAGRLHKYCNENFLSLKEAFESTTQYGKLNSLKCVLAGRKAYLRFRAT 214

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NM+TK  D  +  +   +  +   ++SGN C+DKK +A+N I GRGK+ VAE 
Sbjct: 215 TGDAMGMNMITKGVDKALSVLQQHFPSMEILALSGNYCTDKKPSAVNWIDGRGKSVVAEA 274

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
           T+   + +  L+ + + ++ LN  KNL+G+ LAG +   NA  AN + A ++ATGQD A 
Sbjct: 275 TLLADVVEDTLKCTVDSLVSLNIDKNLVGSALAGSVGGFNAQAANAVAAIFIATGQDPAQ 334

Query: 249 IVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGD 306
           +VE S  +T      + L  S T+P++ +G VG G  + A +  L  +GC    +   G 
Sbjct: 335 VVESSMCITTMSKVGNDLLISVTMPSIEVGVVGGGTGLAAQRGCLELIGCGGPSKESPGT 394

Query: 307 NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           NA+ L+ + AA VL  ELSL++     G L+ AH+RL R
Sbjct: 395 NAQLLSRVVAAGVLSAELSLMSGLA-AGHLLSAHMRLNR 432


>gi|259486924|tpe|CBF85179.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4]
          Length = 416

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 117/345 (33%), Positives = 184/345 (53%), Gaps = 11/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+KI G +    V +P++T E  L  S  RG  +++    G+ A ++ 
Sbjct: 75  IGYMPIPVGVAGPIKINGKM----VFLPMSTTEGALVASTNRGC-MAINAGGGVTALVLG 129

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+      + E A  A Q +        I      +S+F R   + +   G+ L++
Sbjct: 130 DGMTRAPIVRFPSLEEAGAAKQWLGSDAGFLIIEDAFNASSRFARLQNIKATAVGSDLYI 189

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           R   +TGDA G NM++K  +  ++ +    +  +   S+SGN C+DKK  A+N I GRGK
Sbjct: 190 RFTASTGDAMGMNMISKGVEQALEAMQKHGFESMDVVSLSGNFCADKKPAAVNWIEGRGK 249

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
              A+ TI     ++ L+TS E ++ LN  KNL+G+ +AG +   NAH AN++ A YLAT
Sbjct: 250 TVTAQATIPEHAVRETLKTSVEALVELNVSKNLVGSAVAGALGGFNAHAANVVTAIYLAT 309

Query: 243 GQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IE 300
           GQD A  V+ S  LT  K  +  L  S  +P++ +G VG G  +   K  L  +G    +
Sbjct: 310 GQDPAQNVQSSNTLTVMKNVNGDLQISVFMPSIEVGTVGGGTVLGPQKAMLHMMGVQGAD 369

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             + G NA+ LA + AA VL GELSL +A  + G L+++HL   R
Sbjct: 370 PEQPGRNAQELALLVAAGVLAGELSLCSA-LSAGSLVKSHLTHNR 413


>gi|260769139|ref|ZP_05878072.1| hydroxymethylglutaryl-CoA reductase [Vibrio furnissii CIP 102972]
 gi|260614477|gb|EEX39663.1| hydroxymethylglutaryl-CoA reductase [Vibrio furnissii CIP 102972]
          Length = 420

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 177/342 (51%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G        +PLAT E  L  S  RG+ + +    G  A L++
Sbjct: 86  IGTVKVPVGVAGPLRVNGLHASGDYLIPLATTEAALVASYHRGSRL-ITASGGASAMLLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+      N   A   +  +T +      + + T+   +   ++  + GN ++L  
Sbjct: 145 EGVTRTPVLAFYNLAQAGQFVAWVTTQYDVFKSLAQSTTAHGQLHDINVTLEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYL-HYGSVSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A +AV D+I+        Y  + GN+  DKKA +      RGK  
Sbjct: 205 EYLTGDASGQNMVTIATNAVFDFIMQHSPIAPEYAFLDGNLSGDKKANSHVLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ +   + +KYL T+PEK++       L G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 TAEVHLTADLVRKYLHTTPEKMVQFGHMTTLGGA-LSGSI-GVNAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L+    LY S T+PNL++G VG G  +P+ K  L  LG     K
Sbjct: 323 DAACVAESAIGITRMELNKHGGLYASVTLPNLMVGTVGGGTGLPSQKACLDILGLAGNGK 382

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               AR LA + A   L GELS++ A  + G    AH +L R
Sbjct: 383 ----ARALAEVAAGLCLAGELSIVGA-FSAGHFSRAHHKLAR 419


>gi|114599635|ref|XP_526894.2| PREDICTED: 3-hydroxy-3-methylglutaryl-Coenzyme A reductase isoform
           5 [Pan troglodytes]
          Length = 820

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 100/286 (34%), Positives = 153/286 (53%), Gaps = 10/286 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLH---DDSLYFSCTIPNLILGCVGNGKNI 286
           QDAA  V  S  +T  +     ++ LY SCT+P++ +G VG G N+
Sbjct: 766 QDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNL 811


>gi|71656304|ref|XP_816701.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Trypanosoma cruzi strain
           CL Brener]
 gi|70881847|gb|EAN94850.1| 3-hydroxy-3-methylglutaryl-CoA reductase, putative [Trypanosoma
           cruzi]
          Length = 452

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 114/339 (33%), Positives = 178/339 (52%), Gaps = 8/339 (2%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G     +  +P+AT E  L  S  RGA  ++    G +  L+ E M
Sbjct: 117 VPIPLGVAGPILIDGK----EYPIPMATTEGALVASTHRGAR-AITRSGGCKTLLLGEGM 171

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           TR+   E  + E A    +        +    E T+Q+ +   L   +AG   +LR    
Sbjct: 172 TRAPVVELPSLEEAGRLHKYCNENFLSLKEAFESTTQYGKLNSLKCVLAGRKAYLRFRAT 231

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NM+TK  D  +  +   +  +   ++SGN C+DKK +A+N I GRGK+ VAE 
Sbjct: 232 TGDAMGMNMITKGVDKALSVLQQHFPSMEILALSGNYCTDKKPSAVNWIDGRGKSVVAEA 291

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
           T+   + +  L+ + + ++ LN  KNL+G+ +AG +   NA  AN + A ++ATGQD A 
Sbjct: 292 TLLAEVVEDTLKCTVDSLVSLNIDKNLVGSAMAGSVGGFNAQAANAVAAIFIATGQDPAQ 351

Query: 249 IVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGD 306
           +VE S  +T      + L  S T+P++ +G VG G  + A +  L  +GC    +   G 
Sbjct: 352 VVESSMCITTMSKVGNDLLISVTMPSIEVGVVGGGTGLAAQRGCLELIGCGGPSKESPGT 411

Query: 307 NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           NA+ L+ + AA VL  ELSL++     G L+ AH+RL R
Sbjct: 412 NAQLLSRVVAAGVLSAELSLMSGLA-AGHLLSAHMRLNR 449


>gi|67522272|ref|XP_659197.1| hypothetical protein AN1593.2 [Aspergillus nidulans FGSC A4]
 gi|40745144|gb|EAA64300.1| hypothetical protein AN1593.2 [Aspergillus nidulans FGSC A4]
          Length = 705

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 183/342 (53%), Gaps = 11/342 (3%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+KI G +    V +P++T E  L  S  RG  +++    G+ A ++ + M
Sbjct: 367 MPIPVGVAGPIKINGKM----VFLPMSTTEGALVASTNRGC-MAINAGGGVTALVLGDGM 421

Query: 69  TRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
           TR+      + E A  A Q +        I      +S+F R   + +   G+ L++R  
Sbjct: 422 TRAPIVRFPSLEEAGAAKQWLGSDAGFLIIEDAFNASSRFARLQNIKATAVGSDLYIRFT 481

Query: 127 FATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            +TGDA G NM++K  +  ++ +    +  +   S+SGN C+DKK  A+N I GRGK   
Sbjct: 482 ASTGDAMGMNMISKGVEQALEAMQKHGFESMDVVSLSGNFCADKKPAAVNWIEGRGKTVT 541

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A+ TI     ++ L+TS E ++ LN  KNL+G+ +AG +   NAH AN++ A YLATGQD
Sbjct: 542 AQATIPEHAVRETLKTSVEALVELNVSKNLVGSAVAGALGGFNAHAANVVTAIYLATGQD 601

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERK 303
            A  V+ S  LT  K  +  L  S  +P++ +G VG G  +   K  L  +G    +  +
Sbjct: 602 PAQNVQSSNTLTVMKNVNGDLQISVFMPSIEVGTVGGGTVLGPQKAMLHMMGVQGADPEQ 661

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G NA+ LA + AA VL GELSL +A  + G L+++HL   R
Sbjct: 662 PGRNAQELALLVAAGVLAGELSLCSA-LSAGSLVKSHLTHNR 702


>gi|12667060|emb|CAC28161.1| putative 3-hydroxy-3-methylglutaryl coenzyme A reductase
           [Thermococcus litoralis]
          Length = 216

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 132/217 (60%), Gaps = 5/217 (2%)

Query: 62  TLIDERMTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGN 119
           T+ID++MTR+   +  +A  A    Q  E  L+  +  + + + ++  +   +   I GN
Sbjct: 2   TIIDDKMTRAPLLKCPDARRAREVAQWVEENLEYLQ-EKAVSKVTRHGKLRGVKPYIVGN 60

Query: 120 LLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMG 179
            L+LR EF TGDA G NMVT A++ +M  I   +  + Y ++SGN+C DKK  A+N I G
Sbjct: 61  NLYLRFEFETGDAMGMNMVTIASEEIMKVIEEHFPDVKYLALSGNLCVDKKPNAMNFING 120

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
           RGK  +AE  I R I +K L+T+PE I  +N +KNL+G+  AG     NAHF N++ A +
Sbjct: 121 RGKTVIAEAIIPREIVEKKLKTTPELIAEVNYRKNLVGSAQAGSY-GFNAHFGNIVGAIF 179

Query: 240 LATGQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNL 275
           LATGQD A I EGS G+T A++  +  LY S T+P+L
Sbjct: 180 LATGQDEAQITEGSHGITLAEVTPEGDLYISITMPSL 216


>gi|2239278|gb|AAB62280.1| hydroxymethylglutaryl CoA reductase [Trypanosoma cruzi]
          Length = 435

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 114/339 (33%), Positives = 178/339 (52%), Gaps = 8/339 (2%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ I G     +  +P+AT E  L  S  RGA  ++    G +  L+ E M
Sbjct: 100 VPIPLGVAGPILIDGK----EYPIPMATTEGALVASTHRGAR-AITRSGGCKTLLLGEGM 154

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFA 128
           TR+   E  + E A    +        +    E T+Q+ +   L   +AG   +LR    
Sbjct: 155 TRAPVVELPSLEEAGRLHKYCNENFLSLKEAFESTTQYGKLNSLKCVLAGRKAYLRFRAT 214

Query: 129 TGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           TGDA G NM+TK  D  +  +   +  +   ++SGN C+DKK +A+N I GRGK+ VAE 
Sbjct: 215 TGDAMGMNMITKGVDKALSVLQQHFPSMEILALSGNYCTDKKPSAVNWIDGRGKSVVAEA 274

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
           T+   + +  L+ + + ++ LN  KNL+G+ +AG +   NA  AN + A ++ATGQD A 
Sbjct: 275 TLLADVVEDTLKCTVDSLVSLNIDKNLVGSAMAGSVGGFNAQAANAVAAIFIATGQDPAQ 334

Query: 249 IVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGD 306
           +VE S  +T      + L  S T+P++ +G VG G  + A +  L  +GC    +   G 
Sbjct: 335 VVESSMCITTMSKVGNDLLISVTMPSIEVGVVGGGTGLAAQRGCLELIGCGGPSKESPGT 394

Query: 307 NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           NA+ L+ + AA VL  ELSL++     G L+ AH+RL R
Sbjct: 395 NAQLLSRVVAAGVLSAELSLMSGLA-AGHLLSAHMRLNR 432


>gi|297721547|ref|NP_001173136.1| Os02g0713900 [Oryza sativa Japonica Group]
 gi|255671208|dbj|BAH91865.1| Os02g0713900 [Oryza sativa Japonica Group]
          Length = 236

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 139/227 (61%), Gaps = 5/227 (2%)

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R    TGDA G NMV+K  + V+ ++ + +  +   SVSGN CSDKK TA+N I GRGK
Sbjct: 1   MRFSCITGDAMGMNMVSKGVENVLGYLQNVFPDMDVISVSGNYCSDKKPTAVNWIEGRGK 60

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + V E  I   + QK L+T+ EK++ LN  KNL G+ +AG +   NAH +N++ A ++AT
Sbjct: 61  SVVCEAIIKGDVVQKVLKTTVEKLVELNIIKNLAGSAVAGALGGFNAHASNIVTALFIAT 120

Query: 243 GQDAANIVEGSQGLT-YAKLHD-DSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           GQD A  VE SQ +T   +++D D L+ S T+P++ +G +G G  + +    L  LG   
Sbjct: 121 GQDPAQNVESSQCITMLEEVNDGDDLHISVTMPSIEVGTIGGGTCLASQAACLNLLGVKG 180

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                 G NA+RLA I A +VL GELSLLAA  + G L+++H+   R
Sbjct: 181 SNHGSPGANAKRLATIVAGSVLAGELSLLAALAS-GHLVKSHMMYNR 226


>gi|254507682|ref|ZP_05119814.1| Hydroxymethylglutaryl-coenzyme A reductase [Vibrio parahaemolyticus
           16]
 gi|219549379|gb|EED26372.1| Hydroxymethylglutaryl-coenzyme A reductase [Vibrio parahaemolyticus
           16]
          Length = 419

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 160/294 (54%), Gaps = 5/294 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G    D   VPLAT E  L  S  RG+ + +    G  A LI+
Sbjct: 86  IGTVKLPVGIAGPLRVNGLYANDDYLVPLATTEAALVASYNRGSQL-ITAAGGSSAMLIN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   N   A + +  +  +     +V E T+   +   ++  I GN ++L  
Sbjct: 145 EGVTRTPVFAFHNIADAGSFVAWVVTQYDHFKQVAESTTSHGKLHDININIEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           EF TGDASG NMVT A + V  +IL         S + GN+  DKK  A      RGK  
Sbjct: 205 EFHTGDASGQNMVTIATNEVYRYILEHAPIEPKESFLDGNLSGDKKPNAHTMRHVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+T++R + +KYL T+PEK++    Q    G+ L+GGI   NAH+AN L A Y+A GQ
Sbjct: 265 TAEVTLSRHLVEKYLHTTPEKMVKFG-QMTTTGSALSGGI-GVNAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSC-TIPNLILGCVGNGKNIPAIKNNLTALG 297
           DAA + E + G+T  +L+     ++C T+PN+++G VG G  +P+ K  L  LG
Sbjct: 323 DAACVSESAIGITRMELNPQGALYACVTLPNIMVGTVGGGTGLPSQKACLDILG 376


>gi|31323294|gb|AAP44139.1| one-transmembrane-helix HMG-CoA reductase [Homarus americanus]
          Length = 655

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 130/346 (37%), Positives = 183/346 (52%), Gaps = 17/346 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G +      VP+AT E  L  S  RG    +   +G+++ +  + M
Sbjct: 210 VPIPVGVAGPLLMNGKMYM----VPMATTEGCLVASTNRGCRAMV---NGVKSEVFRDGM 262

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIE---QTSQFTRFLQLHSQIAGNLLFLRL 125
           TR+       A  A T +   T KK   A + E    TS+F R   L   IAG LLF+R 
Sbjct: 263 TRAPSVRLPTAAQA-TEVYMWTRKKENFAVIKEGFDSTSRFARLQDLQVGIAGRLLFMRF 321

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NMV+K  +A +  +   +  L   SVSGN C DKK +AIN I GRGK+ V
Sbjct: 322 VAQTGDAMGMNMVSKGTEAGLKALKKHFPELEVLSVSGNYCVDKKPSAINWIEGRGKSVV 381

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  +   +    L+TS   I+  +  KNL+G+ LAG I   NAH AN++ A ++A GQD
Sbjct: 382 CESVVPGKVVTSILKTSVAAIVEASVTKNLVGSSLAGSIGGNNAHAANIIAAMFIACGQD 441

Query: 246 AANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            A +V  S  +T  +      D L+ S T+P+L +G VG G  +      LT LG     
Sbjct: 442 PAQVVGSSNCMTLMEAWGEKGDDLHISVTMPSLEVGTVGGGTGLAPQSACLTMLGVKGAH 501

Query: 303 K--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERM 346
           K   G+NA +LA I AATVL GELSL++A    G L+++HL   R+
Sbjct: 502 KDNPGENACQLAKIVAATVLAGELSLMSALA-AGHLVKSHLAHNRV 546


>gi|158284797|ref|XP_307890.4| AGAP002288-PA [Anopheles gambiae str. PEST]
 gi|157020763|gb|EAA03787.4| AGAP002288-PA [Anopheles gambiae str. PEST]
          Length = 877

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 120/350 (34%), Positives = 180/350 (51%), Gaps = 20/350 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+ + GP+ + G     +  VP+AT E  L  S  RG     L   G+ +   D
Sbjct: 538 IGYVPIPVGYAGPLLLDGK----RYFVPMATTEGALVASTNRGC--KALSVRGVTSFCED 591

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAE-----IARVIEQTSQFTRFLQLHSQIAGNL 120
             MTR+      N    L A Q     +AE     I    + TS++ R   LH  I G +
Sbjct: 592 VGMTRAPCVRFPNV---LRAAQAKRWMEAEDNFKRIKHAFDSTSRYARLRDLHVAIDGPV 648

Query: 121 LFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGR 180
           L++R   +TGDA G NM++K  +  +  + + +  +   S+SGN+CSDKK  AIN IMGR
Sbjct: 649 LYVRFRASTGDAMGMNMLSKGTERALRELQAAFPDMAVVSLSGNVCSDKKPAAINWIMGR 708

Query: 181 GKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYL 240
           GK  V E  I  A     L+T+   ++  N  KN  G+ +AG I   NAH ANM+ A ++
Sbjct: 709 GKRVVCETVIPAASLASILKTNARTLVQCNKLKNWTGSAVAGSIGGNNAHAANMVTAVFI 768

Query: 241 ATGQDAANIVEGSQGLTYAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
           A GQD A  V  S   T  +L  ++   LY +C++P+L +G +G G  +P     L  LG
Sbjct: 769 ACGQDPAQNVTSSNCSTNMELCGETGEDLYITCSMPSLEVGTLGGGTGLPGQSACLNMLG 828

Query: 298 CIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                 T   +NA++LA I  A V+ GELSL++A     +L+++H+R  R
Sbjct: 829 VRGAHPTQPAENAKQLARIICAIVMAGELSLMSALVT-NDLVKSHMRHNR 877


>gi|31323291|gb|AAP44138.1| soluble HMG-CoA reductase [Homarus americanus]
          Length = 599

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 130/346 (37%), Positives = 183/346 (52%), Gaps = 17/346 (4%)

Query: 9   ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
           + +P+   GP+ + G +      VP+AT E  L  S  RG    +   +G+++ +  + M
Sbjct: 154 VPIPVGVAGPLLMNGKMYM----VPMATTEGCLVASTNRGCRAMV---NGVKSEVFRDGM 206

Query: 69  TRSIFFETENAEMALTALQEITLKKAEIARVIE---QTSQFTRFLQLHSQIAGNLLFLRL 125
           TR+       A  A T +   T KK   A + E    TS+F R   L   IAG LLF+R 
Sbjct: 207 TRAPSVRLPTAAQA-TEVYMWTRKKENFAVIKEGFDSTSRFARLQDLQVGIAGRLLFMRF 265

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NMV+K  +A +  +   +  L   SVSGN C DKK +AIN I GRGK+ V
Sbjct: 266 VAQTGDAMGMNMVSKGTEAGLKALKKHFPELEVLSVSGNYCVDKKPSAINWIEGRGKSVV 325

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  +   +    L+TS   I+  +  KNL+G+ LAG I   NAH AN++ A ++A GQD
Sbjct: 326 CESVVPGKVVTSILKTSVAAIVEASVTKNLVGSSLAGSIGGNNAHAANIIAAMFIACGQD 385

Query: 246 AANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEER 302
            A +V  S  +T  +      D L+ S T+P+L +G VG G  +      LT LG     
Sbjct: 386 PAQVVGSSNCMTLMEAWGEKGDDLHISVTMPSLEVGTVGGGTGLAPQSACLTMLGVKGAH 445

Query: 303 K--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERM 346
           K   G+NA +LA I AATVL GELSL++A    G L+++HL   R+
Sbjct: 446 KDNPGENACQLAKIVAATVLAGELSLMSALAA-GHLVKSHLAHNRV 490


>gi|224034491|gb|ACN36321.1| unknown [Zea mays]
          Length = 241

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 135/227 (59%), Gaps = 5/227 (2%)

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R   +TGDA G NMV+K    V+D++ + +  +   S+SGN CSDKK+ A+N I GRGK
Sbjct: 1   MRFSCSTGDAMGMNMVSKGVQNVLDYLQADFPDMDVISISGNFCSDKKSAAVNWIDGRGK 60

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           + V E  I   + +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++AT
Sbjct: 61  SVVCEAVIKEEVVKKVLKTNVQALVELNVIKNLAGSAVAGALGGFNAHASNIVAAIFIAT 120

Query: 243 GQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC-- 298
           GQD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG   
Sbjct: 121 GQDPAQNVESSQCITMLEAINDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLDLLGVKG 180

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                 G NAR LA + A  VL  ELSL++AQ   G L+++H++  R
Sbjct: 181 ANRESPGSNARLLATVVAGAVLAAELSLISAQA-AGHLVQSHMKYNR 226


>gi|153832835|ref|ZP_01985502.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio harveyi HY01]
 gi|148870969|gb|EDL69859.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio harveyi HY01]
          Length = 420

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 177/344 (51%), Gaps = 14/344 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++++P+   GP++I G    D   VPLAT E  L  S  RGA++ +    G    LI 
Sbjct: 86  IGTVNVPVGVAGPLRINGLYANDDYLVPLATTEAALVASYNRGANL-ITAAGGASTLLIS 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E ++R+  F  ++   A   +  +  +     +  E T+   +   ++  I GN ++L  
Sbjct: 145 EGVSRTPVFGFQSLAEAAQFVSWVVTQYDIFRKEAESTTTHGKLKDINVNIEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A   V  +IL         + + GN+  DKKA A      RGK  
Sbjct: 205 EYVTGDASGQNMVTIATHKVFHYILEHSPIAPVDAYLDGNLSGDKKANAHTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+TI  A+ +KYL T+PE ++    + N +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 SAEVTIPAALVEKYLHTTPEAMVKFG-KMNTVGGLLSGTI-GINAHYANALTALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           DAA + E + G+T  ++  DS   LY S T+PN+++G VG G  +P  K  L  LG    
Sbjct: 323 DAACVAESAVGIT--RMDVDSQGNLYTSVTLPNIMVGTVGGGTGLPTQKACLDILGLHGN 380

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            K    A+ LA + A   L GELS++ A         AH +L R
Sbjct: 381 GK----AKALAEVAAGLCLAGELSIVGAFC-ADHFSRAHHKLAR 419


>gi|293335277|ref|NP_001169411.1| hypothetical protein LOC100383280 [Zea mays]
 gi|224029191|gb|ACN33671.1| unknown [Zea mays]
          Length = 356

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 104/300 (34%), Positives = 166/300 (55%), Gaps = 7/300 (2%)

Query: 52  SMLCPDGIRATLIDERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRF 109
           S  C  G  + L+ + M+R+   +  + + A  L A  E       +A V  ++S+F + 
Sbjct: 47  SHRCVWGAFSVLLRDAMSRAPVVKLPSIKRAAELKAFVETHTNFETLAAVFNRSSRFGKL 106

Query: 110 LQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDK 169
             +H  +AG  L++R   +TGDA G NMV+K  + V+ ++ + +  +   S+SGN CSDK
Sbjct: 107 QGIHCALAGRNLYMRFTCSTGDAMGMNMVSKGVEDVLGYLQNDFPDMDLISLSGNYCSDK 166

Query: 170 KATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANA 229
           KA A+N I GRGK+ V E  +   + Q  L+T+ +K++ LN  KNL G+ +AG +   NA
Sbjct: 167 KAAAVNWIEGRGKSVVCEARVKGGVVQSVLKTTVQKLVELNIVKNLAGSAVAGALGGFNA 226

Query: 230 HFANMLLAYYLATGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIP 287
           H +N++ A ++ATGQD A  VE SQ +T  +  +D   L+ S T+P++ +G VG G  + 
Sbjct: 227 HASNIVTALFIATGQDPAQNVESSQCITMMEAVNDGGDLHISVTMPSIEVGTVGGGTCLA 286

Query: 288 AIKNNLTALGCIEERK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +    L  LG     +   G NAR LA I A +VL      L A    G+L+++H++  R
Sbjct: 287 SQAACLNLLGVRGPNRDSPGANARILATIVAGSVLA-GELSLLAALAAGQLVKSHMKYNR 345


>gi|124003246|ref|ZP_01688096.1| hydroxymethylglutaryl-coenzyme A reductase [Microscilla marina ATCC
           23134]
 gi|123991344|gb|EAY30775.1| hydroxymethylglutaryl-coenzyme A reductase [Microscilla marina ATCC
           23134]
          Length = 517

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 103/316 (32%), Positives = 159/316 (50%), Gaps = 10/316 (3%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+ + GP+K+ G   + +  +PLAT E  L  S  RG  +  +   G++ T+I + M R
Sbjct: 186 VPLGFAGPLKVNGEHAKGEFLIPLATAEGTLVASYNRGMSVINMS-GGVKCTIIGDAMQR 244

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  E+A  A   ++ +   +  IA   E TS   +   +   ++    FLR  + TG
Sbjct: 245 APVFIFEDARGARDFVKWVHAHEKTIAYHAETTSSVAKLQDIDHYLSNKFAFLRFNYFTG 304

Query: 131 DASGHNMVTKAADAVMDWILSQW--SYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEI 188
           DA+G NMV +A  A   WIL  +  + +    +  N  +DKKA+ IN +  RGK  VAE 
Sbjct: 305 DAAGQNMVGRATFAACSWILDNYKDNKIEKFFLESNFATDKKASQINVMRTRGKRVVAEC 364

Query: 189 TINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAAN 248
            + R +  + +R  PE++       N IG  L+G   +   H AN + A ++ATGQD AN
Sbjct: 365 VVKRDVLIQRMRVEPEQLAYHGQVAN-IGAILSGA-NNNGLHSANAITAMFIATGQDVAN 422

Query: 249 IVEGSQGLTYAKL-HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307
           + E S G+ Y+++  +  LY S TIP+LI+   G G  +   K  L  L C  + K    
Sbjct: 423 VSESSAGIIYSEVTAEGDLYISITIPSLIVATYGGGTGLATQKECLELLDCYGKGKV--- 479

Query: 308 ARRLAAICAATVLCGE 323
             + A I A  VL GE
Sbjct: 480 -NKFAEIVAGAVLAGE 494


>gi|156976919|ref|YP_001447825.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio harveyi ATCC
           BAA-1116]
 gi|156528513|gb|ABU73598.1| hypothetical protein VIBHAR_05704 [Vibrio harveyi ATCC BAA-1116]
          Length = 420

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 120/344 (34%), Positives = 177/344 (51%), Gaps = 14/344 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++++P+   GP++I G    D   VPLAT E  L  S  RGA++ +    G    LI 
Sbjct: 86  IGTVNVPVGVAGPLRINGLYANDDYLVPLATTEAALVASYNRGANL-ITAAGGASTLLIS 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E ++R+  F  ++   A   +  +  +     +  E T+   +   ++  I GN ++L  
Sbjct: 145 EGVSRTPVFGFQSLAEAAQFVSWVVTQYDIFRKEAESTTTHGKLKDINVNIEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A   V  +IL         + + GN+  DKKA A      RGK  
Sbjct: 205 EYVTGDASGQNMVTIATHKVFHYILEHSPIAPVDAYLDGNLSGDKKANAHTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+TI  A+ +KYL T+PE ++    + N +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 SAEVTIPAALVKKYLHTTPEAMVKFG-KMNTVGGLLSGTI-GINAHYANALTALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDDS---LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           DAA + E + G+T  ++  DS   LY S T+PN+++G VG G  +P  K  L  LG    
Sbjct: 323 DAACVAESAVGIT--RMDVDSQGNLYTSVTLPNIMVGTVGGGTGLPTQKACLDILGLHGN 380

Query: 302 RKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            K    A+ LA + A   L GELS++ A         AH +L R
Sbjct: 381 GK----AKALAEVAAGLCLAGELSIVGAFC-ADHFSRAHHKLAR 419


>gi|332142922|ref|YP_004428660.1| Hydroxymethylglutaryl-coenzyme A reductase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|332143033|ref|YP_004428771.1| Hydroxymethylglutaryl-coenzyme A reductase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327552944|gb|AEA99662.1| Hydroxymethylglutaryl-coenzyme A reductase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327553055|gb|AEA99773.1| Hydroxymethylglutaryl-coenzyme A reductase [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 514

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 110/314 (35%), Positives = 158/314 (50%), Gaps = 8/314 (2%)

Query: 11  MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70
           +P+   GP+KI G   Q +  VPLAT E  L  S  RG  +  +   G+ AT++D+ M R
Sbjct: 185 VPIGIAGPIKINGENAQGEFVVPLATTEGTLVASYNRGMKLLNMS-GGVTATVVDDAMQR 243

Query: 71  SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATG 130
           +  F  ENA  A   ++ I     +I    E TS       +   ++    FLR  F TG
Sbjct: 244 APVFIFENARGARDFVKWIKENFEKIKEEAEATSSVATLTYIDHFLSNKFAFLRFNFRTG 303

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DA+G NMV +A  A   WIL  +  +    +  N  +DKKA+ IN +  RGK   AE TI
Sbjct: 304 DAAGQNMVGRATFAACGWILDHYEGIENFYLESNFATDKKASQINIMRTRGKRVTAEATI 363

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
            R    + +R  P++I   + +   +G+FL+ G+ +   H  N + A ++ATGQD AN+ 
Sbjct: 364 KREHLLEVMRVDPKQID-YHGRVAGVGSFLS-GVNNTGLHSPNGITAMFIATGQDVANVS 421

Query: 251 EGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNAR 309
           E S  + Y++L DD  LY S TIP+LI+   G G  I   +  L  L C       D   
Sbjct: 422 ESSAAMMYSELTDDGDLYVSITIPSLIVATYGGGTGIGTQRECLELLDCYGR----DRVY 477

Query: 310 RLAAICAATVLCGE 323
           + A I A+ VL GE
Sbjct: 478 KFAEIVASVVLAGE 491


>gi|64310803|gb|AAY41278.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase protein [Dioscorea
           zingiberensis]
          Length = 221

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 131/217 (60%), Gaps = 3/217 (1%)

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DA G NMV+K    V++++   +   H  S+SGN CSDKK+ A+N I GRGK+ V   TI
Sbjct: 1   DAMGMNMVSKGVQNVLEYLWGDFPDTHVISISGNYCSDKKSAAVNWIEGRGKSVVCGATI 60

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
              + +K L+T+   +I LNT KNL+G+ +AG +   NAH +N++ A ++ATGQD A  V
Sbjct: 61  KEEVVEKVLKTTVSALIELNTAKNLVGSAVAGSLGGFNAHASNIVSAIFIATGQDPAQNV 120

Query: 251 EGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE--RKTGDNA 308
           E SQ LT  +     LY S ++P + +G VG G  + A    L  LG         G N+
Sbjct: 121 ESSQCLTLFERDGKDLYVSVSMPCIEVGTVGGGTQLAAQAACLELLGVKGAGLETPGSNS 180

Query: 309 RRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           RRLA+I A  VL GELSL++A  + G+L+++H++  R
Sbjct: 181 RRLASIIAGAVLAGELSLMSALAS-GQLVKSHMKYNR 216


>gi|3851620|gb|AAC72378.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum tuberosum]
          Length = 255

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 138/238 (57%), Gaps = 5/238 (2%)

Query: 112 LHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKA 171
           +   IAG  L++R   +TGDA G NMV+K    V+D++ +++  +    +SGN CSDKK 
Sbjct: 9   IQCAIAGKNLYMRFVCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKP 68

Query: 172 TAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHF 231
            A+N I GRGK+ V E  I   + +K L+T    ++ LN  KNL G+ +AG +   NAH 
Sbjct: 69  AAVNWIEGRGKSVVCEAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHA 128

Query: 232 ANMLLAYYLATGQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAI 289
           +N++   ++ATGQD A  +E S  +T  +  +D   L+ S T+P++ +G VG G  + + 
Sbjct: 129 SNIVSTVFIATGQDPAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQ 188

Query: 290 KNNLTALGC--IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              L  LG         G NAR LA + A +VL GELSL++A  + G+L+ +H++  R
Sbjct: 189 SACLNLLGVKGANREAPGSNARLLATVVAGSVLAGELSLMSA-ISAGQLVNSHMKYNR 245


>gi|262168567|ref|ZP_06036263.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae RC27]
 gi|262023096|gb|EEY41801.1| hydroxymethylglutaryl-CoA reductase [Vibrio cholerae RC27]
          Length = 372

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 184/345 (53%), Gaps = 13/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYE---YPLWHSVKRGAHISMLCPDGIRAT 62
           + ++ +P+   GP+++ G+  Q    VPLAT E     L  S  RG+ + +    G  A 
Sbjct: 36  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVALVASYHRGSQL-ITAAGGASAL 94

Query: 63  LIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           +++E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++
Sbjct: 95  VLNEGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVY 154

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRG 181
           L  E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RG
Sbjct: 155 LVFEYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRG 214

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K   AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A
Sbjct: 215 KKVSAEVHLSAELVKKYLHTTPEQMMQFG-QMTTVGGALSGAI-GVNAHYANALAALYIA 272

Query: 242 TGQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            GQDAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   
Sbjct: 273 CGQDAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAG 332

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +     +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 333 Q----GHARALAEVAAALCLAGELSIVGAFC-AGHFSRAHHKLAR 372


>gi|147671466|ref|YP_001215501.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae O395]
 gi|146313849|gb|ABQ18389.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio cholerae O395]
          Length = 420

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 184/345 (53%), Gaps = 13/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYE---YPLWHSVKRGAHISMLCPDGIRAT 62
           + ++ +P+   GP+++ G+  Q    VPLAT E     L  S  RG+ + +    G  A 
Sbjct: 84  IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVALVASYHRGSQL-ITAAGGASAL 142

Query: 63  LIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           +++E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++
Sbjct: 143 VLNEGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVY 202

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRG 181
           L  E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RG
Sbjct: 203 LVFEYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRG 262

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K   AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A
Sbjct: 263 KKVSAEVHLSAELVKKYLHTTPEQMMQFG-QMTTVGGALSGAI-GVNAHYANALAALYIA 320

Query: 242 TGQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            GQDAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   
Sbjct: 321 CGQDAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAG 380

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +     +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 381 Q----GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 420


>gi|227015214|gb|ACP11423.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae O395]
          Length = 439

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 184/345 (53%), Gaps = 13/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYE---YPLWHSVKRGAHISMLCPDGIRAT 62
           + ++ +P+   GP+++ G+  Q    VPLAT E     L  S  RG+ + +    G  A 
Sbjct: 103 IGTVKLPVGIAGPLRVNGSHAQGDYLVPLATTEAALVALVASYHRGSQL-ITAAGGASAL 161

Query: 63  LIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
           +++E +TR+  F   +   A   +  +T +  ++  + + T+   +   +   I GN ++
Sbjct: 162 VLNEGVTRTPVFAFLSLAQAGQFVGWVTSQFEQMKEIAQSTTAHGKLKDIQVNIEGNHVY 221

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRG 181
           L  E+ TGDASG NMVT A  AV ++I+         + + GN+  DKKA +      RG
Sbjct: 222 LVFEYTTGDASGQNMVTIATHAVFEFIMRHSPVAPVQAFLDGNLSGDKKANSYTLRSVRG 281

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLA 241
           K   AE+ ++  + +KYL T+PE+++    Q   +G  L+G I   NAH+AN L A Y+A
Sbjct: 282 KKVSAEVHLSAELVKKYLHTTPEQMMQFG-QMTTVGGALSGAI-GVNAHYANALAALYIA 339

Query: 242 TGQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            GQDAA + E + G+T  ++H    LY S T+PNL++G VG G ++P+    L+ +G   
Sbjct: 340 CGQDAACVAESAIGMTRMEIHPHGGLYASVTLPNLMVGTVGGGTHLPSQHACLSLMGLAG 399

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +     +AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 400 Q----GHARALAEVAAALCLAGELSIVGAFCA-GHFSRAHHKLAR 439


>gi|55379948|ref|YP_137798.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Haloarcula
           marismortui ATCC 43049]
 gi|55232673|gb|AAV48092.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Haloarcula
           marismortui ATCC 43049]
          Length = 405

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 121/341 (35%), Positives = 174/341 (51%), Gaps = 5/341 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V +  +PM  +GP+ + G   +    +PLAT E  L  SV RG   ++    G  A ++ 
Sbjct: 69  VGAAQVPMGVVGPLPVDGGAAEGDHHLPLATSEGALLASVNRGVS-TIRNAGGATARVLK 127

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F  E+   A      +      +A   E T+       +   + G+ +FLR 
Sbjct: 128 SGMTRAPVFRVEDVAEAGEVSAWVREHVDVLADAAESTTSHGELQDVTPYVVGDSVFLRF 187

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NM T A +A  D + ++ +     ++SGN+CSDKK  AIN + GRG+   
Sbjct: 188 SYDTKDAMGMNMATIATEAACDVVETE-TPADLVALSGNLCSDKKPAAINAVEGRGRTVA 246

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++ I     +  L T+ + I+  NT+KNL+G+  AG +   NAH AN++ A +LA GQD
Sbjct: 247 ADVLIPHEQVEDRLDTTSDAIVEANTRKNLVGSAKAGAL-GFNAHAANVVAAAFLALGQD 305

Query: 246 AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG-CIEERKT 304
            A +VEGS  +T     +D LY S TI +L +G VG G  +P     L  LG        
Sbjct: 306 MAQVVEGSNAITTVDAREDGLYASVTIASLEVGTVGGGTGLPTQSEALDVLGYSGGGDPA 365

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           G NA  LA + AA  L GELSLLAA ++   L  AH  L R
Sbjct: 366 GSNADALAEVIAAGALAGELSLLAALSSR-HLSSAHADLGR 405


>gi|124486467|ref|YP_001031083.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanocorpusculum
           labreanum Z]
 gi|124364008|gb|ABN07816.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanocorpusculum
           labreanum Z]
          Length = 404

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 114/349 (32%), Positives = 173/349 (49%), Gaps = 21/349 (6%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G        +PLAT E  L  S+ RG   ++    G    ++ 
Sbjct: 65  IGCVQIPLGVAGPLTVKGEYANGSFWLPLATTEGALVASINRGCS-AITKAGGTEVRILR 123

Query: 66  ERMTRSIFFETEN----AEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLL 121
           + MTR+  F  ++    AE+A  A   + L K       E+T+     + L +  AG  +
Sbjct: 124 DGMTRAPIFAAKSVAHAAEVARWAEDNLLLLKV----AAEETTNHGELIGLTTYTAGTSV 179

Query: 122 FLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           F+R EF T DA G NM T A++A    I  + +     +VSGN+C DKK +AIN I GRG
Sbjct: 180 FIRFEFDTKDAMGMNMATIASEAAAHLI-EEETKAKLIAVSGNMCCDKKPSAINIIEGRG 238

Query: 182 KNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA---- 237
           K   A + ++  +     +T+   +  +NT+KNL G+      R+A+  F          
Sbjct: 239 KTVSAGVFLSDELVSMVFKTNSATLAEVNTRKNLTGS-----ARAASFGFNAQAANVVAA 293

Query: 238 YYLATGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALG 297
            ++A GQD A++VEGS  +T   L +  +Y S T+P+L +G +G G +I      L+ LG
Sbjct: 294 MFIACGQDPAHVVEGSNAITTVDLVEGGVYVSVTLPSLQVGTIGGGTSIATQNACLSTLG 353

Query: 298 CI-EERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                   GDNA+  A I A+ VL GELSLL A      L +AH  L R
Sbjct: 354 VAGGAENPGDNAKAFAEIVASGVLAGELSLLGA-LGAQHLGKAHRELGR 401


>gi|291229006|ref|XP_002734467.1| PREDICTED: 3-hydroxy-3-methylglutaryl-Coenzyme A reductase-like,
           partial [Saccoglossus kowalevskii]
          Length = 645

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 161/297 (54%), Gaps = 20/297 (6%)

Query: 4   KKVSSISMPMRWIGPMKITG-NVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPD----- 57
           K+   ++ P++ +     +G NVI  K+ V      + L +S + G  I+   P+     
Sbjct: 341 KRTVVMTTPVKCLDNETKSGDNVISGKLHVDKNDVSHTLENSCQDGNDIN---PELNSLS 397

Query: 58  ------GIRATLIDERMTRSIFFETENAEMA--LTALQEITLKKAEIARVIEQTSQFTRF 109
                 G+R++L+ + MTR+      +A++A  +    E       +      TS+F R 
Sbjct: 398 HQKMSGGLRSSLLADGMTRAPVVRLPSAQLASEVKKWLEDHDNFELVGESFNSTSRFARL 457

Query: 110 LQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDK 169
            +L   +AG L+++R +  TGDA G NMV+KA +  +  +   +  L   S+SGN C+DK
Sbjct: 458 QRLQIAVAGRLVYIRFQAITGDAMGMNMVSKAVEKSLLLLKDHFPELEVLSLSGNYCTDK 517

Query: 170 KATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANA 229
           K+ A+N I GRGK+ V E TI   + +K L+TS   ++ LN  KNL+G+ +AG I   NA
Sbjct: 518 KSAAMNWIEGRGKSVVCEATIPAHVVEKVLKTSANALVDLNISKNLVGSSMAGSIGGFNA 577

Query: 230 HFANMLLAYYLATGQDAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNG 283
           H AN++ A Y+ATGQDAA ++  S  +T  +      + LY +CT+P++ +G VG G
Sbjct: 578 HAANIVAAIYIATGQDAAQVISSSSCITLMETTGPMQNDLYITCTMPSVEVGTVGGG 634


>gi|146328197|emb|CAM58114.1| Hydroxymethylglutaryl-CoA reductase [uncultured marine
           microorganism]
          Length = 409

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 116/342 (33%), Positives = 170/342 (49%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP++I G       +VPLAT E  L  S  RG  + +    G  A ++D
Sbjct: 65  IGTVDVPVGLAGPLRIKGRHGTKDYQVPLATTEAALVASYNRGCQL-ITAAGGCNARVVD 123

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + ++R+  F   +   A      I    AE   V+ + +   R +   + + GN ++L L
Sbjct: 124 QAVSRTPMFAFTSVVDAERFANFIAEHSAEFKSVVAKITSHGRLISTRAVVEGNHIYLDL 183

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYL-HYGSVSGNICSDKKATAINGIMGRGKNF 184
            F TGDASG NMVT AADA+   ILS+      +  +  N   DKKAT+      RGK  
Sbjct: 184 RFETGDASGQNMVTFAADAICKTILSRAPIQPEHWFLEANFSGDKKATSKTLGSVRGKRV 243

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            A+I + R + ++ L T PE ++       L G     G      HFAN L A YLA GQ
Sbjct: 244 CADICLPRELVRETLHTMPEHMVDYWVAGALGGVM--SGTTGIQGHFANGLTALYLACGQ 301

Query: 245 DAANIVEGSQGLTYAK-LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           D A + E + G+T  +   +  LY S T+PN+++G VG G  +P+ K  L  LG      
Sbjct: 302 DVACVAESATGMTRLETTAEGDLYASVTLPNIMVGTVGGGTGLPSTKACLDILGL----S 357

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              N+  LA +CAA VL GELS++ A  + G+   AH  L R
Sbjct: 358 GPGNSSALAEVCAAIVLAGELSIIGAFCS-GDFAMAHRSLSR 398


>gi|284163829|ref|YP_003402108.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Haloterrigena
           turkmenica DSM 5511]
 gi|284013484|gb|ADB59435.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Haloterrigena
           turkmenica DSM 5511]
          Length = 408

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 118/349 (33%), Positives = 173/349 (49%), Gaps = 16/349 (4%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +  +PM  +GP+ + G        +PLAT E  L  SV RG  + +    G  A +  
Sbjct: 67  IGAAQVPMGVVGPVPVDGGAATGDHYLPLATTEGALLASVNRGLGV-IRSAGGADARVTK 125

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F       A   ++ +      +A   E T+     + +   + G+ ++LR 
Sbjct: 126 NGMTRAPVFRVAGVAEAAETVEWVNENTEALAEAAESTTSHGELIDVEPYVVGDSVYLRF 185

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NM T A     + I+ + +     ++SGN+CSDKK  AIN + GRG++  
Sbjct: 186 AYDTKDAMGMNMATIATGEACE-IVERETPADLVALSGNLCSDKKPAAINAVEGRGRSVT 244

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A+  I   + +  L T+PE I   NT+KNL G+  AG +   NAH AN++ A +LATGQD
Sbjct: 245 ADAVIPGELVEDRLHTTPEAIAEANTRKNLTGSAKAGSL-GFNAHAANVVAAAFLATGQD 303

Query: 246 AANIVEGSQGLTY--AKLHDD---SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIE 300
            A +VE +  +T   A+  +D    LY S ++ +L +G VG G  +P     L  LG   
Sbjct: 304 EAQVVEAANAITTMDAREREDGTTDLYASVSLASLEVGTVGGGTKLPTQSEALEVLGL-- 361

Query: 301 ERKTGD----NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            R  GD    NA  LA I A   L GELSLL A ++   L  AH  L R
Sbjct: 362 -RGGGDPPGSNADALAEIIAVGALAGELSLLGALSSR-HLASAHEDLGR 408


>gi|83950038|ref|ZP_00958771.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Roseovarius
           nubinhibens ISM]
 gi|83837937|gb|EAP77233.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Roseovarius
           nubinhibens ISM]
          Length = 421

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/341 (32%), Positives = 174/341 (51%), Gaps = 9/341 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+  +GP+++ G        VPLAT E  L  S  RGA  +     G+   ++ 
Sbjct: 87  IGTVKVPVGLVGPLRLNGMNANGDFYVPLATTEAALVASYARGAFAAGRA-GGVSTAVLY 145

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E + R+  F  ++   A   +  +      +  V E T++  + + L   I  N++FL  
Sbjct: 146 EGVLRTPAFVFQSLLQAGQFVDWVVGNVEALQAVAEATTRHGKLVSLEPFIDTNIVFLIC 205

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSY-LHYGSVSGNICSDKKATAINGIMGRGKNF 184
            + TGDA+G NMVT A DA+   I       +    + GN   DKKA+A+  + GRG+  
Sbjct: 206 RYTTGDAAGQNMVTIATDALCRAIAKDCPVPIESWYIEGNFSGDKKASALAMVTGRGRKV 265

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            A IT+   + +K L TS E ++      NL G  L+G +  A AH+AN L A+Y+ATGQ
Sbjct: 266 SASITLPAGVVEKTLGTSVEAMLAYGRVANL-GAHLSGQL-GAQAHYANGLAAFYIATGQ 323

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
           DAA + E + G+T  +   + L+ S T+PN+++G VG G  +P+    L  LG     K 
Sbjct: 324 DAACVAESAVGVTRMEPRGEDLFCSVTLPNILVGSVGGGTGLPSQSAALNILGL----KG 379

Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +   LA + AA  LCGE+S++AA    G    AH  L R
Sbjct: 380 AGHGTALAEVAAALCLCGEISIVAA-IAAGHFTRAHESLAR 419


>gi|289622135|emb|CBI51313.1| unnamed protein product [Sordaria macrospora]
          Length = 1156

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 120/342 (35%), Positives = 183/342 (53%), Gaps = 11/342 (3%)

Query: 9    ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68
            + +P+   GP+ I G        VP+AT E  L  S  RG   ++    G    L  + M
Sbjct: 786  MPLPVGVAGPLVIDGQ----SYFVPMATTEGVLVASTSRGCK-AINSGGGAVTVLTADGM 840

Query: 69   TRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126
            TR    + E  E A  A   +  +K +  + +    TS+F R   + + +AG  L++R +
Sbjct: 841  TRGPCVQFETLERAGAAKLWLDSEKGQSTMKKAFNSTSRFARLESMKTAMAGTNLYIRFK 900

Query: 127  FATGDASGHNMVTKAADAVMDWILSQ-WSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
              TGDA G NM++K  +  +  + ++ +  ++  SVSGN C+DKK  AIN I GRGK+ V
Sbjct: 901  TTTGDAMGMNMISKGVEHALSVMYNEGFEDMNIVSVSGNYCTDKKPAAINWIDGRGKSVV 960

Query: 186  AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            AE  I   + +  L+T  + ++ LN  KNLIG+ +AG +   NAH AN++ A +LATGQD
Sbjct: 961  AEAIIPGDVVKNVLKTDVDTLVELNVNKNLIGSAMAGSVGGFNAHAANIVAAIFLATGQD 1020

Query: 246  AANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304
             A +VE +  +T  +    +L  S ++P++ +G +G G  +      L  LG      T 
Sbjct: 1021 PAQVVESANCITLMRNLRGNLQISVSMPSIEVGTLGGGTILEPQSAMLDMLGVRGPHPTN 1080

Query: 305  -GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             G+NARRLA + AA VL GELSL +A    G L++AH+   R
Sbjct: 1081 PGENARRLARVVAAAVLAGELSLCSALAA-GHLVKAHMAHNR 1121


>gi|195573222|ref|XP_002104594.1| GD21034 [Drosophila simulans]
 gi|194200521|gb|EDX14097.1| GD21034 [Drosophila simulans]
          Length = 257

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 99/233 (42%), Positives = 135/233 (57%), Gaps = 6/233 (2%)

Query: 118 GNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGI 177
           G  L++R    TGDA G NMV+K A+  +  I  Q+  +   S+SGN C DKK  AIN I
Sbjct: 3   GPQLYIRFVAITGDAMGMNMVSKGAEMALRRIQLQFPDMQIISLSGNFCCDKKPAAINWI 62

Query: 178 MGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA 237
            GRGK  V E TI+ A  +  LRT  + ++  N  KN+ G+ +AG I   NAH ANM+ A
Sbjct: 63  KGRGKRVVTECTISAATLRSVLRTDAKTLVECNKLKNMGGSAMAGSIGGNNAHAANMVTA 122

Query: 238 YYLATGQDAANIVEGSQGLTYAKL---HDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLT 294
            +LATGQD A  V  S   T  +    + + LY +CT+P+L +G VG G  +P     L 
Sbjct: 123 VFLATGQDPAQNVTSSNCSTAMECWAENSEDLYMTCTMPSLEVGTVGGGTGLPGQSACLE 182

Query: 295 ALGC--IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            LG       + GDNA++LA I  ATV+ GELSL+AA  N  +L+++H+R  R
Sbjct: 183 MLGVRGAHPTRPGDNAKKLAQIVCATVMAGELSLMAALVN-SDLVKSHMRHNR 234


>gi|91208651|gb|ABE27875.1| hydroxymethylglutaryl-coenzyme A reductase [Arnebia euchroma]
          Length = 562

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 114/344 (33%), Positives = 184/344 (53%), Gaps = 16/344 (4%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ ++  P+ I G ++ D  +  VP+AT E  L  S  RG   ++    G  + ++ + 
Sbjct: 219 MPIGYVQLPVGIAGPLLLDDKEYSVPMATTEGCLVASTNRGCK-AIYASGGATSVVLRDG 277

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR+  + F T      L    E  L    ++ V  Q+S+F R   +   IAG  L++R 
Sbjct: 278 MTRAPVVRFGTAKRAAELKFFLEDPLNFETLSAVFNQSSRFGRLQSIKCAIAGKNLYMRF 337

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
             +TGDA G NMV+K    V++++  ++  +    +SGN CSDKK  A+N I GRGK+ V
Sbjct: 338 SCSTGDAMGMNMVSKGTQHVIEFLEKEFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVV 397

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
            E  I   + +K L+T      L    + L+  +   G+   NAH +N++ A ++ATGQD
Sbjct: 398 CEAIIEDVV-KKVLKTMCSCGAL--HAQELLSQWR--GLWWINAHASNIVSAIFIATGQD 452

Query: 246 AANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
            A  +E S  +T  +  ++   L+ S T+P++ +G VG G  + +    L  LG     +
Sbjct: 453 PAQNIESSHCITMMEAVNEGKDLHVSVTMPSIEVGTVGGGTQLASQAACLNLLGVKGANR 512

Query: 304 --TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              G NAR+LAAI A +VL GELSL++A    G+L+++H++  R
Sbjct: 513 ECPGANARQLAAIVAGSVLAGELSLMSA-IAAGQLVKSHMKYNR 555


>gi|328876358|gb|EGG24721.1| hydroxymethylglutaryl CoA reductase [Dictyostelium fasciculatum]
          Length = 396

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 88/222 (39%), Positives = 134/222 (60%), Gaps = 5/222 (2%)

Query: 128 ATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAE 187
           +TGDA G NMV+K  +  ++ I   +  +   S+SGN+C+DKK +AIN + GRGK+ V E
Sbjct: 154 STGDAMGMNMVSKGVEKALEVITEYFPEIDVLSLSGNVCTDKKPSAINWLEGRGKSVVCE 213

Query: 188 ITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAA 247
             I+  I +  L+TS + ++ LN  KNLIG+ +AG +   NAH +N++ A Y+ATGQD A
Sbjct: 214 AIISGDIVRDVLKTSVDSLVSLNIDKNLIGSAMAGSVGGFNAHASNIVTALYIATGQDPA 273

Query: 248 NIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKN--NLTALGCIEERK 303
             VE S  +T  +  +D   LY S T+P++ +G VG G ++PA     +L  +      K
Sbjct: 274 QNVESSNCITLMEQINDGKDLYISVTMPSIEVGTVGGGTHLPAQAACLDLLKIRGANLEK 333

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            G N+ +LA + A  V+ GELSL++A    G L+ +HL+  R
Sbjct: 334 PGANSEQLARVVAGAVMAGELSLMSALA-AGHLVRSHLKHNR 374


>gi|312883345|ref|ZP_07743071.1| hydroxymethylglutaryl-CoA reductase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368961|gb|EFP96487.1| hydroxymethylglutaryl-CoA reductase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 419

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 119/347 (34%), Positives = 180/347 (51%), Gaps = 20/347 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G        +PLAT E  L  S  RGA + +    G    L+ 
Sbjct: 86  IGTVKVPVGIAGPIRVNGLHANGDYLIPLATTEAALVASYNRGAKL-ITEAGGASTMLLK 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F  +    A   +  ++ +      V E T++  + + ++  I  N +    
Sbjct: 145 EGITRTPVFVFQRLAQAGEFVAWLSTQVDHFKAVAETTTKHGKLVNVNFNIESNQVHTIF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILS------QWSYLHYGSVSGNICSDKKATAINGIMG 179
           E+ TGDASG NMVT A +A+  +IL       + +YL       N+  DKK T+      
Sbjct: 205 EYHTGDASGQNMVTIATNAIYSFILKNSPIEPEEAYLE-----SNLSGDKKPTSYPLRHV 259

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
           RGK  V+EITIN+ + +KYL T+P+ ++    Q +  G  L GGI   NAH+AN L A Y
Sbjct: 260 RGKKVVSEITINKFLVEKYLHTTPKDLVRFG-QVSATGAMLNGGI-GINAHYANALAALY 317

Query: 240 LATGQDAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC 298
           +A GQDAA + E + G+T  +L +   LY S T+PNL++G VG G ++P+ K  L  +G 
Sbjct: 318 IACGQDAACVAESTVGITRMELTNTGDLYASVTMPNLMVGSVGGGTSLPSQKACLDIMGL 377

Query: 299 IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
               K    AR LA + AA  L GELS++ A    G    AH +L R
Sbjct: 378 HGAGK----ARALAEVAAALCLAGELSIMGAFC-AGHFSRAHQKLAR 419


>gi|326532992|dbj|BAJ89341.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 511

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/274 (33%), Positives = 148/274 (54%), Gaps = 9/274 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + ++ 
Sbjct: 205 VGYVQLPVGIAGPLLLDGQ----RFYVPMATTEGCLVASTNRGCK-AIAESGGATSVVLR 259

Query: 66  ERMTRSIF--FETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+    F T      L A  E       ++ V  ++S+F R   +   +AG  L++
Sbjct: 260 DAMTRAPVARFPTARRAAELKAFLEDPANFDTLSVVFNRSSRFGRLQGVQCAMAGRNLYM 319

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   +TGDA G NM++K    V+D++   +  +   S+SGN CSDKK  A+N I GRGK+
Sbjct: 320 RFSCSTGDAMGMNMISKGVQNVLDYLQDDFPDMDVISISGNFCSDKKPAAVNWIEGRGKS 379

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   I +K L+T+ + ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 380 VVCEAVIKEEIVKKVLKTNVQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATG 439

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNL 275
           QD A  VE SQ +T  +  +D   L+ S T+P++
Sbjct: 440 QDPAQNVESSQCITMLEAVNDGKDLHISVTMPSI 473


>gi|126180305|ref|YP_001048270.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Methanoculleus
           marisnigri JR1]
 gi|125863099|gb|ABN58288.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Methanoculleus
           marisnigri JR1]
          Length = 402

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 111/329 (33%), Positives = 164/329 (49%), Gaps = 12/329 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G        +PLAT E  L  SV RG  +      G    ++ 
Sbjct: 65  IGTVQVPLGVAGPLRVKGEYADGSYYLPLATTEGALVASVNRGCSLVTRA-GGADVRIMR 123

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           + MTR+  F   +   A      +    AE+  V E T++   F +  + +AG  +F+RL
Sbjct: 124 DGMTRAPVFAARDVVHAREVAAWVESHAAEVREVAESTTKHGEFREAVTYVAGTSVFVRL 183

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
           EF T DA G NMVT A   V + I  + +     + SGN+C+DKK  AIN + GRGK  V
Sbjct: 184 EFDTKDAMGMNMVTIAGQKVGELI-ERETGARLVATSGNMCTDKKPAAINLVRGRGKTVV 242

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA----YYLA 241
           A + +  A     L+T  E +I +N +KNL+G+      R+A+  F           ++A
Sbjct: 243 AGVRLTDAAIVDLLKTDAETLIEVNYRKNLVGS-----ARAASFGFNAHAANVVAAMFIA 297

Query: 242 TGQDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCI-E 300
            GQD A++VEGS  +T     D  +Y S T+P+L +G VG G  +      L  LG    
Sbjct: 298 CGQDPAHVVEGSTAITTVDRVDGGVYVSVTLPSLPVGTVGGGTGVDTQHECLAMLGVAGG 357

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAA 329
               G +A+  A I AA VL GELSLL A
Sbjct: 358 GDPPGTHAKAFAEIVAAGVLAGELSLLGA 386


>gi|299152177|gb|ADJ18178.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Eucalyptus grandis
           x Eucalyptus urophylla]
          Length = 519

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 108/346 (31%), Positives = 172/346 (49%), Gaps = 12/346 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G  + L+ 
Sbjct: 170 VGYVQLPVGIAGPLLLDGR----EYSVPMATTEGCLVASTNRGCK-AIFVSGGATSVLLR 224

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F T      L    E       +AR  +Q     +  +      G     
Sbjct: 225 DGMTRAPIVRFATAKRAADLKFFVENPANFESLARYFQQVQLIRKAPEHQVCDRGEESVH 284

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
            +    G   GH    + +  V+D++ S +  +    +SGN C+DKK  A+N I GRGK+
Sbjct: 285 EVLLQHGRCDGHEHGLERSPNVLDFLQSDFPDMDVLGISGNFCADKKPAAVNWIEGRGKS 344

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E TI   + +K L+TS E ++ LN  KNL G+ +AG +   NAH +N++ A ++ATG
Sbjct: 345 VVCEATIKGDVVRKVLKTSVEALVELNMLKNLTGSAMAGALGGFNAHASNIVAAIFIATG 404

Query: 244 QDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEE 301
           QD A  VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG    
Sbjct: 405 QDPAQNVESSHCITMMEAINDGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGA 464

Query: 302 RK--TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            K   G N+R LA + +  VL  ELSL++A    G+L+++H++  R
Sbjct: 465 NKELAGANSRLLATVVSGAVLAAELSLMSA-IAAGQLVKSHMKYNR 509


>gi|164604968|dbj|BAF98280.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
          Length = 526

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 150/275 (54%), Gaps = 14/275 (5%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGA---HISMLCPDGIRATLI 64
           MP+ ++  P+ I G ++ D  +V VP+AT E  L  S  RG    HIS     G  + ++
Sbjct: 253 MPVGYVQIPVGIAGPLLLDGKEVSVPMATTEGCLVASTNRGCKAIHIS----GGATSVVL 308

Query: 65  DERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLF 122
            + MTR+  + F T      L    E +     ++ V  ++S+F R   +   IAG  L+
Sbjct: 309 RDGMTRAPVVRFGTAKRAAQLKFYLEDSANFETLSTVFNKSSRFGRLQSIRCAIAGKNLY 368

Query: 123 LRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           +R    TGDA G NMV+K    V+D++ + +  +    VSGN CSDKK  A+N I GRGK
Sbjct: 369 IRFCCGTGDAMGMNMVSKGVQNVLDFLQNDFPDMDVIGVSGNFCSDKKPAAVNWIEGRGK 428

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
           +   E  I   + +K L+T+ E ++ LN  KNL G+ LAG +   NAH +N++ A Y+AT
Sbjct: 429 SVACEAIIKGDVVKKVLKTNVEALVELNMLKNLTGSALAGALGGFNAHASNIVTAIYIAT 488

Query: 243 GQDAANIVEGSQGLTYAKLHDD--SLYFSCTIPNL 275
           GQD A  VE S  +T  +  +D   L+ S T+P++
Sbjct: 489 GQDPAQNVESSHCITMMEAVNDGQDLHVSVTMPSI 523


>gi|256681158|gb|ACV04940.1| hydroxy-methyl-glutaryl-coenzyme A reductase [Bacopa monnieri]
          Length = 230

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 129/220 (58%), Gaps = 5/220 (2%)

Query: 130 GDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEIT 189
           GDA G NMV+K    VMD++  ++  +    +SGN CSDKK  A+N I GRGK+ V E  
Sbjct: 1   GDAMGMNMVSKGVQNVMDFLNKEFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEAI 60

Query: 190 INRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANI 249
           I   + +K L+T    ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD A  
Sbjct: 61  IKEDVVKKVLKTDVASLVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYIATGQDPAQN 120

Query: 250 VEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT--G 305
           VE S  +T  +  +D   L+ S T+P++ +G VG G  + +    L  LG     K   G
Sbjct: 121 VESSHCITMMEAVNDGKDLHISVTMPSIEIGTVGGGTQLASQSACLNLLGVKGASKDAPG 180

Query: 306 DNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            N+R+LA I A  VL GELSL++A    G+L+++H++  R
Sbjct: 181 SNSRQLATIVAGAVLAGELSLMSALA-AGQLVKSHMKYNR 219


>gi|162136075|gb|ABX82838.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Cyclocarya
           paliurus]
          Length = 583

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 174/345 (50%), Gaps = 13/345 (3%)

Query: 11  MPMRWIG-PMKITGNVIQD--KVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDER 67
           MP+ +I  P+ I G ++ D  +  VP+AT E  L  S  RG     L   G  + L+ + 
Sbjct: 232 MPIGYIQIPVGIAGPLLLDGREYMVPMATTEGCLVASTNRGCKAINLS-GGASSVLLRDG 290

Query: 68  MTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL-R 124
           MTR+  + F T      L    E      E     ++  Q  R    H         L  
Sbjct: 291 MTRAPVVRFATAQRAAQLKFFLE-DPPNYETCPFFKKGVQQIRKAPEHQMCNCREEPLHE 349

Query: 125 LEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNF 184
           +    GDA G NMV+K    V+D++   +  +    +SGN CSDKK  A+N I GRGK+ 
Sbjct: 350 ILLQHGDAMGMNMVSKGVQNVLDFLQDDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSV 409

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
           V E  I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A ++ATGQ
Sbjct: 410 VCEAIIKEEVVKKVLKTNVAALVELNMLKNLTGSAVAGALGGYNAHASNIVSAIFIATGQ 469

Query: 245 DAANIVEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IE 300
           D A  VE S  +T  +  +D   L+ S ++P++ +G VG G  + +    L  +G     
Sbjct: 470 DPAQNVESSNCITMLEPVNDGKDLHISVSMPSIEVGTVGGGTQLASQSACLNLIGVKGAN 529

Query: 301 ERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           +   G N+R LA I A  VL GELSL++A  + G+L+ +H++  R
Sbjct: 530 KESPGSNSRLLATIVAGAVLAGELSLMSAIAS-GQLVRSHMKYNR 573


>gi|91224656|ref|ZP_01259917.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio alginolyticus
           12G01]
 gi|91190544|gb|EAS76812.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio alginolyticus
           12G01]
          Length = 420

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 112/342 (32%), Positives = 174/342 (50%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++++P+   GP+++ G    D   VPLAT E  L  S  RGA++ +    G  A L+ 
Sbjct: 86  IGTVNVPVGIAGPLRVNGLYANDDFLVPLATTEAALVASYNRGANL-ITAAGGASALLLS 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E ++R+  F   +   A   +  +  +     ++ E T+   +   ++  I GN ++L  
Sbjct: 145 EGVSRTPVFAFNHLADAGQFVSWVVTQFDVFRQIAESTTSHGKLKDINVNIEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A + V   IL+        + + GN+  DKK  A      RGK  
Sbjct: 205 EYVTGDASGQNMVTIATNEVFHHILATSPIKPTQAFLDGNLSGDKKPNAHTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+TI   + +KYL T+PE ++    +   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 SAEVTIPAELVEKYLHTTPESMVQFG-KMTTVGGLLSGTI-GVNAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSC-TIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T   +      ++C T+PN+++G VG G  +P  K  L  LG      
Sbjct: 323 DAACVAESAIGITRMDVDAQGNLYACVTLPNIMVGTVGGGTGLPTQKACLDILGL----H 378

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              NA+ LA + A+  L GELS++ A         AH +L R
Sbjct: 379 GNGNAKALAEVAASLCLAGELSIVGAFC-ADHFSRAHHKLAR 419


>gi|153831137|ref|ZP_01983804.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae 623-39]
 gi|148873376|gb|EDL71511.1| 3-hydroxy-3-methylglutaryl CoA reductase [Vibrio cholerae 623-39]
          Length = 309

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 110/316 (34%), Positives = 170/316 (53%), Gaps = 10/316 (3%)

Query: 32  VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFETENAEMALTALQEITL 91
           VPLAT E  L  S  RG+ + +    G  A L++E +TR+  F   +   A   +  +T 
Sbjct: 2   VPLATTEAALVASYHRGSQL-ITAAGGASALLLNEGVTRTPVFAFLSLAQAGQFVGWVTS 60

Query: 92  KKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILS 151
           +  ++  + + T+   +   +   I GN ++L  E+ TGDASG NMVT A  AV ++I+ 
Sbjct: 61  QFEQMKEIAQSTTAHGKLKDIQVNIEGNHVYLVFEYTTGDASGQNMVTIATHAVFEFIMR 120

Query: 152 QWSYLHYGS-VSGNICSDKKATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLN 210
                   + + GN+  DKKA +      RGK   AE+ ++  + +KYL T+PE+++   
Sbjct: 121 HSPVAPVQAFLDGNLSGDKKANSYTLRSVRGKKVSAEVHLSAELVKKYLHTTPEQMVQFG 180

Query: 211 TQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQGLTYAKLH-DDSLYFS 269
            Q   +G  L+G I   NAH+AN L A Y+A GQDAA + E + G+T  ++H    LY S
Sbjct: 181 -QMTTVGGALSGAI-GVNAHYANALAALYIACGQDAACVAESAIGMTRMEIHPHGGLYAS 238

Query: 270 CTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAA 329
            T+PNL++G VG G ++P+    L+ +G   +     +AR LA + AA  L GELS++ A
Sbjct: 239 VTLPNLMVGTVGGGTHLPSQHACLSLMGLAGQ----GHARALAEVAAALCLAGELSIVGA 294

Query: 330 QTNPGELMEAHLRLER 345
               G    AH +L R
Sbjct: 295 FC-AGHFSRAHHKLAR 309


>gi|23574646|dbj|BAC20567.1| HMG-CoA reductase [Penicillium citrinum]
          Length = 1173

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 111/336 (33%), Positives = 176/336 (52%), Gaps = 10/336 (2%)

Query: 18   PMKITGNVIQDKVK--VPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRS--IF 73
            P+ + G ++ D     +P+AT E  L  S  RG+    L   G    L  + MTR   + 
Sbjct: 800  PVGVAGPIVIDGKSYFIPMATTEGVLVASASRGSKAINLG-GGAVTVLTGDGMTRGPCVK 858

Query: 74   FETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDAS 133
            F+      A     +  + +  +      TS+F R   + + IAG  L++R +  TGDA 
Sbjct: 859  FDVLERAGAAKIWLDSDVGQTVMKEAFNSTSRFARLQSMRTTIAGTHLYIRFKTTTGDAM 918

Query: 134  GHNMVTKAADAVMDWILSQ--WSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITIN 191
            G NM++K  +  ++ + ++  +S ++  ++SGN C+DKK +A+N I GRGK  VAE  I 
Sbjct: 919  GMNMISKGVEHALNVMATEAGFSDMNIITLSGNYCTDKKPSALNWIDGRGKGIVAEAIIP 978

Query: 192  RAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVE 251
              + +  L++  + ++ LN  KNLIG+ +AG +   NA  AN+  A ++ATGQD A +VE
Sbjct: 979  ANVVRDVLKSDVDSMVQLNISKNLIGSAMAGSVGGFNAQAANLAAAIFIATGQDPAQVVE 1038

Query: 252  GSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT--GDNAR 309
             +  +T       SL  S ++P++ +G +G G  +      L  LG      T  G+NAR
Sbjct: 1039 SANCITLMNNLRGSLQISVSMPSIEVGTLGGGTILEPQGAMLDMLGVRGSHPTTPGENAR 1098

Query: 310  RLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            +LA I  + VL GELSL AA    G L++AH+   R
Sbjct: 1099 QLARIIGSAVLAGELSLCAALAA-GHLVKAHMAHNR 1133


>gi|269967730|ref|ZP_06181778.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio alginolyticus
           40B]
 gi|269827636|gb|EEZ81922.1| hydroxymethylglutaryl-coenzyme A reductase [Vibrio alginolyticus
           40B]
          Length = 452

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 113/342 (33%), Positives = 174/342 (50%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++++P+   GP+++ G    D   VPLAT E  L  S  RGA++ +    G  A L+ 
Sbjct: 118 IGTVNVPVGIAGPLRVNGLYANDDFLVPLATTEAALVASYNRGANL-ITAAGGASALLLS 176

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E ++R+  F   +   A   +  +  +     ++ E T+   +   ++  I GN ++L  
Sbjct: 177 EGVSRTPVFAFNHLADAGQFVSWVVTQFDVFRQIAESTTSHGKLKDINVNIEGNHVYLVF 236

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A + V   IL+        + + GN+  DKK  A      RGK  
Sbjct: 237 EYVTGDASGQNMVTIATNEVFHHILATSPIKPTQAFLDGNLSGDKKPNAHTLRSVRGKKV 296

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+TI   + +KYL T+PE ++    +   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 297 SAEVTIPAELVEKYLHTTPESMVQFG-KMTTVGGLLSGTI-GVNAHYANALAALYIACGQ 354

Query: 245 DAANIVEGSQGLTYAKLH-DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T   +    +LY   T+PN+++G VG G  +P  K  L  LG      
Sbjct: 355 DAACVAESAIGITRMDVDAQGNLYACATLPNIMVGTVGGGTGLPTQKACLDILGL----H 410

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
              NA+ LA + A+  L GELS++ A         AH +L R
Sbjct: 411 GNGNAKALAEVAASLCLAGELSIVGAFC-ADHFSRAHHKLAR 451


>gi|262395387|ref|YP_003287240.1| hydroxymethylglutaryl-CoA reductase [Vibrio sp. Ex25]
 gi|262338981|gb|ACY52775.1| hydroxymethylglutaryl-CoA reductase [Vibrio sp. Ex25]
          Length = 420

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 153/294 (52%), Gaps = 5/294 (1%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++++P+   GP+++ G    D   VPLAT E  L  S  RGA++ +    G  A L+ 
Sbjct: 86  IGTVNVPVGIAGPLRVNGLYANDDFLVPLATTEAALVASYNRGANL-ITAAGGASALLLS 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E ++R+  F   N   A   +  +  +     ++ E T+   +   ++  I GN ++L  
Sbjct: 145 EGVSRTPVFAFNNLADAGQFVSWVVTQFDAFRQIAESTTSHGKLKDINVNIEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGS-VSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A + V   IL+        + + GN+  DKK  A      RGK  
Sbjct: 205 EYVTGDASGQNMVTIATNEVFHHILATSPIKPTQAFLDGNLSGDKKPNAHTLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+TI   + +KYL T+PE ++    +   +G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 SAEVTIPAELVEKYLHTTPESMVQFG-KMTTVGGLLSGTI-GVNAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDDSLYFSC-TIPNLILGCVGNGKNIPAIKNNLTALG 297
           DAA + E + G+T   +      ++C T+PN+++G VG G ++   K  L  LG
Sbjct: 323 DAACVAESAIGITRMDVDAQGNLYACVTLPNIMVGTVGGGTSLLTQKACLDILG 376


>gi|3095080|gb|AAC15476.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Tagetes erecta]
          Length = 483

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 138/268 (51%), Gaps = 10/268 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V  + +P+   GP+ + G     +  VP+AT E  L  S  RG   ++    G    L+ 
Sbjct: 221 VGYVQIPVGIAGPLLLNGT----EFSVPMATTEGCLVASTNRGCK-AIYISGGATCILLK 275

Query: 66  ERMTRS--IFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR+  + F T      L    E  +    +A V  ++S+F R   +   IAG   + 
Sbjct: 276 DGMTRAPVVRFGTAKRAAELKQFLEDPMNFDTLAVVFNKSSRFGRLQSVQCAIAGKNXYN 335

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R   ATGDA G NMVTK    V+D++   +  +    +SGN CSDKK  AIN I GRGK+
Sbjct: 336 RFCCATGDAMGMNMVTKGVQNVLDFLQHDFPDMDVMGISGNYCSDKKPAAINWIEGRGKS 395

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + QK L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A YLATG
Sbjct: 396 VVCEAIIKEEVVQKVLKTTVPALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVYLATG 455

Query: 244 QDAANIVEGSQGLTYAKLHDDS---LYF 268
           QD A  VE S  +T  +  +D    LYF
Sbjct: 456 QDPAQNVESSHCITMMEAVNDGKDLLYF 483


>gi|315181678|gb|ADT88591.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio furnissii
           NCTC 11218]
          Length = 420

 Score =  146 bits (368), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 178/342 (52%), Gaps = 10/342 (2%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+++ G        +PLAT E  L  S  RG+ + +    G  A L++
Sbjct: 86  IGTVKVPVGVAGPLRVNGLHASGDYLIPLATTEAALVASYHRGSRL-ITAAGGASAMLLN 144

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           E +TR+  F   N   A   +  +T +      + + T+   +   ++  + GN ++L  
Sbjct: 145 EGVTRTPVFAFYNLAQAGQFVAWVTTQYDVFKSLAQSTTAHGQLHDINVTLEGNHVYLVF 204

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYL-HYGSVSGNICSDKKATAINGIMGRGKNF 184
           E+ TGDASG NMVT A +AV D+I+        Y  + GN+  DKKA +      RGK  
Sbjct: 205 EYLTGDASGQNMVTIATNAVFDFIMQHSPIAPEYAFLDGNLSGDKKANSHVLRSVRGKKV 264

Query: 185 VAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQ 244
            AE+ +   + ++YL T+PEK++       L G  L+G I   NAH+AN L A Y+A GQ
Sbjct: 265 TAEVHLTADLVRRYLHTTPEKMVQFGHMTTLGGA-LSGSI-GVNAHYANALAALYIACGQ 322

Query: 245 DAANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           DAA + E + G+T  +L+    LY S T+PNL++G VG G  +P+ K  L  LG     K
Sbjct: 323 DAACVAESAIGITRMELNKHGGLYASVTLPNLMVGTVGGGTGLPSQKACLDILGLAGNGK 382

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                R LA + AA  L GELS++ A  + G    AH +L R
Sbjct: 383 A----RALAEVAAALCLAGELSIVGA-FSAGHFSRAHHKLAR 419


>gi|256681160|gb|ACV04941.1| hydroxy-methyl-glutaryl-coenzyme A reductase [Bacopa monnieri]
          Length = 219

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 86/220 (39%), Positives = 129/220 (58%), Gaps = 5/220 (2%)

Query: 130 GDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEIT 189
           GDA G NM++K    VMD++  ++  +    +SGN CSDKK  A+N I GRGK+ V E  
Sbjct: 1   GDAMGMNMISKGVQNVMDFLNKEFPDMDVIGISGNYCSDKKPAAVNWIEGRGKSVVCEAI 60

Query: 190 INRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANI 249
           I   + +K L+T+   ++ LN  KNL G+ +AG +   NAH +N++ A Y+ATGQD A  
Sbjct: 61  IKEDVVKKVLKTNVASLLELNMLKNLTGSAMAGALGGFNAHASNIVSAVYIATGQDPAQN 120

Query: 250 VEGSQGLTYAKLHDD--SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK--TG 305
           VE S  +T  +  +D   L+ S T+P++ +G VG    + +    L  LG     K   G
Sbjct: 121 VESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGRTQLASQSACLNLLGVKGASKEAPG 180

Query: 306 DNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
            N+R+LA I A  VL GELSL++A    G+L+++H++  R
Sbjct: 181 SNSRKLATIVAGAVLAGELSLMSALA-AGQLVKSHMKYNR 219


>gi|222480430|ref|YP_002566667.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Halorubrum
           lacusprofundi ATCC 49239]
 gi|222453332|gb|ACM57597.1| 3-hydroxy-3-methylglutaryl Coenzyme A reductase [Halorubrum
           lacusprofundi ATCC 49239]
          Length = 407

 Score =  145 bits (367), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 120/345 (34%), Positives = 178/345 (51%), Gaps = 12/345 (3%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           V ++ +PM   GP+ + G  +  +  +P+AT E  L  S+ RG  + +    G  A +  
Sbjct: 70  VGAVQVPMGVAGPVAVDGGALSGERYLPMATTEGALVASINRGCSV-VNDAGGATARVTK 128

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
             MTR+  F   +   A   +  +   +  +    E T+     L +   + GN ++LR 
Sbjct: 129 SGMTRAPIFRVADVAEAEALVSWVRDNEGVLREAAESTTSHGELLDVTPYVVGNNVYLRF 188

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
            + T DA G NMVT A     D I ++       ++SGN+CSDKK  AIN + GRG++  
Sbjct: 189 RYDTKDAMGMNMVTIATREACDEIEAETDASLV-ALSGNLCSDKKPAAINAVEGRGRSVA 247

Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245
           A++ + R + ++ L T+PE I  +NT+KNL+G+  AGG+   NAH AN + A +LATGQD
Sbjct: 248 ADVEVPREVVEERLHTTPESIAEINTRKNLVGSAKAGGL-GFNAHVANAVAAMFLATGQD 306

Query: 246 AANIVEGSQGLTYAK-LHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304
            A +VEG+  +T A+   +  LY S ++ +L +G VG G  +P     L  LG    R  
Sbjct: 307 EAQVVEGANAITTAETTPEGDLYLSVSLASLEVGTVGGGTGLPTQAAGLDILGV---RGG 363

Query: 305 GD----NARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
           GD    N   LA   A   L GELSLLAA  +   L  AH  L R
Sbjct: 364 GDPAGSNGDALAEAIAVGALAGELSLLAALGSR-HLSSAHADLGR 407


>gi|114599633|ref|XP_001148178.1| PREDICTED: 3-hydroxy-3-methylglutaryl-Coenzyme A reductase isoform
           1 [Pan troglodytes]
          Length = 835

 Score =  145 bits (367), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 109/346 (31%), Positives = 164/346 (47%), Gaps = 56/346 (16%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ + G   Q    VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 531 IGYMPIPVGVAGPLCLDGKEFQ----VPMATTEGCLVASTNRGCRAIGL-GGGASSRVLA 585

Query: 66  ERMTRSIFFETENA--EMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR        A     + A  E +   A I    + TS+F R  +LH+ IAG  L++
Sbjct: 586 DGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYI 645

Query: 124 RLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKN 183
           R +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRGK+
Sbjct: 646 RFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKS 705

Query: 184 FVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATG 243
            V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y+A G
Sbjct: 706 VVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACG 765

Query: 244 QDAANIVEGSQGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERK 303
           Q                               +LG  G  K+ P                
Sbjct: 766 Q-------------------------------MLGVQGACKDNP---------------- 778

Query: 304 TGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLERMHLN 349
            G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R  +N
Sbjct: 779 -GENARQLARIVCGTVMAGELSLMAALA-AGHLVKSHMIHNRSKIN 822


>gi|148250109|gb|ABQ53154.1| 3-hydroxy-3-methylglutaryl coenzyme A redutase [Houttuynia cordata]
          Length = 223

 Score =  145 bits (366), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 87/219 (39%), Positives = 128/219 (58%), Gaps = 5/219 (2%)

Query: 131 DASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITI 190
           DA G NMV+K    V+D++ + +  +   S+SGN CSDKK  A+N I GRGK+ V E  I
Sbjct: 1   DAMGMNMVSKGVQNVLDFLQTDYPDMDIISISGNFCSDKKPAAVNWIEGRGKSVVCEAII 60

Query: 191 NRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIV 250
              + +K L+TS + ++ LNT KNL G+ +AG +   NAH +N++ A Y+ATGQD A  +
Sbjct: 61  KEDVVKKVLKTSVDALVELNTLKNLAGSAIAGVLGGFNAHASNIVSAIYIATGQDPAQNI 120

Query: 251 EGSQGLTY--AKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--IEERKTGD 306
           E S  +T   A  + + L+ S T+P + +G VG G  + +    L  LG         G 
Sbjct: 121 ESSHCITMMEAVNNREDLHISVTMPCIEVGTVGGGTQLSSQSACLNLLGVKGANMES