HHsearch results for GI: 255764511 and protein with PDBid: 3p2e_A

>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A*
Probab=95.88  E-value=0.019  Score=35.10  Aligned_cols=92  Identities=10%  Similarity=-0.035  Sum_probs=67.1

Q ss_pred             HHHHHHCCCCCCEEEECCCCCCHHHHHHHHHCC--EEEEECCCHHHHHHHHHHHHHC-----CCCEEEECCCHHHHHHHH
Q ss_conf             688660838888899837688288999997489--0999809989999999985214-----885277113278898765
Q gi|255764511|r   27 KVIALLNPAPGKVILDATFGAGGYSRSFCKMGS--NVIALDRDPFAVSCGQETMRDY-----KEQFSLFQATFSQLQDYV   99 (341)
Q Consensus        27 Evl~~l~~~~~g~~iD~TlG~GGHS~~iL~~~~--~liaiDrD~~ai~~a~~~l~~~-----~~r~~~~~~~F~~i~~~l   99 (341)
                      +-+.-+.++++.+++|.=.|.|..+..+.+.++  +|+|+|.+++++..+..+....     ..++.+..++..++....
T Consensus        15 ~~l~~~~~~~~~~vLDvGcG~G~~~~~la~~~p~~~vvGvD~s~~~l~~a~~~~~~~~~~~~~~~v~~~~~d~~~lp~~~   94 (225)
T 3p2e_A           15 DELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVIAAAESLPFEL   94 (225)
T ss_dssp             HHHHHHHTTCSEEEEEETCTTSHHHHHHHHTCTTEEEEEECSCCGGGHHHHHHHTSCGGGTCCSSEEEECCBTTBCCGGG
T ss_pred             HHHHHHHCCCCCEEEEEEEECCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCHHHHCCCHHHCCCCC
T ss_conf             99998648899989992276739999999868997899986788999999988887544037864333205174498430


Q ss_pred             HHCCCCEEEEECCCHHHHHH
Q ss_conf             31233247862252078887
Q gi|255764511|r  100 PDKGVDGVVFDLGVSSMQID  119 (341)
Q Consensus       100 ~~~~vdgIl~DLGvSS~Qld  119 (341)
                      . ...+.+-+|+-.+...+.
T Consensus        95 ~-~~~~~~~~~~~~~~~~~~  113 (225)
T 3p2e_A           95 K-NIADSISILFPWGTLLEY  113 (225)
T ss_dssp             T-TCEEEEEEESCCHHHHHH
T ss_pred             C-CCCCEEEEEECHHHHHHH
T ss_conf             4-775349997400355675