RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|255764509|ref|YP_003065434.2| hydroxymethylglutaryl-coenzyme
A (HMG-CoA) reductase [Candidatus Liberibacter asiaticus str. psy62]
         (351 letters)



>d1dqaa4 d.179.1.1 (A:462-586,A:704-870) Substrate-binding domain of
           HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
          Length = 292

 Score =  157 bits (399), Expect = 1e-39
 Identities = 66/169 (39%), Positives = 97/169 (57%), Gaps = 6/169 (3%)

Query: 180 RGKNFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYY 239
             K+ V E  I   + ++ L+T+ E +I +N  KNL+G+ +AG I   NAH AN++ A Y
Sbjct: 124 ADKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIY 183

Query: 240 LATGQDAANIVEGSQGLTYA---KLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTAL 296
           +A GQDAA  V  S  +T        ++ LY SCT+P++ +G VG G N+   +  L  L
Sbjct: 184 IACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQML 243

Query: 297 GCIEERKT--GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRL 343
           G     K   G+NAR+LA I   TV+ GELSL+AA    G L+++H+  
Sbjct: 244 GVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAA-GHLVKSHMIH 291



 Score = 46.0 bits (109), Expect = 5e-06
 Identities = 23/144 (15%), Positives = 52/144 (36%), Gaps = 9/144 (6%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           +  + +P+   GP+ +       + +VP+AT E  L  S  RG     L   G  + ++ 
Sbjct: 70  IGYMPIPVGVAGPLCLDEK----EFQVPMATTEGCLVASTNRGCRAIGLG-GGASSRVLA 124

Query: 66  ERMTR-SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLR 124
           ++          +     L    E  ++      ++   S     +  ++  A N+    
Sbjct: 125 DKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLV--GSAMAGSIGGYNAHAANI-VTA 181

Query: 125 LEFATGDASGHNMVTKAADAVMDW 148
           +  A G  +  N+ +     +M+ 
Sbjct: 182 IYIACGQDAAQNVGSSNCITLMEA 205


>d1dqaa1 d.58.20.1 (A:587-703) NAD-binding domain of HMG-CoA
           reductase {Human (Homo sapiens) [TaxId: 9606]}
          Length = 117

 Score =  130 bits (329), Expect = 2e-31
 Identities = 40/116 (34%), Positives = 59/116 (50%), Gaps = 2/116 (1%)

Query: 68  MTRSIFFETENAEMALTALQ--EITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
           MTR        A  +       E +   A I    + TS+F R  +LH+ IAG  L++R 
Sbjct: 2   MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRF 61

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRG 181
           +  +GDA G NM++K  +  +  +   +  +   +VSGN C+DKK  AIN I GRG
Sbjct: 62  QSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRG 117


>d1r31a2 d.179.1.1 (A:3-110,A:221-378) Substrate-binding domain of
           HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
          Length = 266

 Score = 59.3 bits (143), Expect = 4e-10
 Identities = 33/240 (13%), Positives = 63/240 (26%), Gaps = 33/240 (13%)

Query: 6   VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65
           + +  +P       +I G  +     VPL   E  +  +    A ++     G   +   
Sbjct: 53  IGTFELPYAVASNFQINGRDVL----VPLVVEEPSIVAAASYMAKLARAN-GGFTTSSSA 107

Query: 66  ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125
            R+ R+    T           E       +   I     F       +           
Sbjct: 108 PRLARAQVRITPQQLETAEFSGE------AVIEGILDAYAFAAVDPYRA----------- 150

Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185
                 A+ +  +    D ++    + W  +  G+ +    S    +          + V
Sbjct: 151 ------ATHNKGIMNGIDPLIVATGNDWRAVEAGAHAYACRSGHYGSLTTWEKDNNGHLV 204

Query: 186 A--EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLA-YYLAT 242
              E+ +   +     +T P   + L          LA          A  L A   LAT
Sbjct: 205 GTLEMPMPVGLVGGATKTHPLAQLSLRILGVKTAQALAEIA--VAVGLAQNLGAMRALAT 262


>d2cfxa2 d.58.4.2 (A:64-140) Transcriptional regulator LrpC
           {Bacillus subtilis [TaxId: 1423]}
          Length = 77

 Score = 26.8 bits (59), Expect = 2.8
 Identities = 7/50 (14%), Positives = 17/50 (34%)

Query: 83  LTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDA 132
           ++ + E T+K A+  R              +         L++   + +A
Sbjct: 2   VSCIVEATVKNADYERFKSYIQTLPNIEFCYRIAGAACYMLKINAESLEA 51


>d2i06a1 e.2.1.1 (A:5-309) Replication terminator protein (Tus)
           {Escherichia coli [TaxId: 562]}
          Length = 305

 Score = 25.6 bits (56), Expect = 6.4
 Identities = 8/50 (16%), Positives = 19/50 (38%), Gaps = 3/50 (6%)

Query: 75  ETENAEMALTALQEITLKKAEIARVIEQTSQFT---RFLQLHSQIAGNLL 121
           +  +    ++ +Q I   K     ++   S+     RF  +H  + G + 
Sbjct: 99  DNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLIT 148


>d1r31a1 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA
           reductase {Pseudomonas mevalonii [TaxId: 32044]}
          Length = 110

 Score = 25.2 bits (55), Expect = 8.6
 Identities = 11/32 (34%), Positives = 14/32 (43%)

Query: 118 GNLLFLRLEFATGDASGHNMVTKAADAVMDWI 149
           G +L   L     DA G N V   A+AV   +
Sbjct: 60  GPMLVAHLIVDVRDAMGANTVNTMAEAVAPLM 91


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.321    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0625    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 1,256,042
Number of extensions: 55680
Number of successful extensions: 112
Number of sequences better than 10.0: 1
Number of HSP's gapped: 106
Number of HSP's successfully gapped: 10
Length of query: 351
Length of database: 2,407,596
Length adjustment: 86
Effective length of query: 265
Effective length of database: 1,226,816
Effective search space: 325106240
Effective search space used: 325106240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.4 bits)