HHsearch results for GI: 255764511 and protein with PDBid: 3ccf_A

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase, structural genomics; 1.90A {Anabaena variabilis atcc 29413}
Probab=97.77  E-value=2.5e-05  Score=53.71  Aligned_cols=97  Identities=22%  Similarity=0.317  Sum_probs=75.8

Q ss_pred             CCCHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHH
Q ss_conf             34009868866083888889983768828899999748909998099899999999852148852771132788987653
Q gi|255764511|r   21 VPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYVP  100 (341)
Q Consensus        21 ~PVll~Evl~~l~~~~~g~~iD~TlG~GGHS~~iL~~~~~liaiDrD~~ai~~a~~~l~~~~~r~~~~~~~F~~i~~~l~  100 (341)
                      .+-+-+++++.|.++||..++|-=.|.|..+..+.+.+++|+|+|.++.++..|++++.    ++.+..+++.++.   .
T Consensus        42 ~~~~~~~ll~~l~~~~g~~VLDiGcG~G~~~~~la~~~~~v~giD~s~~ml~~a~~~~~----~~~~~~~~~~~~~---~  114 (279)
T 3ccf_A           42 VWQYGEDLLQLLNPQPGEFILDLGCGTGQLTEKIAQSGAEVLGTDNAATMIEKARQNYP----HLHFDVADARNFR---V  114 (279)
T ss_dssp             CSSSCCHHHHHHCCCTTCEEEEETCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHHHCT----TSCEEECCTTTCC---C
T ss_pred             HHHHHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECHHHHHHHHHHHCC----CCCEEEHHHCCCC---C
T ss_conf             79999999970699996999993585859999999649989999163889999986165----4311100000135---6


Q ss_pred             HCCCCEEEEECCCHHHHHHHHHHCCC
Q ss_conf             12332478622520788876540734
Q gi|255764511|r  101 DKGVDGVVFDLGVSSMQIDCGDRGFS  126 (341)
Q Consensus       101 ~~~vdgIl~DLGvSS~Qld~~~RGFS  126 (341)
                      +..+|.|+.-..  .+++.++.+.+.
T Consensus       115 ~~~fD~v~~~~~--l~~~~d~~~~l~  138 (279)
T 3ccf_A          115 DKPLDAVFSNAM--LHWVKEPEAAIA  138 (279)
T ss_dssp             SSCEEEEEEESC--GGGCSCHHHHHH
T ss_pred             CCCCCEEEEEEC--CCCCCCHHHHHH
T ss_conf             765538977520--145678899999