HHsearch alignment for GI: 255764511 and conserved domain: pfam01795

>pfam01795 Methyltransf_5 MraW methylase family. Members of this family are probably SAM dependent methyltransferases based on Escherichia coli mraW. This family appears to be related to pfam01596.
Probab=100.00  E-value=0  Score=836.09  Aligned_cols=299  Identities=43%  Similarity=0.713  Sum_probs=286.0

Q ss_pred             CCCCCHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHH---CCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCHHHH
Q ss_conf             833400986886608388888998376882889999974---89099980998999999998521488527711327889
Q gi|255764511|r   19 DHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKM---GSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQL   95 (341)
Q Consensus        19 ~H~PVll~Evl~~l~~~~~g~~iD~TlG~GGHS~~iL~~---~~~liaiDrD~~ai~~a~~~l~~~~~r~~~~~~~F~~i   95 (341)
T Consensus         3 ~H~PVll~Evi~~L~~~~~g~yvD~T~G~GGHS~~iL~~~~~~~~li~iDrD~~ai~~a~~~l~~~~~r~~~~~~nF~~l   82 (310)
T pfam01795         3 HHISVLLQEVVELLNIKPDGIYIDCTLGGGGHSEAILEQLPEEGRLIGIDRDPQAIANAKERLKPFKGRVTLIHSNFANL   82 (310)
T ss_pred             CCCCCCHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCCCEEEEECCHHHH
T ss_conf             76411199999726838999999958897199999998489999799998989999999985302588589992537579


Q ss_pred             HHHHHHC---CCCEEEEECCCHHHHHHHHHHCCCCCCCCCEECCCCCC-CCCHHHHHHHCCHHHHHHHHHHHCCCCHHHH
Q ss_conf             8765312---33247862252078887654073445664101043556-8418999862225789989997446302688
Q gi|255764511|r   96 QDYVPDK---GVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCS-GISASDVVNQANVKDLTRILGILGEEKQASR  171 (341)
Q Consensus        96 ~~~l~~~---~vdgIl~DLGvSS~Qld~~~RGFSf~~dgpLDMRmd~~-~~tA~eiln~~s~~~L~~i~~~yGee~~a~~  171 (341)
T Consensus        83 ~~~l~~~~~~~vdGil~DLGvSS~Qld~~~RGFSf~~dgpLDMRMd~~~~~tA~~iln~~~e~eL~~il~~yGEe~~a~~  162 (310)
T pfam01795        83 FAYLKELGVGKVDGILFDLGVSSPQLDGAERGFSFKHDAPLDMRMDQSAGLTAAEVLNTYSEEDLARIFKKYGEERFSKR  162 (310)
T ss_pred             HHHHHHCCCCCCCEEEEECCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHCCCCHHHH
T ss_conf             99998759876678999644681421477568675889987666678999849999850899999999998577456999


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH-HCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCEEEEEEE
Q ss_conf             9999999975212432137999999887643-127712578888887665134057899999988520244533899872
Q gi|255764511|r  172 IAHAIVKRRQSAPFQTTQDLSSLIQKTVYFS-KNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSF  250 (341)
Q Consensus       172 IA~~Iv~~R~~~~i~TT~eL~~iI~~~~~~~-~~~k~hpatr~FQALRI~VN~El~~L~~~L~~~~~~L~~gGrl~VISF  250 (341)
T Consensus       163 IA~~Iv~~R~~~~i~tT~~L~~iI~~~~p~~~~~~~~hpAtr~FQALRI~VN~EL~~L~~~L~~~~~~L~~gGrl~VISF  242 (310)
T pfam01795       163 IARAIVERRKKKPIETTKELAEIIKKAVPAKAKRKKIHPATRTFQAIRIYVNDELESLKEALEQAPDLLAPGGRLSVISF  242 (310)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHCCCHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             99999999986277779999999998560110145667389999999999977999999999999983689968999985


Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCC-CCCCCCCCEEECCCCCCCCCHHHHHHCCCCCEEEEEEEEEC
Q ss_conf             55023899999986417887776567-78777754045248654788899982871001232377871
Q gi|255764511|r  251 HSLEDRLVKKFFASRSGKVMAVRHMI-PSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGMRT  317 (341)
Q Consensus       251 HSLEDRiVK~ff~~~~~~~~~~~~~~-~~~~~~~~~~~l~kkpi~PS~~Ei~~NpRSRSAKLRv~~k~  317 (341)
T Consensus       243 HSLEDRiVK~ff~~~~~~~~~p~~~p~~~~~~~~~~~~ltkK~i~ps~~Ei~~NpRSRSAKLRvaeKi  310 (310)
T pfam01795       243 HSLEDRIVKNFFREYSKGCQVPAGLPVILEGLEPLLKIITKKPILPSEEEIEENPRSRSAKLRVAEKI  310 (310)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCHHHHHHCCCHHHHHHEEEEEC
T ss_conf             43467999999998403678885568665567754355069991829999962962662033048959