HHsearch results for GI: 255764511 and protein with PDBid: 3mb5_A

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*
Probab=97.92  E-value=0.00012  Score=49.33  Aligned_cols=89  Identities=17%  Similarity=0.275  Sum_probs=70.0

Q ss_pred             CCCHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHH---CCEEEEECCCHHHHHHHHHHHHHC--CCCEEEECCCHHHH
Q ss_conf             3400986886608388888998376882889999974---890999809989999999985214--88527711327889
Q gi|255764511|r   21 VPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKM---GSNVIALDRDPFAVSCGQETMRDY--KEQFSLFQATFSQL   95 (341)
Q Consensus        21 ~PVll~Evl~~l~~~~~g~~iD~TlG~GGHS~~iL~~---~~~liaiDrD~~ai~~a~~~l~~~--~~r~~~~~~~F~~i   95 (341)
                      +|--..-++..+++.||..++|+-.|.|+-|..+...   .++|+|+|.+++++..|+++++..  .+++.+.+..... 
T Consensus        78 yp~d~~~Ii~~l~i~pG~rVLd~G~GsG~lt~~lar~~~~~G~V~~~D~~~~~~~~A~~n~~~~gl~~~v~~~~~D~~~-  156 (255)
T 3mb5_A           78 HPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYE-  156 (255)
T ss_dssp             CHHHHHHHHHHTTCCTTCEEEEECCTTSHHHHHHHHHHCTTSEEEEECSCHHHHHHHHHHHHHHTCTTTEEEECSCGGG-
T ss_pred             CHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCHHC-
T ss_conf             8899999999719898998998886627999999974388977998349999999999999971998149999461103-


Q ss_pred             HHHHHHCCCCEEEEECC
Q ss_conf             87653123324786225
Q gi|255764511|r   96 QDYVPDKGVDGVVFDLG  112 (341)
Q Consensus        96 ~~~l~~~~vdgIl~DLG  112 (341)
                        ......+|.|++|+.
T Consensus       157 --~~~~~~~D~V~ld~p  171 (255)
T 3mb5_A          157 --GIEEENVDHVILDLP  171 (255)
T ss_dssp             --CCCCCSEEEEEECSS
T ss_pred             --CCCCCCCCEEEEECC
T ss_conf             --555565657999668