HHsearch results for GI: 255764511 and protein with PDBid: 3id6_C

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O- methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, RNA-binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} PDB: 3id5_B*
Probab=96.62  E-value=0.0094  Score=37.03  Aligned_cols=84  Identities=13%  Similarity=0.050  Sum_probs=58.8

Q ss_pred             HHHHCCCCCCEEEECCCCCCHHHHHHHHH---CCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHH-HHCCC
Q ss_conf             86608388888998376882889999974---890999809989999999985214885277113278898765-31233
Q gi|255764511|r   29 IALLNPAPGKVILDATFGAGGYSRSFCKM---GSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYV-PDKGV  104 (341)
Q Consensus        29 l~~l~~~~~g~~iD~TlG~GGHS~~iL~~---~~~liaiDrD~~ai~~a~~~l~~~~~r~~~~~~~F~~i~~~l-~~~~v  104 (341)
                      ++.+.++||..++|--.|.|..+..+.+.   .++|||+|..|.++..+.++.+..+ ++..+.....+...+- ....+
T Consensus        69 l~~~~lkpG~~VLdLG~G~G~~~~~la~~Vg~~G~V~aVD~s~~~l~~a~~~a~~~~-n~~~v~~d~~~~~~~~~~~~~v  147 (232)
T 3id6_C           69 LKTNPIRKGTKVLYLGAASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRP-NIFPLLADARFPQSYKSVVENV  147 (232)
T ss_dssp             CSCCSCCTTCEEEEETCTTSHHHHHHHHHHTTTSEEEEEECCHHHHHHHHHHHHHCT-TEEEEECCTTCGGGTTTTCCCE
T ss_pred             HHHCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCC-CCCCEEECCCCHHHCCCCCCEE
T ss_conf             330588999999996771889999999971568769999799999999997656546-7763010146754537777369


Q ss_pred             CEEEEECCC
Q ss_conf             247862252
Q gi|255764511|r  105 DGVVFDLGV  113 (341)
Q Consensus       105 dgIl~DLGv  113 (341)
                      |.|+.|+..
T Consensus       148 d~i~~~~~~  156 (232)
T 3id6_C          148 DVLYVDIAQ  156 (232)
T ss_dssp             EEEEECCCC
T ss_pred             EEEEEECCC
T ss_conf             999985257