RPSBLAST alignment of GI: 255764509 and MMDB domain: 2r4f_A_86-153_259-441

>2r4f_A (A:86-153,A:259-441) 3-hydroxy-3-methylglutaryl-coenzyme A reductase; oxidoreductase, cholesterol, biocynthesis, HMG-COA, NADPH, statin, alternative splicing; HET: RIE; 1.70A {Homo sapiens} PDB: 2q1l_A* 2q6c_A* 2q6b_A* 3bgl_A* 3cct_A* 3ccw_A* 3ccz_A* 3cd0_A* 3cd5_A* 3cd7_A* 3cda_A* 3cdb_A* 1dqa_A* 1dq9_A* 1dq8_A* 1hw8_A* 1hw9_A* 1hwi_A* 1hwj_A* 1hwk_A* ...Length = 251
 Score =  186 bits (473), Expect = 5e-48
 Identities = 75/184 (40%), Positives = 108/184 (58%), Gaps = 6/184 (3%)

Query: 171 ATAINGIMGRGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAH 230
             AIN I GRGK+ V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH
Sbjct: 69  PAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAH 128

Query: 231 FANMLLAYYLATGQDAANIVEGSQGLT---YAKLHDDSLYFSCTIPNLILGCVGNGKNIP 287
            AN++ A Y+A GQDAA  V  S  +T    +   ++ LY SCT+P++ +G VG G N+ 
Sbjct: 129 AANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLL 188

Query: 288 AIKNNLTALGCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345
             +  L  LG     K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+   R
Sbjct: 189 PQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA-GHLVKSHMIHNR 247

Query: 346 MHLN 349
             +N
Sbjct: 248 SKIN 251