RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764511|ref|YP_003065518.2| S-adenosyl-methyltransferase MraW [Candidatus Liberibacter asiaticus str. psy62] (341 letters) >gnl|CDD|178824 PRK00050, PRK00050, 16S rRNA m(4)C1402 methyltranserfase; Provisional. Length = 296 Score = 397 bits (1023), Expect = e-111 Identities = 133/304 (43%), Positives = 192/304 (63%), Gaps = 17/304 (5%) Query: 20 HVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSN---VIALDRDPFAVSCGQE 76 H+PVLL++V+ L P + +D TFG GG+SR+ + +IA+DRDP A++ ++ Sbjct: 3 HIPVLLDEVVDALAIKPDGIYVDGTFGGGGHSRAILERLGPKGRLIAIDRDPDAIAAAKD 62 Query: 77 TMRDYKEQFSLFQATFSQLQDYVPD--KGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLD 134 ++ + +F+L FS L++ + + VDG++ DLGVSS Q+D +RGFSF+K GPLD Sbjct: 63 RLKPFG-RFTLVHGNFSNLKEVLAEGLGKVDGILLDLGVSSPQLDDAERGFSFRKDGPLD 121 Query: 135 MRMSCS-GISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSS 193 MRM S G++A++VVN + ++L RI GEE+ A RIA AIV+ R P TT +L+ Sbjct: 122 MRMDQSQGLTAAEVVNTYSEEELARIFKEYGEERFARRIARAIVEARPKKPITTTGELAE 181 Query: 194 LIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSL 253 +I K+ + IHPATR+FQALRI VN+E+EEL + L +A LK GG L V+SFHSL Sbjct: 182 II-KSAVPPRRKGIHPATRTFQALRIEVNDELEELERALEAALDLLKPGGRLAVISFHSL 240 Query: 254 EDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRA 313 EDR+VK+FF S P + +TKK + P++E++A N R+RSAKLR Sbjct: 241 EDRIVKRFFRELSKG--------CCGNKP-KLKLLTKKPIKPSEEEIAANPRARSAKLRV 291 Query: 314 GMRT 317 R Sbjct: 292 AERL 295 >gnl|CDD|161660 TIGR00006, TIGR00006, S-adenosyl-methyltransferase MraW. Genetics paper in 1972 links mra cluster to peptidoglycan biosynthesis in E. coli. Seems to be common in proteobacteria.wn. Length = 305 Score = 296 bits (759), Expect = 7e-81 Identities = 131/301 (43%), Positives = 192/301 (63%), Gaps = 12/301 (3%) Query: 20 HVPVLLEKVIALLNPAPGKVILDATFGAGGYSRS-FCKMGS-NVIALDRDPFAVSCGQET 77 H VLL++V+ LN P + +D T G GG+S++ ++G+ +I +DRDP A++ +E Sbjct: 4 HQSVLLDEVVEGLNIKPDGIYIDCTLGFGGHSKAILEQLGTGRLIGIDRDPQAIAFAKER 63 Query: 78 MRDYKEQFSLFQATFSQLQDYVPDKGV---DGVVFDLGVSSMQIDCGDRGFSFQKSGPLD 134 + D++ + L F+ +++ + V DG++ DLGVSS Q+D +RGFSF+ GPLD Sbjct: 64 LSDFEGRVVLIHDNFANFFEHLDELLVTKIDGILVDLGVSSPQLDDPERGFSFKHDGPLD 123 Query: 135 MRM-SCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSS 193 MRM +SA++++N + +DL RIL GEEK + RIA AIV+RR+ P QTT++L+ Sbjct: 124 MRMDQSQKLSAAEILNTYSEEDLERILKKYGEEKFSKRIARAIVERRKKKPIQTTKELAE 183 Query: 194 LIQKTVY-FSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHS 252 LI K V FSK+ IHPATR FQA+RI+VN+E+EEL + L+ A L GG L ++SFHS Sbjct: 184 LISKAVPGFSKHKSIHPATRVFQAIRIYVNDELEELEEALQFAPNLLAPGGRLSIISFHS 243 Query: 253 LEDRLVKKFFASRS-GKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKL 311 LEDR+VK FF S + + + ITKK + P++E++ N RSRSAKL Sbjct: 244 LEDRIVKNFFRELSKFPQPPGLPVKETPLYAL----ITKKPITPSEEEIKENPRSRSAKL 299 Query: 312 R 312 R Sbjct: 300 R 300 >gnl|CDD|150199 pfam09445, Methyltransf_15, RNA cap guanine-N2 methyltransferase. RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe Tgs1 and Giardia lamblia Tgs2 catalyse methylation of the exocyclic N2 amine of 7-methylguanosine. Length = 165 Score = 33.0 bits (76), Expect = 0.11 Identities = 15/45 (33%), Positives = 24/45 (53%) Query: 37 GKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDY 81 ++ILD GAGG + F + +VI +D +P ++C Q Y Sbjct: 1 ARIILDVFCGAGGNTIQFANVFCSVIGIDINPEHLACAQHNAEVY 45 >gnl|CDD|184894 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional. Length = 434 Score = 31.8 bits (73), Expect = 0.28 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Query: 28 VIALLNPAPGKVILDATFGAGGYSRSFCK-MG--SNVIALDRDP 68 V LL+P PG+VILDA GG + + MG + A+DR Sbjct: 244 VAPLLDPQPGEVILDACAAPGGKTTHIAELMGDQGEIWAVDRSA 287 >gnl|CDD|184897 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional. Length = 445 Score = 31.6 bits (72), Expect = 0.30 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%) Query: 31 LLNPAPGKVILDATFGAGGYSRSFCK--MGS--NVIALDRDP 68 LLNP PG +LD GG S +F M + + A+DR P Sbjct: 245 LLNPQPGSTVLDLCAAPGGKS-TFMAELMQNRGQITAVDRYP 285 >gnl|CDD|184932 PRK14968, PRK14968, putative methyltransferase; Provisional. Length = 188 Score = 31.4 bits (72), Expect = 0.34 Identities = 17/76 (22%), Positives = 32/76 (42%), Gaps = 5/76 (6%) Query: 36 PGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQL 95 G +L+ G+G + K G V+ +D +P+AV C + + + + + S L Sbjct: 23 KGDRVLEVGTGSGIVAIVAAKNGKKVVGVDINPYAVECAKCNAKLNNIRNNGVEVIRSDL 82 Query: 96 QDYVPDKGVDGVVFDL 111 + G FD+ Sbjct: 83 FE-----PFRGDKFDV 93 >gnl|CDD|115607 pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins. Length = 140 Score = 31.1 bits (71), Expect = 0.41 Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 82 KEQFSLFQATFSQLQDYVPDKGVDGVVFDLG 112 E L + + +Y+P+ V +F+LG Sbjct: 25 SEIVELILDSHENIDEYIPEGPVKAAIFNLG 55 >gnl|CDD|179944 PRK05134, PRK05134, bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional. Length = 233 Score = 30.1 bits (69), Expect = 0.76 Identities = 13/44 (29%), Positives = 21/44 (47%) Query: 22 PVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALD 65 P+ L + GK +LD G G S S ++G++V +D Sbjct: 34 PLRLNYIREHAGGLFGKRVLDVGCGGGILSESMARLGADVTGID 77 >gnl|CDD|150622 pfam09968, DUF2202, Uncharacterized protein domain (DUF2202). This domain, found in various hypothetical archaeal proteins, has no known function. Length = 162 Score = 30.0 bits (68), Expect = 0.94 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Query: 219 IFVNNEIEEL-----AQGLRSAEKALKAGGLLIVVSFHSLEDRL 257 +F N +++EL +G +S E ALK G + + + LE+ + Sbjct: 65 VFTNPDLQELYNQLVEKGSKSLEDALKVGATIEDLDIYDLEEAI 108 >gnl|CDD|162239 TIGR01177, TIGR01177, conserved hypothetical protein TIGR01177. This family is found exclusively in the Archaea. Length = 329 Score = 29.3 bits (66), Expect = 1.3 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 6/85 (7%) Query: 30 ALLNPA---PGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYK-EQF 85 A++N A G +LD G GG+ MG+ VI D D V+ + + Y E F Sbjct: 173 AMVNLARVTEGDRVLDPFCGTGGFLIEAGLMGAKVIGCDIDWKMVAGARINLEHYGIEDF 232 Query: 86 SLFQATFSQLQDYVPDKGVDGVVFD 110 + + ++L + + VD + D Sbjct: 233 FVKRGDATKLP--LSSESVDAIATD 255 >gnl|CDD|161931 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB. The seed alignment is built from bacterial sequences only. Eukaryotic homologs include Nop2, a protein required for processing pre-rRNA, that is likely also a rRNA methyltransferase, although the fine specificity may differ. Cutoff scores are set to avoid treating archaeal and eukaroytic homologs automatically as functionally equivalent, although they may have very similar roles. Length = 426 Score = 28.7 bits (64), Expect = 2.2 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Query: 28 VIALLNPAPGKVILDATFGAGGYSRSFCKMG--SNVIALDRD 67 V L P + ILDA GG + ++ + V+ALD Sbjct: 230 VATWLAPQNEETILDACAAPGGKTTHILELAPQAQVVALDIH 271 >gnl|CDD|177641 PHA03413, PHA03413, putative internal core protein; Provisional. Length = 1304 Score = 28.5 bits (63), Expect = 2.7 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 5/65 (7%) Query: 180 RQSAPFQTTQDLSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKAL 239 Q+A F TTQ+L + FS +R+ + + +E+E + +G A KAL Sbjct: 1046 NQAAAFNTTQNLGQAARHANGFSMVHRLMANLNAG-----IIADELENMFKGDAEAFKAL 1100 Query: 240 KAGGL 244 + GL Sbjct: 1101 EEFGL 1105 >gnl|CDD|162871 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit. This model recognizes the CbiT methylase which is responsible, in part (along with CbiE), for methylating precorrin-6y (or cobalt-precorrin-6y) at both the 5 and 15 positions as well as the concomitant decarbozylation at C-12. In many organisms, this protein is fused to the CbiE subunit. The fused protein, when found in organisms catalyzing the oxidative version of the cobalamin biosynthesis pathway, is called CobL. Length = 124 Score = 28.5 bits (64), Expect = 3.0 Identities = 14/56 (25%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Query: 28 VIALLNPAPGKVILDATFGAGGYSRSFCKMGSN--VIALDRDPFAVSCGQETMRDY 81 ++ L PG V+ D G+G + ++ N V A++R+P A+ + R + Sbjct: 11 TLSKLRLRPGDVLWDIGAGSGSITIEAARLVPNGRVYAIERNPEALRLIERNARRF 66 >gnl|CDD|129628 TIGR00537, hemK_rel_arch, HemK-related putative methylase. The gene hemK from E. coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase (Medline 95189105). Functional analysis of the nearest homolog in Saccharomyces cerevisiae, YNL063w, finds it is not protoporphyrinogen oxidase and sequence analysis suggests that HemK homologs have S-adenosyl-methionine-dependent methyltransferase activity (Medline 99237242). Homologs are found, usually in a single copy, in nearly all completed genomes, but varying somewhat in apparent domain architecture. This model represents an archaeal and eukaryotic protein family that lacks an N-terminal domain found in HemK and its eubacterial homologs. It is found in a single copy in the first six completed archaeal and eukaryotic genomes. Length = 179 Score = 28.3 bits (63), Expect = 3.0 Identities = 15/67 (22%), Positives = 26/67 (38%), Gaps = 3/67 (4%) Query: 23 VLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYK 82 +LLE + L P +L+ G G + G ++ D +PFAV +E + Sbjct: 9 LLLEANLRELKP---DDVLEIGAGTGLVAIRLKGKGKCILTTDINPFAVKELRENAKLNN 65 Query: 83 EQFSLFQ 89 + Sbjct: 66 VGLDVVM 72 >gnl|CDD|182838 PRK10919, PRK10919, ATP-dependent DNA helicase Rep; Provisional. Length = 672 Score = 28.3 bits (63), Expect = 3.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 224 EIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRL 257 ++ +L Q RS+ + LKA +LI + H E RL Sbjct: 269 QVIKLEQNYRSSGRILKAANILIANNPHVFEKRL 302 >gnl|CDD|182489 PRK10477, PRK10477, outer membrane lipoprotein Blc; Provisional. Length = 177 Score = 27.7 bits (62), Expect = 4.3 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Query: 58 GSNVIALDRD-PFAVSCGQETMRDY 81 G NVIALDR+ A+ CG + RDY Sbjct: 115 GYNVIALDREYRHALVCGPD--RDY 137 >gnl|CDD|162663 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyltransferase. This model represents the S-adenosylmethionine-dependent O-methyltransferase responsible for methylation of magnesium protoporphyrin IX. This step is essentiasl for the biosynthesis of both chlorophyll and bacteriochlorophyll. This model encompasses two closely related clades, from cyanobacteria (and plants) where it is called ChlM and other photosynthetic bacteria where it is known as BchM. Length = 219 Score = 27.5 bits (61), Expect = 5.2 Identities = 14/40 (35%), Positives = 18/40 (45%) Query: 37 GKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQE 76 GK +LDA G G S K G+ V A+D V + Sbjct: 56 GKRVLDAGCGTGLLSIELAKRGAIVKAVDISEQMVQMARN 95 >gnl|CDD|162613 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosynthesis methyltransferases. Note that a number of non-orthologous genes which are members of pfam03737 have been erroneously annotated as MenG methyltransferases. Length = 223 Score = 27.2 bits (61), Expect = 5.5 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 212 RSFQALRI-FVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFASRSGKVM 270 SF A+ I F + ++ + LR + LK GG L+++ F + L+KKF+ V+ Sbjct: 105 NSFDAVTIAFGLRNVTDIQKALREMYRVLKPGGRLVILEFSKPANALLKKFYKFYLKNVL 164 >gnl|CDD|182822 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional. Length = 427 Score = 27.5 bits (62), Expect = 5.6 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 14/46 (30%) Query: 31 LLNPAPGKVILDATFGAGGYSRSFCKMG--------SNVIALDRDP 68 LL P G+ +LDA GG K + V+ALD D Sbjct: 239 LLAPQNGERVLDACAAPGG------KTAHILELAPQAQVVALDIDA 278 >gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional. Length = 251 Score = 27.5 bits (61), Expect = 5.6 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 6/53 (11%) Query: 86 SLFQATFSQLQDYVPDKGVDG--VVFDLGVSSMQIDC----GDRGFSFQKSGP 132 S F F+++ D+VP+ V G + + V S+ + G FQK P Sbjct: 45 STFLRCFNRMNDFVPNCKVKGELDIDGIDVYSVDTNVVLLRAKVGMVFQKPNP 97 >gnl|CDD|181470 PRK08562, rpl32e, 50S ribosomal protein L32e; Validated. Length = 125 Score = 27.2 bits (61), Expect = 7.2 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 4/29 (13%) Query: 152 NVKDLTRILGILGEEKQASRIAHAIVKRR 180 NVK+L + L E QA+RIA + KR+ Sbjct: 81 NVKELEK----LDPETQAARIASTVGKRK 105 >gnl|CDD|180083 PRK05441, murQ, N-acetylmuramic acid-6-phosphate etherase; Reviewed. Length = 299 Score = 27.1 bits (61), Expect = 8.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 221 VNNEIEELAQGLRSAEKALKAGGLLI 246 V + ++A + +A AL+ GG LI Sbjct: 41 VEKALPQIAAAVDAAAAALRQGGRLI 66 >gnl|CDD|128898 smart00650, rADc, Ribosomal RNA adenine dimethylases. Length = 169 Score = 26.7 bits (60), Expect = 8.2 Identities = 11/45 (24%), Positives = 23/45 (51%) Query: 24 LLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDP 68 +++K++ N PG +L+ G G + + + V A++ DP Sbjct: 1 VIDKIVRAANLRPGDTVLEIGPGKGALTEELLERAARVTAIEIDP 45 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.134 0.377 Gapped Lambda K H 0.267 0.0681 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,426,009 Number of extensions: 343897 Number of successful extensions: 733 Number of sequences better than 10.0: 1 Number of HSP's gapped: 722 Number of HSP's successfully gapped: 33 Length of query: 341 Length of database: 5,994,473 Length adjustment: 94 Effective length of query: 247 Effective length of database: 3,963,321 Effective search space: 978940287 Effective search space used: 978940287 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (25.8 bits)