RPSBLAST alignment for GI: 255764509 and conserved domain: COG1257

>gnl|CDD|31449 COG1257, HMG1, Hydroxymethylglutaryl-CoA reductase [Lipid metabolism]. Length = 436
 Score =  213 bits (543), Expect = 6e-56
 Identities = 121/353 (34%), Positives = 171/353 (48%), Gaps = 20/353 (5%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + ++ +P+   GP+ I G        +P+AT E  L  S  RGA +      G  A + +
Sbjct: 66  IGTVQLPLGIAGPLLINGKEYY----IPMATTEGALVASASRGAKLITAS-GGATARVTE 120

Query: 66  ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123
           + MTR   F   +   A      +  K+           T +  + + +   + GNLL+L
Sbjct: 121 DGMTRQPVFRFVSLPEAAKFAIWVKKKEIIELAKEAAPSTGRGGKLIHIEPFVEGNLLYL 180

Query: 124 RLEFATGDASGHNMVTKAADAVMDWI-LSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182
           R    TGDA G NMV  A +AV  +I    +      ++S N+C+DKK  AIN I GRGK
Sbjct: 181 RFYVDTGDAMGMNMVNIATEAVAPFIEEETFGGAVLLAISSNLCTDKKPAAINSIEGRGK 240

Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242
             VAE TI   + +K L+ +PE I+ +N  K L G  +  GI   NAH AN + A   AT
Sbjct: 241 TVVAEATIPEEVVKKILKATPEAIVDVNRAKTLNGGAMN-GIDGFNAHTANDVRAIEAAT 299

Query: 243 GQDAANIVEGSQGLTYAKLHDDS-LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--- 298
           GQDAA + E S  +T+ +   D  LY S T+P+L++G  G G  +P  +  L  LG    
Sbjct: 300 GQDAAQVGEYSPLITWMEDQRDGDLYGSVTLPSLVVGTGGGGTVLPTQREALKILGVAGA 359

Query: 299 ------IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
                 +       NA  LAA+ A  +L GE+SLLAA    G L  AH  L R
Sbjct: 360 GELAGVLAAVGLAQNAAALAALVAEGILAGEMSLLAALAA-GHLGAAHDELGR 411