HHsearch alignment for GI: 255764511 and conserved domain: PRK04457

>PRK04457 spermidine synthase; Provisional.
Probab=93.49  E-value=0.57  Score=26.93  Aligned_cols=102  Identities=19%  Similarity=0.298  Sum_probs=65.2

Q ss_pred             CCCCHHHCCCCCCCCCCHH--HHHHHHH--CCCCCCEEEECCCCCCHHHHHHHHHC--CEEEEECCCHHHHHHHHHHHHH
Q ss_conf             4320110116078334009--8688660--83888889983768828899999748--9099980998999999998521
Q gi|255764511|r    7 KTMSSAIHHTIGDHVPVLL--EKVIALL--NPAPGKVILDATFGAGGYSRSFCKMG--SNVIALDRDPFAVSCGQETMRD   80 (341)
Q Consensus         7 ~~m~~~~~~~~~~H~PVll--~Evl~~l--~~~~~g~~iD~TlG~GGHS~~iL~~~--~~liaiDrD~~ai~~a~~~l~~   80 (341)
T Consensus        35 ~~~QS~m~~~~-P~~L~l~Ytr~Mm~~LLf~p~P-k~vl~iGLGgGsl~k~~~~~~P~~~i~~VEIdp~Vi~vAr~~F~l  112 (262)
T PRK04457         35 DTIQSSMRLDR-PSELVLSYSRAMMGFLLFNPRP-QHILQIGLGGGSFAKFIDTYLPDTRQTAVEINPQVIAVARNHFEL  112 (262)
T ss_pred             CCEEEEEECCC-CCHHHHHHHHHHHHHHHCCCCC-CEEEEEECCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCC
T ss_conf             86382354278-8502128899999998658997-869999257019999999839867589998788999999986579


Q ss_pred             --CCCCEEEECCCHHHHHHHHHHCCCCEEEEEC
Q ss_conf             --4885277113278898765312332478622
Q gi|255764511|r   81 --YKEQFSLFQATFSQLQDYVPDKGVDGVVFDL  111 (341)
Q Consensus        81 --~~~r~~~~~~~F~~i~~~l~~~~vdgIl~DL  111 (341)
T Consensus       113 P~dd~Rl~V~~~Dg~~fv~~-~~~~~DvI~vD~  144 (262)
T PRK04457        113 PFEDEKFEIIEADGAEYIKV-FPASTDVILVDG  144 (262)
T ss_pred             CCCCCCEEEEECCHHHHHHH-CCCCCCEEEEEC
T ss_conf             99997269995538999854-867778899968