PSIBLAST alignment of GI: 255764509 and protein with PDB id: 1qax

gi|5542333|pdb|1QAX|A Chain A, Ternary Complex Of Pseudomonas Mevalonii Hmg-Coa Reductase With Hmg-Coa And Nad+ Length = 428
>gi|5542334|pdb|1QAX|B Chain B, Ternary Complex Of Pseudomonas Mevalonii Hmg-Coa Reductase With Hmg-Coa And Nad+ Length = 428
 Score =  271 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 65/369 (17%), Positives = 110/369 (29%), Gaps = 53/369 (14%)

Query: 1   MHMKKVSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIR 60
           M    + +  +P       +I G      V VPL   E  +  +    A ++     G  
Sbjct: 50  MIENVIGTFELPYAVASNFQINGR----DVLVPLVVEEPSIVAAASYMAKLA-RANGGFT 104

Query: 61  ATLIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQT-----SQFTRFLQLHSQ 115
            +     M   +       +  L A   +  +K EI  +  +      S       +   
Sbjct: 105 TSSSAPLMHAQVQI--VGIQDPLNARLSLLRRKDEIIELANRKDQLLNSLGGGCRDIEVH 162

Query: 116 -----IAGNLLFLRLEFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKK 170
                  G +L   L     DA G N V   A+AV   + +         +  N+   + 
Sbjct: 163 TFADTPRGPMLVAHLIVDVRDAMGANTVNTMAEAVAPLMEAITGGQVRLRILSNLADLRL 222

Query: 171 ATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAH 230
           A              A++ I      +    S E +I                  + N  
Sbjct: 223 AR-------------AQVRITPQQL-ETAEFSGEAVIEGILDAYAFAAVDPYRAATHNKG 268

Query: 231 FANMLLAYYLATGQDAANIVEGSQGL-----------TYAKLHDDSLYFSCTIPNLILGC 279
             N +    +ATG D   +  G+              T+ K ++  L  +  +P + +G 
Sbjct: 269 IMNGIDPLIVATGNDWRAVEAGAHAYACRSGHYGSLTTWEKDNNGHLVGTLEMP-MPVGL 327

Query: 280 VGNGKN-IPAIKNNLTALGCIEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELME 338
           VG      P  + +L  LG          A+ LA I  A  L   L  + A    G +  
Sbjct: 328 VGGATKTHPLAQLSLRILGVK-------TAQALAEIAVAVGLAQNLGAMRALATEG-IQR 379

Query: 339 AHLR-LERM 346
            H+    R 
Sbjct: 380 GHMALHARN 388