Query         gi|255764513|ref|YP_003065530.2| glutamyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 492
No_of_seqs    247 out of 3465
Neff          6.7 
Searched_HMMs 39220
Date          Tue May 31 15:08:35 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 255764513.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK00574 gltX glutamyl-tRNA sy 100.0       0       0 1328.2  34.3  473    4-480     2-488 (489)
  2 TIGR00464 gltX_bact glutamyl-t 100.0       0       0 1332.9  28.9  473    6-480     1-512 (513)
  3 PRK01406 gltX glutamyl-tRNA sy 100.0       0       0 1221.9  33.7  461    6-480     2-467 (467)
  4 PRK12558 glutamyl-tRNA synthet 100.0       0       0 1160.6  30.3  451    6-477     2-461 (461)
  5 KOG1149 consensus              100.0       0       0 1100.0  26.3  474    5-485    32-522 (524)
  6 PRK12410 glutamyl-tRNA synthet 100.0       0       0 1085.0  27.5  425    8-466     1-426 (433)
  7 COG0008 GlnS Glutamyl- and glu 100.0       0       0  972.9  30.8  451    7-477    10-471 (472)
  8 pfam00749 tRNA-synt_1c tRNA sy 100.0       0       0  868.4  18.2  310    6-324     1-314 (314)
  9 PRK05710 glutamyl-Q tRNA(Asp)  100.0       0       0  787.5  16.5  292    4-316     2-298 (299)
 10 cd00808 GluRS_core Descriminat 100.0       0       0  707.4  16.9  239    6-332     1-239 (239)
 11 cd00418 GlxRS_core Glutamyl-tR 100.0       0       0  591.1  12.5  206    6-331     1-222 (223)
 12 PRK04156 gltX glutamyl-tRNA sy 100.0       0       0  579.5  18.2  263    4-289    98-388 (566)
 13 cd00807 Gln_GluRS_non_core Glu 100.0       0       0  575.3  14.3  219    6-310     1-235 (238)
 14 TIGR00463 gltX_arch glutamyl-t 100.0       0       0  485.9  16.4  289    5-328   100-431 (600)
 15 PRK05347 glutaminyl-tRNA synth 100.0       0       0  417.8  18.3  289    4-323    27-355 (556)
 16 KOG1147 consensus              100.0 3.1E-36 7.8E-41  266.4  17.7  268    4-330   198-503 (712)
 17 TIGR00440 glnS glutaminyl-tRNA 100.0 3.4E-37 8.7E-42  272.9  10.3  298    7-323     1-332 (564)
 18 KOG1148 consensus              100.0 1.2E-35 3.1E-40  262.3  14.1  298    3-326   245-572 (764)
 19 cd00802 class_I_aaRS_core Clas  99.9 1.1E-27 2.7E-32  208.4   5.4  134    7-258     1-142 (142)
 20 PRK00750 lysK lysyl-tRNA synth  99.7 1.6E-14 4.1E-19  118.9  20.6  422   12-474    36-513 (513)
 21 PRK01611 argS arginyl-tRNA syn  99.4 6.3E-13 1.6E-17  108.1   9.2  134  185-327   298-447 (570)
 22 COG1384 LysS Lysyl-tRNA synthe  99.4 4.8E-11 1.2E-15   95.3  15.2  430    6-476    20-521 (521)
 23 PRK12451 arginyl-tRNA syntheta  99.3 1.4E-11 3.6E-16   98.9  10.8  134  184-326   293-443 (562)
 24 cd00814 MetRS_core This is the  99.3 2.3E-11 5.8E-16   97.5  11.0  249    8-284     4-310 (319)
 25 cd00668 Ile_Leu_Val_MetRS_core  99.3 1.4E-10 3.5E-15   92.2  13.8  260    9-285     5-326 (334)
 26 PRK11893 methionyl-tRNA synthe  99.2 3.8E-10 9.7E-15   89.2  13.2  266    9-306     6-349 (512)
 27 pfam00750 tRNA-synt_1d tRNA sy  99.2 1.7E-10 4.2E-15   91.7  11.2  140  175-319   187-345 (345)
 28 pfam09334 tRNA-synt_1g tRNA sy  99.2   2E-10 5.1E-15   91.1  10.8   93   10-109     5-115 (388)
 29 TIGR03447 mycothiol_MshC cyste  99.1 1.3E-08 3.2E-13   78.9  14.0  230    4-283    34-318 (411)
 30 PRK00260 cysS cysteinyl-tRNA s  99.0 5.5E-08 1.4E-12   74.6  15.9  225   12-288    30-300 (460)
 31 pfam01406 tRNA-synt_1e tRNA sy  99.0 9.2E-09 2.4E-13   79.8  11.9  247   12-303    16-298 (301)
 32 PRK12268 methionyl-tRNA synthe  99.0 4.4E-08 1.1E-12   75.2  14.6  280    7-306     6-383 (558)
 33 COG0018 ArgS Arginyl-tRNA synt  99.0 3.2E-09 8.2E-14   82.9   8.7  291    5-327   117-453 (577)
 34 PRK00133 metG methionyl-tRNA s  99.0 4.3E-09 1.1E-13   82.1   9.1  286    9-314     7-385 (666)
 35 PRK12418 cysteinyl-tRNA synthe  98.9   7E-08 1.8E-12   73.8  14.0  224   11-286    15-294 (384)
 36 PRK12267 methionyl-tRNA synthe  98.8 6.7E-09 1.7E-13   80.8   6.2  284    1-313     1-355 (644)
 37 cd00671 ArgRS_core This is the  98.8 3.8E-08 9.7E-13   75.6   8.5   84  175-258   172-267 (267)
 38 COG0215 CysS Cysteinyl-tRNA sy  98.7 1.4E-07 3.7E-12   71.7   8.6  230   12-287    29-301 (464)
 39 COG0143 MetG Methionyl-tRNA sy  98.6 6.8E-07 1.7E-11   67.1  10.4  292    4-314     5-390 (558)
 40 PRK12282 tryptophanyl-tRNA syn  98.6 9.8E-06 2.5E-10   59.3  15.7  195   14-284    10-221 (333)
 41 cd00812 LeuRS_core This is the  98.6 4.5E-07 1.2E-11   68.3   8.4   67  217-285   295-368 (376)
 42 cd00395 Tyr_Trp_RS_core Tyrosi  98.6 6.3E-06 1.6E-10   60.6  14.2  201    7-284     3-213 (274)
 43 cd00674 LysRS_core_class_I Thi  98.5 3.9E-06 9.9E-11   62.0  12.7  253    5-283    19-303 (354)
 44 pfam00579 tRNA-synt_1b tRNA sy  98.5 1.8E-06 4.7E-11   64.2  11.0  184    7-264     8-207 (291)
 45 pfam01921 tRNA-synt_1f tRNA sy  98.4 5.8E-06 1.5E-10   60.8  10.6  257    6-289    20-311 (355)
 46 PRK12283 tryptophanyl-tRNA syn  98.4 5.6E-05 1.4E-09   54.1  15.3   91   14-120    10-107 (398)
 47 cd00817 ValRS_core This is the  98.3 4.2E-06 1.1E-10   61.7   8.4   96    9-111     6-137 (363)
 48 COG0180 TrpS Tryptophanyl-tRNA  98.3 2.6E-05 6.7E-10   56.4  11.8  199   12-286    11-226 (314)
 49 cd00806 TrpRS_core Tryptophany  98.2 2.4E-05 6.2E-10   56.6   9.8  199    7-284     3-218 (282)
 50 PRK00927 tryptophanyl-tRNA syn  98.1 3.6E-05 9.2E-10   55.4   9.4  180    7-261     3-199 (325)
 51 cd00818 IleRS_core This is the  98.1 2.1E-05 5.3E-10   57.0   7.5  254    9-285     6-331 (339)
 52 PRK12284 tryptophanyl-tRNA syn  98.1 3.3E-05 8.5E-10   55.7   8.5  185   13-262     9-210 (436)
 53 PRK12556 tryptophanyl-tRNA syn  97.9 4.9E-05 1.3E-09   54.5   7.1  184   12-261     9-208 (328)
 54 PRK08560 tyrosyl-tRNA syntheta  97.9 7.9E-05   2E-09   53.1   8.1  182    6-259    30-225 (333)
 55 cd00805 TyrRS_core Tyrosinyl-t  97.8 0.00016 4.2E-09   51.0   8.4   84  196-282   136-219 (268)
 56 PRK05729 valS valyl-tRNA synth  97.8 0.00025 6.5E-09   49.7   8.8   90   12-110    43-170 (877)
 57 PRK13208 valS valyl-tRNA synth  97.7 0.00032 8.1E-09   49.0   9.1   88   12-110    46-170 (809)
 58 TIGR00398 metG methionyl-tRNA   97.7  0.0001 2.7E-09   52.3   6.5  282   13-312     8-402 (573)
 59 cd02156 nt_trans nt_trans (nuc  97.7 4.1E-05   1E-09   55.0   4.0   43   11-54      2-44  (147)
 60 pfam00133 tRNA-synt_1 tRNA syn  97.6  0.0014 3.5E-08   44.7  10.1  163    9-195    28-234 (606)
 61 PRK06039 ileS isoleucyl-tRNA s  97.5   0.002 5.1E-08   43.5  10.0   88   12-110    43-171 (1042)
 62 TIGR00422 valS valyl-tRNA synt  97.4 0.00066 1.7E-08   46.8   7.0   16  245-260   578-593 (970)
 63 PRK13804 ileS isoleucyl-tRNA s  97.3  0.0032 8.2E-08   42.2   9.3   90   12-110    62-189 (966)
 64 TIGR00467 lysS_arch lysyl-tRNA  97.2  0.0061 1.5E-07   40.3  10.3  449    5-475    19-538 (539)
 65 TIGR00456 argS arginyl-tRNA sy  97.2 0.00073 1.9E-08   46.6   5.6  301    5-327   118-475 (600)
 66 PRK00390 leuS leucyl-tRNA synt  97.2 0.00095 2.4E-08   45.8   6.1   87   12-109    40-150 (822)
 67 PRK05743 ileS isoleucyl-tRNA s  97.2  0.0029 7.5E-08   42.4   8.5   89   12-111    57-182 (910)
 68 PRK12285 tryptophanyl-tRNA syn  97.1  0.0066 1.7E-07   40.0   8.9  186    7-264    69-263 (369)
 69 TIGR00435 cysS cysteinyl-tRNA   97.0  0.0038 9.8E-08   41.6   7.6  198   53-289   207-449 (660)
 70 COG0525 ValS Valyl-tRNA synthe  96.9   0.014 3.7E-07   37.8   9.4   93   11-110    40-168 (877)
 71 cd00672 CysRS_core This is the  96.8   0.006 1.5E-07   40.3   7.1  169   12-283    27-203 (213)
 72 COG0495 LeuS Leucyl-tRNA synth  96.6  0.0041 1.1E-07   41.4   5.2   95    9-110    39-153 (814)
 73 TIGR00456 argS arginyl-tRNA sy  96.5  0.0015 3.9E-08   44.4   2.3   63   41-110   227-298 (600)
 74 TIGR00396 leuS_bact leucyl-tRN  96.5  0.0075 1.9E-07   39.7   5.6   93   13-110    40-151 (916)
 75 TIGR00233 trpS tryptophanyl-tR  96.4    0.01 2.7E-07   38.7   6.0  217   14-286    10-253 (366)
 76 KOG2007 consensus               94.5    0.21 5.4E-06   29.8   7.0  236    8-289    56-340 (586)
 77 KOG0435 consensus               94.3   0.036 9.1E-07   35.1   2.8   95    6-111    59-177 (876)
 78 PRK12300 leuS leucyl-tRNA synt  94.3     0.3 7.7E-06   28.8   7.4   72  211-285   525-602 (888)
 79 KOG2713 consensus               93.2     0.4   1E-05   28.0   6.5  153   13-236    20-181 (347)
 80 KOG0432 consensus               91.6    0.86 2.2E-05   25.7   6.6   92   12-110    83-211 (995)
 81 COG0162 TyrS Tyrosyl-tRNA synt  77.9     1.7 4.4E-05   23.6   2.3   66  196-261   166-231 (401)
 82 TIGR00395 leuS_arch leucyl-tRN  69.6     0.4   1E-05   27.9  -2.6  113  214-331   695-834 (1109)
 83 PRK13354 tyrosyl-tRNA syntheta  69.0     5.3 0.00013   20.3   3.1   80  197-283   172-254 (405)
 84 KOG0156 consensus               68.1     4.3 0.00011   21.0   2.4   56    8-63     24-86  (489)
 85 COG5477 Predicted small integr  66.4     6.7 0.00017   19.7   3.1   45   28-72     30-76  (97)
 86 KOG0436 consensus               65.0      11 0.00028   18.1   8.4  265   15-305    50-392 (578)
 87 COG0060 IleS Isoleucyl-tRNA sy  64.1      12  0.0003   18.0   4.7   42  242-283   590-631 (933)
 88 cd06115 AthCS_per_like Arabido  61.9      13 0.00032   17.8   5.5   12  454-465   363-374 (410)
 89 KOG2361 consensus               59.6      13 0.00032   17.8   3.6  161   35-206    13-222 (264)
 90 cd06107 EcCS_AthCS-per_like Es  58.3      15 0.00037   17.4   6.7   15  113-127    59-73  (382)
 91 PRK05912 tyrosyl-tRNA syntheta  57.7      11 0.00027   18.3   2.9   95  197-307   168-265 (402)
 92 PRK13389 UTP--glucose-1-phosph  54.5      11 0.00028   18.2   2.5   78  272-351   219-298 (302)
 93 cd03473 Rieske_CMP_Neu5Ac_hydr  51.9     6.7 0.00017   19.6   1.1   28   27-56     44-73  (107)
 94 KOG3349 consensus               45.2      23 0.00059   16.0   3.0   22   93-114   115-136 (170)
 95 PRK07561 DNA topoisomerase I;   44.3      20 0.00051   16.4   2.5  110   18-127   173-343 (878)
 96 TIGR00392 ileS isoleucyl-tRNA   44.1     5.8 0.00015   20.0  -0.2   44  241-284   656-707 (938)
 97 COG0742 N6-adenine-specific me  43.2      19  0.0005   16.5   2.4   34    9-42     14-48  (187)
 98 cd06116 CaCS_like Chloroflexus  43.0      25 0.00063   15.8   5.9   12  454-465   336-347 (384)
 99 TIGR02042 sir sulfite reductas  42.8      23 0.00058   16.0   2.6   32  420-454   468-499 (583)
100 TIGR01480 copper_res_A copper-  42.1      19 0.00049   16.5   2.2   45  149-193   135-194 (644)
101 COG1754 Uncharacterized C-term  41.9      14 0.00036   17.4   1.5   10   78-87     37-46  (298)
102 KOG0437 consensus               41.6      26 0.00067   15.6   4.9   45  215-261   668-717 (1080)
103 COG4720 Predicted membrane pro  40.5      13 0.00034   17.6   1.2   26   13-38     29-56  (177)
104 COG3733 TynA Cu2+-containing a  40.5     6.5 0.00017   19.7  -0.4   32  182-213   297-328 (654)
105 COG1938 Archaeal enzymes of AT  40.0      28 0.00071   15.5   7.1   82  168-253    60-160 (244)
106 TIGR02884 spore_pdaA delta-lac  37.6      25 0.00064   15.8   2.2   11   96-106    80-90  (225)
107 TIGR00871 zwf glucose-6-phosph  37.0     8.2 0.00021   19.0  -0.4  180  246-437     6-228 (498)
108 PRK13805 bifunctional acetalde  36.7      31 0.00079   15.1   8.1   31   92-125   265-295 (862)
109 PRK11913 phhA phenylalanine 4-  34.3     6.5 0.00017   19.7  -1.2   76  199-287    93-168 (272)
110 pfam10245 MRP-S22 Mitochondria  33.7      35 0.00088   14.8   3.0   55   51-128     2-56  (243)
111 pfam06253 MTTB Trimethylamine   33.1      16 0.00041   17.0   0.6  141   78-228    29-191 (505)
112 KOG4144 consensus               32.9      35  0.0009   14.7   3.0   67  265-332   111-186 (190)
113 COG1281 Disulfide bond chapero  32.9      35 0.00091   14.7   2.6   10  171-180    86-95  (286)
114 pfam06971 Put_DNA-bind_N Putat  32.7      36 0.00091   14.7   3.5   30   88-120     7-36  (49)
115 PRK09138 DNA topoisomerase I;   32.5      22 0.00057   16.1   1.3  111   17-127   162-326 (887)
116 pfam08275 Toprim_N DNA primase  32.3      29 0.00073   15.3   1.8   28  260-289    11-38  (128)
117 PRK05614 gltA type II citrate   32.1      37 0.00093   14.6   5.7   13  453-465   373-385 (414)
118 KOG0434 consensus               32.0     7.7  0.0002   19.2  -1.1   33  228-260   572-607 (1070)
119 PRK10602 murein peptide amidas  31.9      22 0.00057   16.1   1.2   75  182-268    23-99  (237)
120 pfam07155 DUF1393 Protein of u  31.3      17 0.00044   16.8   0.5   24   16-39     32-55  (169)
121 cd06114 EcCS_like Escherichia   31.0      38 0.00097   14.5   5.7   12  454-465   361-372 (400)
122 KOG3180 consensus               30.8       2   5E-05   23.3  -4.4   85  173-258   119-208 (254)
123 PRK01402 hslO Hsp33-like chape  30.7      39 0.00098   14.5   2.7   14  170-183    95-108 (327)
124 COG5279 CYK3 Uncharacterized p  30.4      39   0.001   14.4   5.2  157   87-261   188-349 (521)
125 COG2969 SspB Stringent starvat  28.5      22 0.00056   16.1   0.7   20    5-24     48-67  (155)
126 TIGR02716 C20_methyl_CrtF C-20  28.2      33 0.00083   15.0   1.5   26  197-222    85-110 (306)
127 COG3350 Uncharacterized conser  28.0      43  0.0011   14.2   2.1   20  104-124    24-43  (53)
128 COG5185 HEC1 Protein involved   27.3      22 0.00057   16.1   0.5   42   28-71     79-123 (622)
129 pfam09424 YqeY Yqey-like prote  27.2      44  0.0011   14.1   2.3   56  400-460    80-139 (143)
130 cd03348 pro_PheOH Prokaryotic   26.9      13 0.00033   17.7  -0.7   75  200-287    82-156 (228)
131 PRK07941 DNA topoisomerase I;   26.9      45  0.0011   14.0   2.4   73   55-127   265-356 (933)
132 PRK08780 DNA topoisomerase III  26.9      34 0.00088   14.8   1.4   17   19-35    166-182 (783)
133 TIGR03388 ascorbase L-ascorbat  26.6      45  0.0011   14.0   2.9   33    5-45     85-121 (541)
134 TIGR01267 Phe4hydrox_mono phen  26.6      16 0.00042   17.0  -0.2   12  240-251   115-126 (251)
135 pfam12000 DUF3495 Domain of un  26.4     8.9 0.00023   18.8  -1.6   57  262-321    55-112 (172)
136 cd00361 arom_aa_hydroxylase Bi  25.8      10 0.00026   18.4  -1.4   75  200-287    76-150 (221)
137 TIGR00432 arcsn_tRNA_tgt archa  25.7      33 0.00083   15.0   1.1   13  317-329   286-298 (658)
138 COG0302 FolE GTP cyclohydrolas  25.6      42  0.0011   14.2   1.7   27   44-74      6-32  (195)
139 cd00498 Hsp33 Heat shock prote  25.5      47  0.0012   13.9   3.0   11  172-182    81-91  (275)
140 pfam10863 DUF2702 Protein of u  25.2      40   0.001   14.4   1.5   29  293-326     5-33  (142)
141 pfam03315 SDH_beta Serine dehy  24.9      24 0.00062   15.8   0.4   19   15-33      5-24  (148)
142 pfam01430 HSP33 Hsp33 protein.  24.7      49  0.0012   13.8   3.0   12  271-282   132-143 (274)
143 pfam03206 NifW Nitrogen fixati  24.4      49  0.0013   13.7   4.2   53   63-126    15-68  (103)
144 TIGR02930 vnfG_nitrog V-contai  24.1      50  0.0013   13.7   4.2   80  362-453    23-102 (109)
145 PRK10122 UTP--glucose-1-phosph  23.8      51  0.0013   13.7   2.4   76  272-349   216-293 (297)
146 PRK13531 regulatory ATPase Rav  23.5      25 0.00063   15.8   0.2   71  157-248    74-149 (498)
147 pfam01589 Alpha_E1_glycop Alph  23.5      48  0.0012   13.8   1.7   91  166-265   217-316 (502)
148 PRK11750 gltB glutamate syntha  23.2      52  0.0013   13.6   3.5   97   15-114   234-347 (1483)
149 COG2461 Uncharacterized conser  22.9      36 0.00093   14.6   1.0   22  433-454   363-384 (409)
150 cd03346 eu_TrpOH Eukaryotic tr  22.9      17 0.00044   16.9  -0.7   77  196-286   132-208 (287)
151 TIGR00538 hemN oxygen-independ  22.9      39 0.00098   14.5   1.1  127  194-337   113-259 (462)
152 TIGR02541 flagell_FlgJ flagell  22.9      23 0.00058   16.0  -0.1   20  268-287   201-221 (332)
153 COG1160 Predicted GTPases [Gen  22.8      53  0.0013   13.5   3.2   76  355-432   297-373 (444)
154 PHA00451 protein kinase         22.6      10 0.00027   18.3  -1.9   26  101-134    98-123 (364)
155 cd06568 GH20_SpHex_like A subg  22.5      54  0.0014   13.5   2.2   71   49-130     9-90  (329)
156 PRK12365 ribonucleotide-diphos  22.1      55  0.0014   13.4   3.1   48   29-76    546-594 (1046)
157 COG0282 ackA Acetate kinase [E  22.0      37 0.00094   14.6   0.8   19   54-72     60-78  (396)
158 TIGR00368 TIGR00368 Mg chelata  21.6      34 0.00087   14.8   0.6   57  209-286   324-380 (505)
159 cd03347 eu_PheOH Eukaryotic ph  21.4      18 0.00046   16.7  -0.9   77  196-286   132-208 (306)
160 PRK03003 engA GTP-binding prot  21.3      57  0.0014   13.3   2.5   39  396-434   367-406 (474)
161 PRK06599 DNA topoisomerase I;   21.0      43  0.0011   14.2   1.0   72   55-126   228-326 (776)
162 KOG0433 consensus               20.1      60  0.0015   13.2  10.1   88   15-111    66-189 (937)
163 PRK05773 3,4-dihydroxy-2-butan  20.1      21 0.00054   16.3  -0.7   37  241-280   144-182 (218)

No 1  
>PRK00574 gltX glutamyl-tRNA synthetase; Reviewed
Probab=100.00  E-value=0  Score=1328.20  Aligned_cols=473  Identities=42%  Similarity=0.747  Sum_probs=457.7

Q ss_pred             CCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             87705634843388785015999999999999718849999704866638867999999998865898886765588767
Q gi|255764513|r    4 SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYG   83 (492)
Q Consensus         4 ~~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~   83 (492)
                      +++|||||||||||+|||||+|||||||||||++||+|||||||||++|+++++++.|+++|+||||+|||||..||+||
T Consensus         2 m~~vrtRFAPSPTG~lHiG~~rtAl~n~l~Ar~~~G~fiLRIEDTD~~R~~~~~~~~I~~~L~wlgl~~DE~p~~~g~~g   81 (489)
T PRK00574          2 MKKVRVRFAPSPTGYLHIGNARTALFNYLFAKHNNGKFILRIEDTDQERNVEGGEESQLENLKWLGIDWDEGPDKGGEYG   81 (489)
T ss_pred             CCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             98871737989998422478999999999999649989998677898778769999999999987988877877788888


Q ss_pred             CEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             63232628999999999998898245148899977668876643100023665557883330011202577407886224
Q gi|255764513|r   84 PYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPN  163 (492)
Q Consensus        84 p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~  163 (492)
                      ||+||+|+++|+++|++|+++|+|||||||+|||+.+|+.|.+.|.+|+|||+||+++.+|++.++++|++||||||+|+
T Consensus        82 PY~QS~R~~~Y~~~a~~Ll~~G~AY~Cfct~eel~~~r~~~~~~g~~~~Y~~~cr~l~~~e~~~~~~~g~~~viRfk~p~  161 (489)
T PRK00574         82 PYRQSERLDIYQKYADQLLEEGKAYYCFCTEEELEAEREKQEARGETPKYDGKCLGLTKEEIEEYEAEGIPPVIRFKVPE  161 (489)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEECCC
T ss_conf             83512689999999999997499745257799999989999756999878723233898889989856999237653699


Q ss_pred             CCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHH
Q ss_conf             31143047513402136432356410004532489867887644444443112235430247889999985100000101
Q gi|255764513|r  164 QGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH  243 (492)
Q Consensus       164 ~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H  243 (492)
                      ++++.|+|+|||+|+|+++++|||||+||||+||||||||||||+|+|||||||||||+|||||++||+||||++|+|||
T Consensus       162 ~~~~~~~D~v~G~i~~~~~~ldD~Vi~rsDG~PtYhla~VVDD~~M~ITHVIRGedhlsnTpkqi~ly~Alg~~~P~faH  241 (489)
T PRK00574        162 NGTYSFDDIVKGKISFDSSTIGDFVIVKSDGFPTYNFAVVVDDHLMEITHVIRGEDHISNTPKQIMIYEAFGWEPPKFGH  241 (489)
T ss_pred             CCEEEEEEECCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCCCCCCCEEECCHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             87189864236764657566787688814898056412114751258764303521577639999999982899974785


Q ss_pred             HHHHHHHHCCCCCCCCCCC--CHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCCCCCHHHH
Q ss_conf             4555311013221223433--02456662977377998998506766655301101467776520211375544201565
Q gi|255764513|r  244 LPLIKNPDKSKLSKRRNPT--SISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQK  321 (492)
Q Consensus       244 ~pli~~~~g~klSKR~~~~--~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks~A~FD~eK  321 (492)
                      +|||+++||+|||||+|++  ||.+||++||+||||+||||+||||++ +++||||++|||+.|||++|+||||+||++|
T Consensus       242 lPLi~~~dg~KLSKR~g~~~~sv~~yre~GylPeAl~NyLa~LGWs~~-~~~Eifsl~eli~~FdL~~i~ks~A~FD~~K  320 (489)
T PRK00574        242 MPLILNEDRKKLSKRDGATLQFIEDYRELGYLPEAIFNFIALLGWSPE-GEEEIFSLEELIKLFDLKRLSKSPAIFDQKK  320 (489)
T ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHCCCCC-CCCCCCCHHHHHHHCCCCCCCCCCCCCCHHH
T ss_conf             111378999816666797015799999879866699999998079999-8746589999986458256878888379999


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHCC------------CCCCCCHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHH
Q ss_conf             5664355551269989999864442000------------0123220688872532035667755675224678885455
Q gi|255764513|r  322 LDWLNGRWIREKLSTTEFLSRVSQWMKE------------KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESF  389 (492)
Q Consensus       322 L~wlN~qyIr~~l~~~el~~~l~~~l~~------------~~~l~~il~likeRi~tL~Di~~~~~ffF~~~~~~d~e~~  389 (492)
                      |+|+|++||+ .++.+++.+.+.+|++.            .+++.++++++|+|+++++|+.+++.|||.++..++++..
T Consensus       321 L~wlN~~~l~-~l~~e~l~~~~~~~l~~~~~~~~~~~~~~~~~l~~il~lik~ri~~l~di~~~~~~ff~~~~~~~~~~~  399 (489)
T PRK00574        321 LKWMNNQYIK-NLDLEEVVELAKPFLEKAGRITEELSEEDDEWLKKVIELYKERVSYLAEIVELSDLFFKEPPELEEEEK  399 (489)
T ss_pred             HHHHHHHHHH-HCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCHHHH
T ss_conf             9999999998-399999999999999975766545661109999999999986326499999999987179865798999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCHHHHCCEEEEEEECCCCCCCHHHHHHHHCHHHHH
Q ss_conf             43314866799999999998405888998889999999999957982331012678896488888899999884959999
Q gi|255764513|r  390 KSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY  469 (492)
Q Consensus       390 ~k~~~~~e~~~~iL~~~~~~L~~~~~w~~e~Ie~~ik~i~e~~giK~k~l~~PLRiALTG~~~GP~L~eil~lLGkeetl  469 (492)
                      ++  ..++.+..+|..+.+.++++++|+.++|+++++++++++|+|+|++|+|||+||||+++||+|+++|++|||++|+
T Consensus       400 ~~--~~~e~~~~iL~~~~~~l~~~~~w~~e~i~~~ik~~~~~~~iK~k~l~~pLR~ALTG~~~GP~l~~i~~lLGkee~l  477 (489)
T PRK00574        400 EV--LKGEQVPEVLEEFKEKLEALEDFTAENIKEAIKAVQKETGIKGKNLFMPIRIAVTGKMHGPELPEIIELLGKEKVL  477 (489)
T ss_pred             HH--HCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHCHHHHH
T ss_conf             87--5565399999999999863898999999999999999959899999999999991998594999999980989999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|255764513|r  470 FRLRHAIALVS  480 (492)
Q Consensus       470 ~RL~~aL~~l~  480 (492)
                      +||++||+.|+
T Consensus       478 ~RL~~al~~l~  488 (489)
T PRK00574        478 KRLKKVLEKLK  488 (489)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999850


No 2  
>TIGR00464 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    Glutamyl-tRNA synthetase (6.1.1.17 from EC) is a class Ic synthetase and shows several similarities with glutaminyl-tRNA synthetase concerning structure and catalytic properties. It is an alpha2 dimer. To date one crystal structure of a glutamyl-tRNA synthetase (Thermus thermophilus) has been solved. The molecule has the form of a bent cylinder and consists of four domains. The N-terminal half (domains 1 and 2) contains the 'Rossman fold' typical for class I synthetases and resembles the corresponding part of E. coli GlnRS, whereas the C-terminal half exhibits a GluRS-specific structure . ; GO: 0000166 nucleotide binding, 0004818 glutamate-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006424 glutamyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=1332.87  Aligned_cols=473  Identities=42%  Similarity=0.738  Sum_probs=458.5

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCE
Q ss_conf             70563484338878501599999999999971884999970486663886799999999886589888676558876763
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPY   85 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~   85 (492)
                      +|||||||||||||||||+|||||||||||++||+|||||||||++|+++|+.++|++.|+||||.|||+|.+||.||||
T Consensus         1 ~vrtRfAPSPTG~LHiGg~RTAlFNyLfAr~~~G~F~lRiEDTD~eR~~~e~~~~i~e~LkWlGi~wDEs~~~gG~Y~Py   80 (513)
T TIGR00464         1 KVRTRFAPSPTGYLHIGGARTALFNYLFARHTGGKFILRIEDTDLERNIEEAEESILEGLKWLGISWDESVYVGGNYGPY   80 (513)
T ss_pred             CCEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEE
T ss_conf             92377338887543533689999999999863893799875367100724468999988874586746675689863011


Q ss_pred             ECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHH-HH-HHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             232628999999999998898245148899977668-87-6643100023665557883330011202577407886224
Q gi|255764513|r   86 RQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR-RA-QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPN  163 (492)
Q Consensus        86 ~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r-~~-~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~  163 (492)
                      +||+|+++|++++++|+++|+||+||||+|+||..| +. |.+++.+|+|||+|||++.++++..+++|.+||||||+|.
T Consensus        81 ~QS~R~~~Y~~~~~~Ll~~g~AYrCYCs~E~LE~~Rke~~q~~~~~~PrYd~~cr~l~~~~~~~~l~~~~~pvvRfK~P~  160 (513)
T TIGR00464        81 YQSQRLDIYKKYIKELLEEGLAYRCYCSKEELERLRKEEIQKANKETPRYDGRCRNLHEEEIENKLAKGIPPVVRFKIPQ  160 (513)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHCCCCCEEEEECCC
T ss_conf             10136789999999997459934422784678899899999708853483753347871378876443799668874079


Q ss_pred             CCEEECCCCCCCCEECCCCCCC------CCCEECCC-------CCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH
Q ss_conf             3114304751340213643235------64100045-------3248986788764444444311223543024788999
Q gi|255764513|r  164 QGSCVFQDKVYGEMEIPWNAVD------MQVLLKSD-------GMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILL  230 (492)
Q Consensus       164 ~~~~~~~D~i~G~~~~~~~~~~------D~vi~r~d-------g~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l  230 (492)
                      ++.+.|+|.|||+|+|.+++++      ||||+|+|       |+|||||||||||++|+||||||||||+|||||||+|
T Consensus       161 ~~~~~F~D~v~G~i~~~~~~l~~dkrydD~vi~k~DenPeeafG~PTYNfAvvvDD~lM~IThViRGedHisNTPkQI~i  240 (513)
T TIGR00464       161 EAEISFNDQVRGEITFEGSELDNDKRYDDLVILKSDENPEEAFGSPTYNFAVVVDDYLMKITHVIRGEDHISNTPKQILI  240 (513)
T ss_pred             CCCEEECCEEEEEEEECCCCCCCCCCCCCEEEEECCCCHHHHCCCCCCCEEEEEECCCCCCCEEEECCHHHCCCHHHHHH
T ss_conf             98424505022158855866786644156126406888322148864250678853325545144120200671899999


Q ss_pred             HHHHHHC-CCHHHHHHHHHHHHCCCCCCCCC--CCCHHHHHHCCCCHHHHHHHHHHCCCCCCC----CCHHHCCHHHHHH
Q ss_conf             9985100-00010145553110132212234--330245666297737799899850676665----5301101467776
Q gi|255764513|r  231 YQYFNFP-IPEFIHLPLIKNPDKSKLSKRRN--PTSISYYSAMGYLPEALINFLALLFVHKSE----DDDELMDMQQLIH  303 (492)
Q Consensus       231 ~~al~~~-~p~f~H~pli~~~~g~klSKR~~--~~~i~~~~~~GylPeAilNyLalLGws~~~----~d~Eifsl~eli~  303 (492)
                      |+||||+ +|.|+|+|||+|.+|||||||||  ++||.+||++|||||||+|||++|||+++.    .++||||++|||+
T Consensus       241 y~Alg~~~iP~f~H~p~I~~~~gKKLSKRdg~~~~si~q~~~~GyLPEAl~Nyl~lLGW~~~~dlas~~~E~Fs~~elie  320 (513)
T TIGR00464       241 YKALGWKRIPTFAHLPLILNEDGKKLSKRDGKTATSIEQFKEQGYLPEALINYLALLGWSPPDDLASKDQEIFSLEELIE  320 (513)
T ss_pred             HHHCCCCCCCCEEEEEEEECCCCCEEECCCCHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             99708898881553535856988400120640257689998668877899999998468965233446566367799982


Q ss_pred             HHHHHHCCCCCCCCHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHCC-------------CCCCCCHHHHHHHCCCHHH
Q ss_conf             520211375544201565566435555126--9989999864442000-------------0123220688872532035
Q gi|255764513|r  304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREK--LSTTEFLSRVSQWMKE-------------KDRLTQALTLAQSRITTLS  368 (492)
Q Consensus       304 ~FdL~~I~Ks~A~FD~eKL~wlN~qyIr~~--l~~~el~~~l~~~l~~-------------~~~l~~il~likeRi~tL~  368 (492)
                      .|+|++||||||.||++||+|||++||| .  ++.+++.+.+.++++.             .+|+..++.++++|++++.
T Consensus       321 ~F~l~~~~kspA~Fd~~KL~w~N~~Ylk-~riL~~~~l~~ll~~~~~~~~~~~~~~~~~~~q~wL~~l~~l~~~~~~~l~  399 (513)
T TIGR00464       321 IFSLNRLSKSPAKFDIKKLKWLNAHYLK-ERILPDEELLELLDPHLKKKESVVKTSTLNEEQEWLKELLLLLKERLKTLK  399 (513)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHH-HHCCCHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             0681102221012444899999999998-644899899988767754068310255664057899999998656677899


Q ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCC-HHHHHHHHHHHHHHHCCCHHHHCCEEEEEE
Q ss_conf             6677556752246788854554331486679999999999840588899-888999999999995798233101267889
Q gi|255764513|r  369 ALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK-RENIETALRNVAQHREKSLKIIVKPLFLAI  447 (492)
Q Consensus       369 Di~~~~~ffF~~~~~~d~e~~~k~~~~~e~~~~iL~~~~~~L~~~~~w~-~e~Ie~~ik~i~e~~giK~k~l~~PLRiAL  447 (492)
                      |+.+.+.+||.++..++.++.++. ..-+.+..+|..+...|+.+++|+ .+++++.+++++++.++|+|++|||||+||
T Consensus       400 e~~~~~~~ff~~~~~~~~~~~~~~-~~~~~~~~~L~~~~~~L~~~~~~~d~~~~~~~~~~~~~~~~~K~k~~~~PlR~a~  478 (513)
T TIGR00464       400 ELAELIRLFFEDKKEVDEDAKKKL-EKFKNVKEVLEALKKKLQALEEWTDAEEVKSAIKQVAEELGLKGKKVFMPLRVAL  478 (513)
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             999999986034367656899889-9889899999999999724865667789999999999984789870447899998


Q ss_pred             ECCCCCCCHHHHHHHHC-HHHHHHHHHHHHHHHH
Q ss_conf             64888888999998849-5999999999999999
Q gi|255764513|r  448 TGSKYSLPLFDSIEILG-RSVVYFRLRHAIALVS  480 (492)
Q Consensus       448 TG~~~GP~L~eil~lLG-keetl~RL~~aL~~l~  480 (492)
                      ||+.+||+|..++.+|| |++++.||+.|+++|.
T Consensus       479 ~G~~~Gp~L~~~~~~ig~k~~~~~Rl~~a~~fi~  512 (513)
T TIGR00464       479 TGKGHGPDLAQSLELIGSKTESIKRLKEALQFIA  512 (513)
T ss_pred             HCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             5789896889999971581899999999999982


No 3  
>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed
Probab=100.00  E-value=0  Score=1221.86  Aligned_cols=461  Identities=46%  Similarity=0.771  Sum_probs=444.7

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCE
Q ss_conf             70563484338878501599999999999971884999970486663886799999999886589888676558876763
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPY   85 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~   85 (492)
                      +|||||||||||+|||||||||||||+|||++||+|||||||||++|+++++++.|+++|+||||+|||        |||
T Consensus         2 ~vr~RfAPSPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtD~~R~~~~~~~~i~~~l~wlgi~~de--------~p~   73 (467)
T PRK01406          2 KVRTRFAPSPTGYLHVGGARTALFNWLFARHHGGKFILRIEDTDLERSTPEAVDAILDGLKWLGLDWDE--------GPY   73 (467)
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCC--------CCE
T ss_conf             534875899998422478999999999999729969999687998878779999999999987999998--------886


Q ss_pred             ECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             23262899999999999889824514889997766887664310002366555788333001120257740788622431
Q gi|255764513|r   86 RQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQG  165 (492)
Q Consensus        86 ~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~  165 (492)
                      +||+|+++|++++++|+++|+|||||||+|||+..|+.|.+.|.+|+|||+||+++.+|+..+.++|.+||||||+|.++
T Consensus        74 ~QS~r~~~y~~~~~~L~~~g~aY~cfcs~e~l~~~r~~~~~~~~~~~Y~~~~r~l~~~~~~~~~~~g~~~viR~k~~~~~  153 (467)
T PRK01406         74 RQSERFDRYKEVAEQLLEKGKAYYCYCTPEELEAMREEQLARGEPPRYDGRCRDLTPEEVAAREAEGRPPVIRFKVPQEG  153 (467)
T ss_pred             EHHCCHHHHHHHHHHHHHCCCCEECCCCHHHHHHHHHHHHHCCCCCCCCHHHHCCCHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             17448999999999999849986447789999986999984799988885553389878876764699825998668888


Q ss_pred             EEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             14304751340213643235641000453248986788764444444311223543024788999998510000010145
Q gi|255764513|r  166 SCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP  245 (492)
Q Consensus       166 ~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~p  245 (492)
                      .+.|+|+|+|+|+|++.++|||||+||||+||||||||||||+|+|||||||+||++|||+|++||+||||++|.|||+|
T Consensus       154 ~~~~~D~i~G~i~~~~~~~~D~vi~r~dg~pty~~a~vvDD~~m~it~virg~d~~~~t~~~~~l~~~l~~~~p~~~H~p  233 (467)
T PRK01406        154 EIVWDDLVRGEIEFSNSELDDLVILRSDGTPTYNLAVVVDDHDMGITHVIRGEDHLSNTPRQILLYEALGWEVPVFAHLP  233 (467)
T ss_pred             CEEEEHHHCCCCCCCCCCCCCEEEEECCCCCEEEECCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             65764030466555755568816880699833420200576236886540375358889999999998389997167301


Q ss_pred             HHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCCCCCHHHHHHHH
Q ss_conf             55311013221223433024566629773779989985067666553011014677765202113755442015655664
Q gi|255764513|r  246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWL  325 (492)
Q Consensus       246 li~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks~A~FD~eKL~wl  325 (492)
                      ||++++|+|||||+|+++|.+||++||+|+||+||||+||||++  ++|+||++||++.||+++|+||||+||.+||+|+
T Consensus       234 li~~~~g~kLSKR~~~~~i~~~~~~GylPeAllNyLa~LGWs~~--~~Eifsl~eli~~Fdl~~isks~A~FD~~KL~~l  311 (467)
T PRK01406        234 LILGEDGKKLSKRHGATSVMQYRDMGYLPEALLNYLARLGWSHG--DQEIFSLEELIELFDLERVSKSPARFDIEKLEWL  311 (467)
T ss_pred             CEECCCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHCCCCC--CCHHCCHHHHHHHCCCCCCCCCCCCCCHHHHHHH
T ss_conf             11489998155668852199999859988999999998479998--4142058999973683668788855489999999


Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHCC-----CCCCCCHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHH
Q ss_conf             355551269989999864442000-----012322068887253203566775567522467888545543314866799
Q gi|255764513|r  326 NGRWIREKLSTTEFLSRVSQWMKE-----KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEII  400 (492)
Q Consensus       326 N~qyIr~~l~~~el~~~l~~~l~~-----~~~l~~il~likeRi~tL~Di~~~~~ffF~~~~~~d~e~~~k~~~~~e~~~  400 (492)
                      |++||+ +++.+++.+.+.++++.     .+++.++++++|+|+++++|+.+++.|||.++..++++...+  ..++...
T Consensus       312 N~~~Lr-~~~~e~l~~~l~~~l~~~~~~~~~~~~~i~~liK~ri~tL~Di~~~~~fff~~~~~~~ee~~~k--~~~~~~~  388 (467)
T PRK01406        312 NGHYIR-ELDPEELAERLKPFLEAGGIANGPALEAVVPLLKERAKTLKELADLARFFFEDPPEYDEDAAKK--LLKPEAR  388 (467)
T ss_pred             HHHHHH-HCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCHHHHHH--HCCHHHH
T ss_conf             999998-0999999999999998748998899999999997534979999999999838998879899987--4446599


Q ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCHHHHCCEEEEEEECCCCCCCHHHHHHHHCHHHHHHHHHHHHHHHH
Q ss_conf             99999999840588899888999999999995798233101267889648888889999988495999999999999999
Q gi|255764513|r  401 DILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS  480 (492)
Q Consensus       401 ~iL~~~~~~L~~~~~w~~e~Ie~~ik~i~e~~giK~k~l~~PLRiALTG~~~GP~L~eil~lLGkeetl~RL~~aL~~l~  480 (492)
                      .+|..+.+.++.. +|+.++|+++++++++++++|+|++|+|||+||||+.+||+|+++|++|||++|++||++||++|+
T Consensus       389 ~iL~~~~~~L~~~-~w~~e~i~~~ik~i~~~~~iK~k~L~~PLRiALTG~~~GP~L~~ii~LLGkdevlkRL~~AL~~L~  467 (467)
T PRK01406        389 ELLKALLEALEAL-EWTAEAIEAAIKAVAEELGLKLGKLFMPLRVALTGRTQSPPLFDSLELLGREETLARLRKALAFLG  467 (467)
T ss_pred             HHHHHHHHHHCCC-CCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHHCC
T ss_conf             9999999986239-999999999999999994998999899999999599859699999998199999999999999609


No 4  
>PRK12558 glutamyl-tRNA synthetase; Provisional
Probab=100.00  E-value=0  Score=1160.64  Aligned_cols=451  Identities=30%  Similarity=0.430  Sum_probs=420.5

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCE
Q ss_conf             70563484338878501599999999999971884999970486663886799999999886589888676558876763
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPY   85 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~   85 (492)
                      .|||||||||||+|||||+|||||||||||++||+|||||||||++|+++++++.|+++|+||||+|||         ||
T Consensus         2 ~vrtRfAPSPTG~lHiG~~rtAl~n~l~Ar~~~G~fiLRIEDtD~~R~~~~~~~~i~~~L~WlGl~wDe---------~~   72 (461)
T PRK12558          2 TVTVRFAPSPTGYIHIGNARTALFNWLFARAHGGKFILRYDDTDVERSKQEYADAIADDLRWLGLDPDR---------VE   72 (461)
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCC---------CC
T ss_conf             654874989898532789999999999999619989998776898768879999999999987999998---------74


Q ss_pred             ECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEEC---
Q ss_conf             23262899999999999889824514889997766887664310002366555788333001120257740788622---
Q gi|255764513|r   86 RQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVP---  162 (492)
Q Consensus        86 ~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p---  162 (492)
                      +||+|+++|++++++|+++|+||+||||+|||+..|+.|.+.|.||+|||+|++++.+|...+..+|..|+|||++|   
T Consensus        73 ~QS~r~~~Y~~~~~~L~~~g~aY~Cfct~eel~~~r~~~~~~~~~~~Y~~~~~~l~~~~~~~~~~~g~~p~~r~~~~~~~  152 (461)
T PRK12558         73 YQSKRFDRYAEAAEKLKAAGLLYACYETAEELERRRKIQLARRLPPVYDRAALKLTDAEKAALEAEGRKPHWRFLLPNFE  152 (461)
T ss_pred             HHHCCHHHHHHHHHHHHHCCCCEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             16439999999999999869936538888999999999996699988784202299888876662479977999835421


Q ss_pred             ------CCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             ------43114304751340213643235641000453248986788764444444311223543024788999998510
Q gi|255764513|r  163 ------NQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNF  236 (492)
Q Consensus       163 ------~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~  236 (492)
                            ..+++.|+|+|+|+|+|++.+++||||+||||+||||||||||||+|+|||||||+||++|||+|++||+||||
T Consensus       153 ~~~~~~~~~~~~~~D~v~G~i~~~~~~~~D~Vi~rsDG~ptY~lA~VVDD~~m~IthviRg~d~l~~t~~~~~l~~alg~  232 (461)
T PRK12558        153 SDPFATQRTEVHWDDLVRGPQTVDLASLSDPVLVREDGTYLYTLPSVVDDIDMGVTHIIRGDDHVTNTGVQIALFRALGA  232 (461)
T ss_pred             CCCCCCCCCCEEEEECCCCEEEECCCCCCCEEEEECCCCCEEEEEEEECCCCCCCCEEEECHHHHHHCHHHHHHHHHHCC
T ss_conf             35567767727984014630673343458828993489710345578557557885446368588615999999999579


Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCCCC
Q ss_conf             00001014555311013221223433024566629773779989985067666553011014677765202113755442
Q gi|255764513|r  237 PIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAV  316 (492)
Q Consensus       237 ~~p~f~H~pli~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks~A~  316 (492)
                      ++|.|+|+|||++++|+|||||||+++|.+||++||+||||+|||++||||+  +++||||++|||+.||+++||||||+
T Consensus       233 ~~p~~~h~pli~~~~g~klskR~g~~sv~~yr~~GylPeAl~NyLalLGWs~--~~~Ei~sl~eli~~Fdl~~i~kS~A~  310 (461)
T PRK12558        233 EPPVFGHHNLLTTASGEGLSKRTGALSVGSLREAGYEPMAVASLAVLLGTSE--NVDAAPDMAALAEHFDLASVSRSSAK  310 (461)
T ss_pred             CCCEEEECCEEECCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHCCCC--CCHHHHHHHHHHHCEECCCCCCCCCC
T ss_conf             9980897134568999816666897589999987998478999999847999--80677648877530547788888875


Q ss_pred             CHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCC
Q ss_conf             01565566435555126998999986444200001232206888725320356677556752246788854554331486
Q gi|255764513|r  317 FDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCP  396 (492)
Q Consensus       317 FD~eKL~wlN~qyIr~~l~~~el~~~l~~~l~~~~~l~~il~likeRi~tL~Di~~~~~ffF~~~~~~d~e~~~k~~~~~  396 (492)
                      ||++||+|+|++||+ +++.+++.+.+.++..+......++..++.++..+.|+.+++.+++.+.....        ...
T Consensus       311 FD~~KL~wlN~~yir-~l~~eel~~~l~~~~~~~~~~~~~l~~~~~~l~~l~d~~~~~~~~~~~~~~~~--------~~~  381 (461)
T PRK12558        311 FDPAELEALNRHLLH-EMPFEEVKPRLEALGICGAKAEPFWLAVRGNLDRLADASLWWQVVHGDLPEAP--------DLS  381 (461)
T ss_pred             CCHHHHHHHHHHHHH-HCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH--------HCC
T ss_conf             799999999999998-19999999999871777666799999997148559999989887312400101--------148


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCHHHHCCEEEEEEECCCCCCCHHHHHHHHCHHHHHHHHHHHH
Q ss_conf             67999999999984058889988899999999999579823310126788964888888999998849599999999999
Q gi|255764513|r  397 EEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI  476 (492)
Q Consensus       397 e~~~~iL~~~~~~L~~~~~w~~e~Ie~~ik~i~e~~giK~k~l~~PLRiALTG~~~GP~L~eil~lLGkeetl~RL~~aL  476 (492)
                      ++...++..+.+.+.. +.|+.++|+++++++++++|+|+|++|+|||+||||+.+||+|+++|++|||++|++||+.||
T Consensus       382 ~~~~~~l~~~~~~l~~-~~w~~e~i~~~lk~~~~~~giK~k~l~~pLRvALTG~~~GP~L~~i~~lLGkee~l~RL~~AL  460 (461)
T PRK12558        382 GEDRAFVRQAFDLLPE-EPWNGETWKAWTEAVKEATGRKGKALFMPLRLALTGRTHGPELADLLPLLGRERTLARLPGQL  460 (461)
T ss_pred             HHHHHHHHHHHHHCCC-CCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCHHHHHHHHHHHH
T ss_conf             6689999999973667-899999999999999999697989999999999959892939999999829699999999962


Q ss_pred             H
Q ss_conf             9
Q gi|255764513|r  477 A  477 (492)
Q Consensus       477 ~  477 (492)
                      +
T Consensus       461 A  461 (461)
T PRK12558        461 A  461 (461)
T ss_pred             C
T ss_conf             9


No 5  
>KOG1149 consensus
Probab=100.00  E-value=0  Score=1099.96  Aligned_cols=474  Identities=41%  Similarity=0.709  Sum_probs=433.7

Q ss_pred             CCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             77056348433887850159999999999997188499997048666388679999999988658988867655887676
Q gi|255764513|r    5 SKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGP   84 (492)
Q Consensus         5 ~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p   84 (492)
                      ..|||||||||||+||+||+|||||||||||++||+|||||||||++|.++|+.++|+++|+|+||+|||||..||++||
T Consensus        32 ~~VRvRFAPSPTGfLHlGgLRTALfNYLfArk~gGkFiLRiEDTDq~R~v~gs~e~i~~~L~w~nl~~DEgP~~gG~~GP  111 (524)
T KOG1149          32 ACVRVRFAPSPTGFLHLGGLRTALFNYLFARKKGGKFILRIEDTDQKRLIRGSEEAIYEDLKWANLDWDEGPGVGGPFGP  111 (524)
T ss_pred             CEEEEEECCCCCCCEEHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             30478635898763220138999999999873288489985156510004644778999998629996558886898885


Q ss_pred             EECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             32326289999999999988982451488999776688766431000236655578833300112025774078862243
Q gi|255764513|r   85 YRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQ  164 (492)
Q Consensus        85 ~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~  164 (492)
                      |.||+|+++|++||+.|++.|+||+||||+++|+.+|+.+...+.+|+|||+|++++.+|++..+++|.|||||||+|++
T Consensus       112 Y~QS~R~eiY~kyae~Ll~sG~AYrCFCs~~rL~~lrk~A~k~~~~p~YD~kca~ls~~ei~~~lakg~pf~iRFrl~~~  191 (524)
T KOG1149         112 YEQSERLEIYKKYAEKLLESGHAYRCFCSEERLDLLRKSALKKHEIPRYDRKCANLSDAEIKQKLAKGTPFTIRFRLPKE  191 (524)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHCCCCCCCCCCHHCCCCHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             24578999999999999865975674158889999988653147887402021335799999997469980699736877


Q ss_pred             CEEECCCCCCCCEECCCCC-CCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHH
Q ss_conf             1143047513402136432-356410004532489867887644444443112235430247889999985100000101
Q gi|255764513|r  165 GSCVFQDKVYGEMEIPWNA-VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH  243 (492)
Q Consensus       165 ~~~~~~D~i~G~~~~~~~~-~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H  243 (492)
                       ...|+|+|+|.|....++ .+||||+||||+||||||||||||+|+|||||||+||++||+||++||+||||.||+|||
T Consensus       192 -~~~f~DLvyG~v~~~~d~~~gD~VvmKSDgfPTYHfAnVVDDh~M~IsHViRGeEWlpST~KH~lLYkAfgW~pPkFaH  270 (524)
T KOG1149         192 -SPPFTDLVYGKVNHNVDSNEGDPVVMKSDGFPTYHFANVVDDHLMGISHVIRGEEWLPSTLKHILLYKAFGWQPPKFAH  270 (524)
T ss_pred             -CCCHHHHHHHHHHCCCCCCCCCCEEEECCCCCCEEEEEEECCHHCCHHHEEECCHHCCCCHHHHHHHHHHCCCCCCEEE
T ss_conf             -8870244420210255556798179814898621222122200012021130201056408899999982899985134


Q ss_pred             HHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCCCCCHHHHHH
Q ss_conf             45553110132212234330245666297737799899850676665530110146777652021137554420156556
Q gi|255764513|r  244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLD  323 (492)
Q Consensus       244 ~pli~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks~A~FD~eKL~  323 (492)
                      +|||+++||+|||||+|+++|..|+++|||||||+||+|++|||... +.|+|||+|||+.|+|++++|++|++|.+||.
T Consensus       271 lpLl~n~d~sKLSKRqgD~~vs~~~e~G~LPeallN~ial~Gwg~~~-~~~f~sl~eLieqF~i~~ltk~~a~ld~ekL~  349 (524)
T KOG1149         271 LPLLLNPDGSKLSKRQGDASVSHYREQGYLPEALLNYIALLGWGFRT-ENEFFSLEELIEQFSIERLTKSNAILDSEKLR  349 (524)
T ss_pred             EEEEECCCCCHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHCCCCCCC-CCCCCCHHHHHHHHCHHHHCCCCCCCCHHHHH
T ss_conf             23466588540002037523888987487739999999980888641-02354699999883633204665305788899


Q ss_pred             HHHHHHHHCCCCHH-----HHHHHHHHHHCC----------CCCCCCHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHH
Q ss_conf             64355551269989-----999864442000----------012322068887253203566775567522467888545
Q gi|255764513|r  324 WLNGRWIREKLSTT-----EFLSRVSQWMKE----------KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAES  388 (492)
Q Consensus       324 wlN~qyIr~~l~~~-----el~~~l~~~l~~----------~~~l~~il~likeRi~tL~Di~~~~~ffF~~~~~~d~e~  388 (492)
                      |+|++|++ +...+     ++...+.+.+++          ...+.+++.+.++++.++.|+.....|||..|..  ...
T Consensus       350 ~~Nr~~lq-r~~~n~s~l~~lv~~~q~~l~e~y~~s~~~~~~~~~k~iL~l~~~~~~~l~dl~s~~~~~f~~P~d--~qa  426 (524)
T KOG1149         350 FLNRLHLQ-RLISNESKLRELVDKLQPLLKEAYGTSSDNEAKEVLKDILLLVTGSLKRLQDLLSELSFFFTRPSD--KQA  426 (524)
T ss_pred             HHHHHHHH-HHCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHEEEECCCH--HHH
T ss_conf             98899986-531674778999999889999852776024659999999997125225798764134224636641--568


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHC-CCCCCCHHHHHHHHHHHHHHHCCCHHHHCCEEEEEEECCCCCCCHHHHHHHHCHHH
Q ss_conf             54331486679999999999840-58889988899999999999579823310126788964888888999998849599
Q gi|255764513|r  389 FKSTALCPEEIIDILKTTQEEFE-VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV  467 (492)
Q Consensus       389 ~~k~~~~~e~~~~iL~~~~~~L~-~~~~w~~e~Ie~~ik~i~e~~giK~k~l~~PLRiALTG~~~GP~L~eil~lLGkee  467 (492)
                      ..  ....+....++..+...++ ....+..+.|+.+++++++++++|.+.+|++||+||+|+..||++.++|++||+++
T Consensus       427 ~~--d~~se~~~~~ia~l~~~l~~~~~~~~~~e~n~~lk~~a~~~~~k~k~~~~~lR~aL~G~~~Gp~iaemi~~lGk~e  504 (524)
T KOG1149         427 VE--DLLSENVASLIAHLLKILNPSALELEQDEWNSSLKAFAKEHQRKLKKLMKLLRVALSGKLPGPPIAEMIELLGKKE  504 (524)
T ss_pred             HH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             99--8865768899999986552666665389999999999998387588899999999817889985989999964698


Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999988665
Q gi|255764513|r  468 VYFRLRHAIALVSSLVQN  485 (492)
Q Consensus       468 tl~RL~~aL~~l~~~~~~  485 (492)
                      |.+||+.++..+....++
T Consensus       505 ~~eRl~~~l~~~~~~l~k  522 (524)
T KOG1149         505 VEERLKELLESLWLELNK  522 (524)
T ss_pred             HHHHHHHHHHHHHHHHHC
T ss_conf             999999999999876214


No 6  
>PRK12410 glutamyl-tRNA synthetase; Provisional
Probab=100.00  E-value=0  Score=1085.02  Aligned_cols=425  Identities=32%  Similarity=0.550  Sum_probs=389.5

Q ss_pred             EEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEC
Q ss_conf             56348433887850159999999999997188499997048666388679999999988658988867655887676323
Q gi|255764513|r    8 RVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQ   87 (492)
Q Consensus         8 ~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~~Q   87 (492)
                      .+||||||||+|||||+|||||||+|||++||+|||||||||++|+++++++.|+++|+||||+|||         ||+|
T Consensus         1 ~vRFAPSPTG~lHiG~~rtAl~n~l~Ar~~~G~fiLRIEDtD~~R~~~~~~~~i~~~L~wlGl~wDe---------~~~Q   71 (433)
T PRK12410          1 MLRFAPSPTGDMHIGNLRAAIFNYIVAKQQNEDFIIRIEDTDKERNIEGKDKEILEILNLFGISWDK---------LVYQ   71 (433)
T ss_pred             CEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCC---------CEEC
T ss_conf             9066979799642789999999999998559989998787899989869999999999985999998---------8312


Q ss_pred             CCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCEE
Q ss_conf             26289999999999988982451488999776688766431000236655578833300112025774078862243114
Q gi|255764513|r   88 SERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSC  167 (492)
Q Consensus        88 S~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~~~  167 (492)
                      |+|+++|++++++|+++|+||+||||++||+..|+.+.+.|.|++|+|+||+++.+|.   ...|.++|||||+|. +++
T Consensus        72 S~R~~~Y~~~~~~L~~~g~aY~C~ct~eel~~~r~~~~~~~~~~~Y~~~c~~l~~~e~---~~~~~~~~~R~k~p~-~~~  147 (433)
T PRK12410         72 SENLKFHRQMAEKLLSEKKAFACFCSEEELEAKKEKAKKQKKPYRYDGTCENLADIEV---LKCEKPFVVRLKKPN-HTM  147 (433)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHH---HHCCCCCEEEEECCC-CCE
T ss_conf             5789999999999998099689656789999988889855999778875443898679---746998279998799-985


Q ss_pred             ECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCC-HHHHHHH
Q ss_conf             304751340213643235641000453248986788764444444311223543024788999998510000-0101455
Q gi|255764513|r  168 VFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIP-EFIHLPL  246 (492)
Q Consensus       168 ~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p-~f~H~pl  246 (492)
                      .|+|+|+|+++|++.+++||||+|+||+||||||||||||+|||||||||+||++|||+|++||+||||++| +|+|+||
T Consensus       148 ~~~D~v~G~i~~~~~~~~D~Vi~R~DG~ptY~la~VVDD~~m~IThViRGeDhl~nT~kQi~l~~aLg~~~P~~~~H~pl  227 (433)
T PRK12410        148 SFTDAIKGELSFEPDEIDSFVILRQDKTPTYNFACAVDDMLYDISFIIRGEDHVSNTPKQILIREALGYNKPITYAHLPI  227 (433)
T ss_pred             EEEECCCCEECCCCCCCCCEEEEECCCCEEEEEEEEECCCCCCCCEEECCHHHHHHHHHHHHHHHHCCCCCCCEEECCCC
T ss_conf             88634475341581105874899348983564227964887874002642859999999999999869999852532010


Q ss_pred             HHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             53110132212234330245666297737799899850676665530110146777652021137554420156556643
Q gi|255764513|r  247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLN  326 (492)
Q Consensus       247 i~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks~A~FD~eKL~wlN  326 (492)
                      |++++|+|||||+|+++|.+||++||+||||+||||+|||++   ++||||++|||+.||+++||||||+||++||.|+|
T Consensus       228 i~~~~g~kLSKR~g~~~i~~yre~GylPeAl~NyLalLG~~~---~~Eifs~~eli~~Fdl~~i~ks~A~FD~~KL~wlN  304 (433)
T PRK12410        228 ILNEEGKKMSKRDNASSVKWLLEQGFLPEAIANYLILLGNKT---PKEIFTLDEAIEWFDIENISKSPAKFDLKKLRQLN  304 (433)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHCCCC---CCCCCCHHHHHHEEEHHCCCCCCCCCCHHHHHHHH
T ss_conf             018999855666898388889767987599999999828999---73314689884455160057888848999999999


Q ss_pred             HHHHHCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             55551269989999864442000012322068887253203566775567522467888545543314866799999999
Q gi|255764513|r  327 GRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT  406 (492)
Q Consensus       327 ~qyIr~~l~~~el~~~l~~~l~~~~~l~~il~likeRi~tL~Di~~~~~ffF~~~~~~d~e~~~k~~~~~e~~~~iL~~~  406 (492)
                      ++||+ +++.+++.+.+...   ...+..++.++++|+.++.|+.+.+.+||.+. .+.+           .....+..+
T Consensus       305 ~~~l~-~l~~e~L~~~l~~~---~~~~~~~~~~~~~~~~~l~ei~~~~~~~~~~~-~~~~-----------~~~~~~~~l  368 (433)
T PRK12410        305 REHLK-MLDDERLSELLGFK---DKDLGGLAKLYTQEASTLKELKEKISAIFSPK-DFKE-----------EFKEEFNIL  368 (433)
T ss_pred             HHHHH-HCCHHHHHHHHCCC---CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CCCH-----------HHHHHHHHH
T ss_conf             99988-49999999885535---04199999999999828999999999860886-7777-----------899999999


Q ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHHHCCCHHHHCCEEEEEEECCCCCCCHHHHHHHHCHH
Q ss_conf             998405888998889999999999957982331012678896488888899999884959
Q gi|255764513|r  407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS  466 (492)
Q Consensus       407 ~~~L~~~~~w~~e~Ie~~ik~i~e~~giK~k~l~~PLRiALTG~~~GP~L~eil~lLGke  466 (492)
                      .+.+...+.+  ++++++.+++++++|+|+|++|+|||+||||+.+||+|+++|++||+.
T Consensus       369 ~~~~~~~~~~--~~~~~~~~~l~e~~g~K~k~l~~pLR~ALTG~~~GP~L~~il~LL~~~  426 (433)
T PRK12410        369 KSMIKDFQLF--ENFEDFKKELMRKSGLKGKKFFKPLRILLTGNEHGPELSDLYPYIKSF  426 (433)
T ss_pred             HHHHHCCCCC--CCHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             9998639985--789999999999969899999999999993999094999999999999


No 7  
>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=0  Score=972.89  Aligned_cols=451  Identities=41%  Similarity=0.659  Sum_probs=422.8

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEE
Q ss_conf             05634843388785015999999999999718849999704866638867999999998865898886765588767632
Q gi|255764513|r    7 VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYR   86 (492)
Q Consensus         7 v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~~   86 (492)
                      |||||||||||+|||||||||||||+|||++||+|||||||||++|+++||++.|+++|+||||+|||+        ||+
T Consensus        10 v~tRFAPsPtG~LHiG~artAl~n~~~Ar~~~G~fiLRiEDTD~~R~~~e~~~~I~~~L~WLGl~wde~--------~~~   81 (472)
T COG0008          10 VRTRFAPSPTGYLHIGHARTALLNYLYARKYGGKFILRIEDTDPERETPEAEDAILEDLEWLGLDWDEG--------PYY   81 (472)
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCC--------EEE
T ss_conf             489779599985426889999997999998399799996479988788789999999998668888976--------143


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCC-CCCCCCCCCCHHHHHHHHHCCCCCEEEEEEC--C
Q ss_conf             326289999999999988982451488999776688766431000-2366555788333001120257740788622--4
Q gi|255764513|r   87 QSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPS-RYDGHCLKLSSQEIERLSQEQKKHVVRLTVP--N  163 (492)
Q Consensus        87 QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~-~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p--~  163 (492)
                      ||+|+++|++++++|+++|+||+||||+|||+++|+.+.+.|.+| .|+|.|++|+.++.......|.++|||||+|  .
T Consensus        82 QS~r~~~Y~~~~~~Li~~G~AY~c~ct~eele~~R~~~~~~~~~P~~y~r~~~~L~~~~~~~~~~~~~~~~iR~k~~~~~  161 (472)
T COG0008          82 QSERFDIYYEYAEKLIEKGKAYVCYCTPEELEEMRELRGALGEPPPSYDRDERNLTLFEKMADLGEGGPAVVRLKIPMAH  161 (472)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCCCCCCCHHHCCCHHHHHHHCCCCCCEEEEEECCCCC
T ss_conf             64239999999999998799688668989999999988625889999992354354667776304688807999477777


Q ss_pred             CCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHH
Q ss_conf             31143047513402136432356410004532489867887644444443112235430247889999985100000101
Q gi|255764513|r  164 QGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH  243 (492)
Q Consensus       164 ~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H  243 (492)
                      .+. .|+|.|+|+|.++++..+| |+.|+||+||||||||||||+|||||||||+||++|||+|++||+||||++|.|+|
T Consensus       162 ~~~-~~~D~v~g~i~~~~~~~~d-v~~r~dg~ptY~favvvDD~~mgITHviRG~d~~~nt~~q~~l~~~lg~~~P~~~H  239 (472)
T COG0008         162 PGP-VFRDLVRGRIVFAPKHPDF-VILRYDGYPTYNFAVVVDDHLMGITHVLRGEDHLDNTPRQIWLYEALGWPPPVYAH  239 (472)
T ss_pred             CCC-CCCCCEEEEEECCCCCCCC-EEECCCCCCCCCEEEEECHHHCCCCEEEECHHHCCCCHHHHHHHHHCCCCCCCEEE
T ss_conf             898-4120423367447668756-04247777454300261032168863773444204789999999973999982797


Q ss_pred             HHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCCCCCHHHHHH
Q ss_conf             45553110132212234330245666297737799899850676665530110146777652021137554420156556
Q gi|255764513|r  244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLD  323 (492)
Q Consensus       244 ~pli~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks~A~FD~eKL~  323 (492)
                      +|+|++.+|+|||||++++++.+|+.+||+|+||.||+++|||+.+.++.|+|++++++++||++.++||++.||.+||+
T Consensus       240 ~~li~~~~g~kLSKr~~~~~~~~~~~~G~~~~al~~~~allg~~~~~~~~e~f~~e~~i~~fd~~~~~ks~a~fd~~kL~  319 (472)
T COG0008         240 LPLLLNEDGKKLSKRKGAVSIGEYRVEGWLPPALPNLLALLGRGYPPEAIEIFSLEEGIKWFDLTIVSKSPAAFDRKKLD  319 (472)
T ss_pred             EEEEECCCCCEECCCCCCCCCCHHHHCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHH
T ss_conf             51046688783047667665302555188938899999984688982069998999987551121021161013687767


Q ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHCC--------CCCCCCHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCC
Q ss_conf             64355551269989999864442000--------0123220688872532035667755675224678885455433148
Q gi|255764513|r  324 WLNGRWIREKLSTTEFLSRVSQWMKE--------KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALC  395 (492)
Q Consensus       324 wlN~qyIr~~l~~~el~~~l~~~l~~--------~~~l~~il~likeRi~tL~Di~~~~~ffF~~~~~~d~e~~~k~~~~  395 (492)
                      |+|.+||+. ++.+.+.+.+.++..+        .++..+++++.++   ++.+|.+...+||.+.     +....+.+.
T Consensus       320 ~~n~ry~~~-~p~e~~~~~~~~~~~~~~~~~~~~~e~~~~~~~l~~~---~~~~i~~~~~~~~~~~-----~~~~~~~l~  390 (472)
T COG0008         320 WLNPRYMRV-DPVEVVIENLKPHLEEEGATLPLNPEMGERVVPLTKE---TLIEIERLDFFFFEDK-----EEVRLKRLA  390 (472)
T ss_pred             HHHHHHHHH-CCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCC---HHHHHHHHHHHHHCCH-----HHHHHHHHC
T ss_conf             660788873-8999998751454543115677777887666454164---3787767789873663-----788988602


Q ss_pred             CHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCHHHHCCEEEEEEECCCCCCCHHHHHHHHCHHHHHHHHHHH
Q ss_conf             66799999999998405888998889999999999957982331012678896488888899999884959999999999
Q gi|255764513|r  396 PEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA  475 (492)
Q Consensus       396 ~e~~~~iL~~~~~~L~~~~~w~~e~Ie~~ik~i~e~~giK~k~l~~PLRiALTG~~~GP~L~eil~lLGkeetl~RL~~a  475 (492)
                      .+....++..+...+... .|+.+++..++++..+..++|++++++|+|+|+||..+||+|+++++++|++.++.||..+
T Consensus       391 ~~~~~~~l~~~~~~l~~~-~~~~~~i~~wv~~~~~~~~vk~~~~~~plr~a~tG~~~~p~l~~~~~~~g~~~q~~Rl~~~  469 (472)
T COG0008         391 NVIVAEVLEKDAEGLITS-DWTKENIIHWVKAVARLFGVKGPKLFPPLRVALTGGYVEPELADTIELLGKEVQFERLGYA  469 (472)
T ss_pred             CHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             067899999898751312-6468999999999999857877555501688860885687778877750139999989888


Q ss_pred             HH
Q ss_conf             99
Q gi|255764513|r  476 IA  477 (492)
Q Consensus       476 L~  477 (492)
                      +.
T Consensus       470 ~~  471 (472)
T COG0008         470 LA  471 (472)
T ss_pred             HH
T ss_conf             50


No 8  
>pfam00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain. Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only glutamyl and glutaminyl tRNA synthetases. In some organisms, a single glutamyl-tRNA synthetase aminoacylates both tRNA(Glu) and tRNA(Gln).
Probab=100.00  E-value=0  Score=868.43  Aligned_cols=310  Identities=46%  Similarity=0.743  Sum_probs=300.7

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCE
Q ss_conf             70563484338878501599999999999971884999970486663886799999999886589888676558876763
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPY   85 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~   85 (492)
                      +|||||||||||+||||||||||+||++||++||+|+|||||||++|++++|++.|+++|+||||+|||        +||
T Consensus         1 ~v~tRFAPSPTG~lHiG~~rtAl~n~l~Ar~~~G~fiLRIEDtD~~R~~~e~~~~I~~dL~wLGl~wDe--------~~~   72 (314)
T pfam00749         1 KVRTRFAPSPTGYLHIGHARTALFNYLFAKNYNGKFILRFDDTDPEREKPEYEESILEDLKWLGIKWDE--------KPY   72 (314)
T ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCC--------CCE
T ss_conf             924972889898644899999999999999809989999687898868768999999999995378998--------835


Q ss_pred             ECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCC--CCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             232628999999999998898245148899977668876643100--023665557883330011202577407886224
Q gi|255764513|r   86 RQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIP--SRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPN  163 (492)
Q Consensus        86 ~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~--~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~  163 (492)
                      +||+|+++|++++++|+++|+||+||||+++|++.|+.+.+.+.+  +.|+|+||+++.++.+....+|.++|||||+|.
T Consensus        73 ~QS~r~~~Y~~~~~~L~~~g~aY~C~cs~~el~~~r~~~~~~~~~~~~~y~~~~~~l~~~~~~~~~~~~~~~~~R~k~~~  152 (314)
T pfam00749        73 YQSDRFDIYYKYAEELIEKGLAYVCFCTPEELEEEREEQEALGSPERPRYDEECLRLFEEEMRKGEAEGGKATLRFKIPM  152 (314)
T ss_pred             EHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCHHHHHCCCCCCCCCEEEEECCC
T ss_conf             52020999999999999749952258999999999987763599989988322022799998615025887227885068


Q ss_pred             CCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHH
Q ss_conf             31143047513402136432356410004532489867887644444443112235430247889999985100000101
Q gi|255764513|r  164 QGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH  243 (492)
Q Consensus       164 ~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H  243 (492)
                      .+.+.|+|.|+|+|++++.+++||||.|+||+|||||||||||++|||||||||+||++|||+|++||+||||++|.|+|
T Consensus       153 ~~~~~~~D~v~G~i~~~~~~~~D~vi~R~dg~ptY~lA~vVDD~~~~IThViRG~D~l~~T~~Q~~l~~aLg~~~P~y~H  232 (314)
T pfam00749       153 ESPYVMRDLVRGRIKFEPSALHDRTGLKWDGYPTYDFAVVIDDAIMGITHVLRGEEHLDNTPKQIWIYQALGWEVPPFIH  232 (314)
T ss_pred             CCCEEEECCCCCEEEECHHHCCCCEEECCEEEEEEEEEEEECCCCCCCCEEECCCCCCCCCHHHHHHHHHCCCCCCCEEE
T ss_conf             88626765766538844453886176446054565230587255688883756601001889999999963999985698


Q ss_pred             HHHHHHHHCCCCCCCCCCCCH--HHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCCCCCHHHH
Q ss_conf             455531101322122343302--456662977377998998506766655301101467776520211375544201565
Q gi|255764513|r  244 LPLIKNPDKSKLSKRRNPTSI--SYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQK  321 (492)
Q Consensus       244 ~pli~~~~g~klSKR~~~~~i--~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks~A~FD~eK  321 (492)
                      +|||++++|+|||||+++.+|  .+||+.||+|+|++|||++|||++. +++|||++++|++.||+++|+||||+||++|
T Consensus       233 ~pli~~~~G~kLSKR~~~~~v~~~~~r~~g~~p~a~ln~L~~lG~s~~-~~~e~~~~~~l~~~F~l~~i~ks~~~fd~~k  311 (314)
T pfam00749       233 EYLRLNLDGTKLSKRKLSLSVFISQVKGWGDPPEALLNFLRRRGWTPE-GIREFFTREELIKSFDLNRVSKSLEAFDRKK  311 (314)
T ss_pred             EEEEECCCCCCCCCCCCHHCCCCCCCCCCCCCHHHHHHHHHHCCCCHH-HHHHHCCHHHHHHHCCHHHCCCCCCCCCHHH
T ss_conf             870898999853372762103526334799961999999998699912-4214448999988579723258866478877


Q ss_pred             HHH
Q ss_conf             566
Q gi|255764513|r  322 LDW  324 (492)
Q Consensus       322 L~w  324 (492)
                      |+|
T Consensus       312 L~~  314 (314)
T pfam00749       312 LDW  314 (314)
T ss_pred             CCC
T ss_conf             689


No 9  
>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed
Probab=100.00  E-value=0  Score=787.54  Aligned_cols=292  Identities=34%  Similarity=0.579  Sum_probs=269.7

Q ss_pred             CCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             87705634843388785015999999999999718849999704866638867999999998865898886765588767
Q gi|255764513|r    4 SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYG   83 (492)
Q Consensus         4 ~~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~   83 (492)
                      ++++||||||||||+|||||+||||+||++||++||+|+|||||||++|+++++++.|+++|+||||+||+        +
T Consensus         2 m~~~v~RFAPSPTG~LHlG~~rtAl~n~l~Ar~~~G~~iLRIEDtD~~R~~~~~~~~Il~~L~wlGl~wD~--------~   73 (299)
T PRK05710          2 MTPYVGRFAPSPSGPLHFGSLVSALLSYLDARAQGGRWLVRIEDIDPPREVPGAAAAILADLEWLGLHWDG--------P   73 (299)
T ss_pred             CCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCC--------C
T ss_conf             98985717969998532899999999999999829989998677897658768999999999995688887--------4


Q ss_pred             CEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             63232628999999999998898245148899977668876643100023665557883330011202577407886224
Q gi|255764513|r   84 PYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPN  163 (492)
Q Consensus        84 p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~  163 (492)
                      ||+||+|+++|++++++|+++|+||+||||++||++.+..+.  +.++.|+|+||+.+.++     ..|.++|||||+|.
T Consensus        74 ~~~QS~R~~~Y~~~~~~L~~~g~aY~C~Ctr~el~~~~~~~~--~~~~~Y~g~cr~~~~~~-----~~~~~~~~R~k~~~  146 (299)
T PRK05710         74 VRRQSERHDAYRAALDRLAAAGLVYPCFCSRKEIAAALRAAH--AGGGAYPGTCRLLAHGR-----AAGRPAAWRLRVPA  146 (299)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCEEECCCHHHHHHHHHHHH--CCCCCCCCHHHCCCCHH-----HCCCCEEEEEECCC
T ss_conf             048885899999999999976990250589999999998512--16998986122145423-----52998179998799


Q ss_pred             CCEEECCCCCCCCEECC-CCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHH
Q ss_conf             31143047513402136-43235641000453248986788764444444311223543024788999998510000010
Q gi|255764513|r  164 QGSCVFQDKVYGEMEIP-WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI  242 (492)
Q Consensus       164 ~~~~~~~D~i~G~~~~~-~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~  242 (492)
                       +.+.|+|.|+|++++. +..++||||+|+||+||||||||||||+|||||||||+||++|||+|++||+||||++|.|+
T Consensus       147 -~~~~~~D~i~G~~~~~~~~~~gDfVi~R~Dg~ptY~lAvvVDD~~~gIThViRG~Dll~sT~~Q~~L~~aLg~~~P~y~  225 (299)
T PRK05710        147 -AVYRFGDRLQGEITADPALAVGDFVLARRDGLFAYNLAVVVDDALQGVTHVVRGADLLESTPRQIYLQQLLGLPTPRYL  225 (299)
T ss_pred             -CCEEEECCCCEEEECCCCCCCCCEEEEECCCCEEEEEEEEECCCCCCCCEEEECHHHHHCCHHHHHHHHHCCCCCCCEE
T ss_conf             -7416862665058506643569879992389705778644346436888798160201148999999998199998579


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHH----HHHHHHHHCCCCCCC
Q ss_conf             14555311013221223433024566629773779989985067666553011014677----765202113755442
Q gi|255764513|r  243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL----IHHFDLHHLSKAGAV  316 (492)
Q Consensus       243 H~pli~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~el----i~~FdL~~I~Ks~A~  316 (492)
                      |+|||++++|+|||||+|+.+|.+|+..||||+|    |++|||+++. +.+.++.+|+    |+.||+++|+||||+
T Consensus       226 H~pli~~~~G~KLSKr~~a~~i~~~~~~~~L~~a----l~~Lg~~~~~-~~~~~~~~e~l~~ai~~fd~~~i~ks~ai  298 (299)
T PRK05710        226 HHPLVLNPDGAKLSKQNGAPALAELDPRPALIAA----LRFLGQAAPE-AWQDASVEELLAWAVAHWDLTAIPRSAII  298 (299)
T ss_pred             EECCEECCCCCCCCCCCCCCCHHHCCCCCHHHHH----HHHCCCCCCC-CCCCCCHHHHHHHHHHHCCHHHCCCCCCC
T ss_conf             6222278698825787998382446614499999----9984999986-45549999999999970797348888678


No 10 
>cd00808 GluRS_core Descriminating Glutamyl-tRNA synthetase (GluRS) catalytic core domain . The descriminating form of GluRS is only found in bacteria and cellular organelles. GluRS is a monomer, that attaches Glu to the appropriate tRNA.  Like other class I tRNA synthetases, GluRS aminoacylates the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=100.00  E-value=0  Score=707.39  Aligned_cols=239  Identities=63%  Similarity=1.066  Sum_probs=233.8

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCE
Q ss_conf             70563484338878501599999999999971884999970486663886799999999886589888676558876763
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPY   85 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~   85 (492)
                      +|||||||||||+||||||||||+||++||++||+|+|||||||++|+++++++.|+++|+||||+|||+|..+|+++||
T Consensus         1 ~V~tRFAPsPtG~LHiG~~rtal~n~l~Ar~~~G~f~LRieDtD~~R~~~e~~~~I~~dL~wLGl~wDe~~~~~~~~~py   80 (239)
T cd00808           1 KVRTRFAPSPTGYLHIGGARTALFNYLFAKKHGGKFILRIEDTDQERSVEEAEEAILEDLKWLGIDWDEGPDVGGPYGPY   80 (239)
T ss_pred             CCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
T ss_conf             91186088989853389999999999999981998999845689887876999999999998188877464668888780


Q ss_pred             ECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             23262899999999999889824514889997766887664310002366555788333001120257740788622431
Q gi|255764513|r   86 RQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQG  165 (492)
Q Consensus        86 ~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~  165 (492)
                      +||+|+++|++++++|+++|                                                            
T Consensus        81 ~QS~r~~~Y~~~~~~L~~~g------------------------------------------------------------  100 (239)
T cd00808          81 RQSERLDIYKKYAEQLLEEG------------------------------------------------------------  100 (239)
T ss_pred             CCCCCHHHHHHHHHHHHHCC------------------------------------------------------------
T ss_conf             42107999999999767659------------------------------------------------------------


Q ss_pred             EEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             14304751340213643235641000453248986788764444444311223543024788999998510000010145
Q gi|255764513|r  166 SCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP  245 (492)
Q Consensus       166 ~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~p  245 (492)
                                                 ||+|||||||||||++|||||||||+||++|||+|++||++|||++|.|+|+|
T Consensus       101 ---------------------------DG~PtY~fA~vvDD~~~~IThviRg~D~~~~t~~q~~l~~~Lg~~~P~f~Hlp  153 (239)
T cd00808         101 ---------------------------DGFPTYHFANVVDDHLMGITHVIRGEEHLSSTPKQILLYEALGWEPPKFAHLP  153 (239)
T ss_pred             ---------------------------CCCCCCCCCCEECCCCCCCCEEEECHHHHCCCHHHHHHHHHCCCCCCEEECCC
T ss_conf             ---------------------------98842343516426547998897152410577999999996489998032662


Q ss_pred             HHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCCCCCHHHHHHHH
Q ss_conf             55311013221223433024566629773779989985067666553011014677765202113755442015655664
Q gi|255764513|r  246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWL  325 (492)
Q Consensus       246 li~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks~A~FD~eKL~wl  325 (492)
                      ||++++|+|||||+++.+|.+||++||+|+||+|||++||||++ ++.|+|+++|+++.|||++|+||||+||++||.|+
T Consensus       154 li~~~~g~kLSKR~~~~si~~~r~~G~~Peai~n~l~~lG~s~~-~~~e~~~~~eli~~Fdl~~i~rs~a~fD~~kL~~l  232 (239)
T cd00808         154 LILNPDGKKLSKRHGDTSISDYREEGYLPEALLNYLALLGWSPP-DGEEFFTLEELIELFDLERVSKSPAIFDPEKLDWL  232 (239)
T ss_pred             CEECCCCCCCCCCCCHHCHHHHHHCCCCHHHHHHHHHHHCCCCC-CCCCCCCHHHHHHHCCHHHCCCCCCCCCHHHHHHH
T ss_conf             42689989776708721699999869987999999999759998-76443899999974495128788871589999999


Q ss_pred             HHHHHHC
Q ss_conf             3555512
Q gi|255764513|r  326 NGRWIRE  332 (492)
Q Consensus       326 N~qyIr~  332 (492)
                      |++|||+
T Consensus       233 N~~~l~~  239 (239)
T cd00808         233 NGQYIRE  239 (239)
T ss_pred             HHHHHCC
T ss_conf             9998259


No 11 
>cd00418 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain. These enzymes attach Glu or Gln, respectively, to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers.  Archaea, cellular organelles, and some bacteria lack GlnRS.  In these cases, the "non-descriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme. The descriminating form of GluRS differs from GlnRS and the non-descriminating form of GluRS in their C-terminal anti-codon binding domains.
Probab=100.00  E-value=0  Score=591.14  Aligned_cols=206  Identities=51%  Similarity=0.858  Sum_probs=199.7

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCE
Q ss_conf             70563484338878501599999999999971884999970486663886799999999886589888676558876763
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPY   85 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~   85 (492)
                      +|||||||||||+||||||||||+||+|||++||+|+|||||||++|++++|++.|+++|+|||++|||        +||
T Consensus         1 ~V~tRFAPsPtG~LHiG~ar~al~n~~~Ak~~~G~~~LRieDTD~~r~~~e~~~~I~~dL~wLGl~~d~--------~~~   72 (223)
T cd00418           1 KVRTRFAPSPTGYLHIGHARAALLNYLYAKKYGGKFILRFDDTDPEREVEEAEDSILEDLKWLGIKWDE--------GPY   72 (223)
T ss_pred             CCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCC--------CEE
T ss_conf             921870889898542899999999999999859989997236886401888999999999991899998--------685


Q ss_pred             ECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             23262899999999999889824514889997766887664310002366555788333001120257740788622431
Q gi|255764513|r   86 RQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQG  165 (492)
Q Consensus        86 ~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~  165 (492)
                      +||+|+++|++++++|+++|                                                            
T Consensus        73 ~QS~r~~~y~~~~~~Li~~G------------------------------------------------------------   92 (223)
T cd00418          73 YQSDRFDIYYEYAEKLIEEG------------------------------------------------------------   92 (223)
T ss_pred             EHHHHHHHHHHHHHHHHHCC------------------------------------------------------------
T ss_conf             38758999999999997569------------------------------------------------------------


Q ss_pred             EEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             14304751340213643235641000453248986788764444444311223543024788999998510000010145
Q gi|255764513|r  166 SCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP  245 (492)
Q Consensus       166 ~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~p  245 (492)
                                                  |+|||||||||||++|||||||||+||++|||+|++||+||||++|.|+|+|
T Consensus        93 ----------------------------~~PtY~fa~vVDD~~~gITHViRG~D~~~~t~~q~~l~~aLg~~~P~~~H~p  144 (223)
T cd00418          93 ----------------------------GYPTYDFAVVVDDHLMGITHVLRGEEHLDNTPKQIWLYEALGWEPPVFAHFG  144 (223)
T ss_pred             ----------------------------CCCCEEEEEEECCCCCCCCEEECCHHHHHCCHHHHHHHHHCCCCCCEEEEEC
T ss_conf             ----------------------------9814010258537657887565462776467999999997099997289862


Q ss_pred             HHHHHHCCCCCCCCCC----------------CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHH
Q ss_conf             5531101322122343----------------302456662977377998998506766655301101467776520211
Q gi|255764513|r  246 LIKNPDKSKLSKRRNP----------------TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHH  309 (492)
Q Consensus       246 li~~~~g~klSKR~~~----------------~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~  309 (492)
                      +|++++|+|||||+++                .+|..||+.||+||||+||+++||||.                     
T Consensus       145 ~l~~~~g~kLSKR~~~~~i~~~~~~gwdDprl~tl~~~r~~G~~peai~n~~~~lG~s~---------------------  203 (223)
T cd00418         145 RLNNEDGTKLSKRKLKKLVEEGIVEGWDDPRLPTLRGLRRRGYLPEALRNFIALLGWSK---------------------  203 (223)
T ss_pred             CEECCCCCCCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCC---------------------
T ss_conf             07658887140200021045577678878871039999986998999999999958998---------------------


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             3755442015655664355551
Q gi|255764513|r  310 LSKAGAVFDKQKLDWLNGRWIR  331 (492)
Q Consensus       310 I~Ks~A~FD~eKL~wlN~qyIr  331 (492)
                         +++.||++||.|+|+++|.
T Consensus       204 ---~~~~~~~~~l~~~nr~~i~  222 (223)
T cd00418         204 ---SDATFDWEKLEALNRKYLD  222 (223)
T ss_pred             ---CCCEECHHHHHHHHHHHCC
T ss_conf             ---7874669999999887559


No 12 
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional
Probab=100.00  E-value=0  Score=579.55  Aligned_cols=263  Identities=32%  Similarity=0.487  Sum_probs=221.1

Q ss_pred             CCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCC--CCCCHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             87705634843388785015999999999999718849999704866--6388679999999988658988867655887
Q gi|255764513|r    4 SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDS--KRSTLESENAVMQSLKWCGLNWDEGPDIGGA   81 (492)
Q Consensus         4 ~~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~--~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~   81 (492)
                      ..+|||||||||||||||||||||+|||+|||++||+|||||||||+  +|+.++|++.|+++|+|||++|||       
T Consensus        98 ~gkV~tRFaP~P~G~LHiGhar~al~N~~~Ak~~~G~~iLR~eDTdp~~~r~~~e~~~~I~~dl~WLG~~~de-------  170 (566)
T PRK04156         98 KGKVVMRFAPNPSGPLHLGHARAAILNDEYAKRYGGKFILRFEDTDPRTKRPDPEAYDMIREDLKWLGVKPDE-------  170 (566)
T ss_pred             CCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCC-------
T ss_conf             8838995286999876189999999969999980998999965888332556378999999999982999780-------


Q ss_pred             CCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH--------HHCCC
Q ss_conf             6763232628999999999998898245148899977668876643100023665557883330011--------20257
Q gi|255764513|r   82 YGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERL--------SQEQK  153 (492)
Q Consensus        82 ~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~--------~~~g~  153 (492)
                        ||+||+|+++|.++|++|+++|+||+||||+||+.+.|...    .    ...||+.+.++...+        ...| 
T Consensus       171 --~~~qSdr~~~y~~~a~~Li~~G~AY~c~c~~ee~~~~r~~~----~----~~p~R~~~~e~nl~~~~~m~~g~~~~g-  239 (566)
T PRK04156        171 --VVIQSDRLEIYYEYARKLIEMGGAYVCTCDPEEFKELKDKG----E----ACPHRDQSPEENLELWEKMLDGEYKEG-  239 (566)
T ss_pred             --CEEHHHHHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHCC----C----CCCCCCCCHHHHHHHHHHHHCCCCCCC-
T ss_conf             --16657619999999999998799277789999999998658----7----687668997888889987651456678-


Q ss_pred             CCEEEEEEC-CCCEEECCCCCCCCEECC-CCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
Q ss_conf             740788622-431143047513402136-432356410004532489867887644444443112235430247889999
Q gi|255764513|r  154 KHVVRLTVP-NQGSCVFQDKVYGEMEIP-WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLY  231 (492)
Q Consensus       154 ~~~iR~k~p-~~~~~~~~D~i~G~~~~~-~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~  231 (492)
                      .+|+|+|++ .+....+.|.|..++... +.-.+|.    -..+||||||||||||+|||||||||+||++||++|++||
T Consensus       240 ~~vlR~K~d~~~~n~~~rD~v~~Ri~~~~H~r~g~k----~~v~PtYdfa~~idD~l~gITHviRg~e~~~~t~~q~~ly  315 (566)
T PRK04156        240 EAVVRIKTDLNHPNPAVRDWVAFRIIDTPHPRTGDK----YRVWPLMNFAVAVDDHLLGVTHVLRGKDHIVNTEKQRYIY  315 (566)
T ss_pred             CEEEEEECCCCCCCCCCCCCEEEEECCCCCCCCCCC----CCCCCCCCEEEEEEHHHCCCCCEEECCCCCCCHHHHHHHH
T ss_conf             769999722678986322355678516777635775----4446442400245111047871564430113447789999


Q ss_pred             HHHHHCCCHHHHHHHHHHHHCCCCCCCCCC----------------CCHHHHHHCCCCHHHHHHHHHHCCCCCC
Q ss_conf             985100000101455531101322122343----------------3024566629773779989985067666
Q gi|255764513|r  232 QYFNFPIPEFIHLPLIKNPDKSKLSKRRNP----------------TSISYYSAMGYLPEALINFLALLFVHKS  289 (492)
Q Consensus       232 ~al~~~~p~f~H~pli~~~~g~klSKR~~~----------------~~i~~~~~~GylPeAilNyLalLGws~~  289 (492)
                      ++|||+.|+|.|..-+ +-.+..||||.=.                .+|..+|..||.||||.+|+..+|-+.+
T Consensus       316 ~~lg~~~P~~~~fgRl-n~~~~vlSKrkl~~lVe~g~v~GWDDPRlpTl~glrRRG~~peAir~f~~~iGvsk~  388 (566)
T PRK04156        316 KYFGWEYPEYIHYGRL-KIEGFVLSTSKIRKGIESGEYSGWDDPRLPTLRALRRRGILPEAIRELIIEVGLKET  388 (566)
T ss_pred             HHCCCCCCEEEEEEEE-ECCCEEEEHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHCCCCC
T ss_conf             9729877505777677-515313108899999862988888788427789998679999999999999685544


No 13 
>cd00807 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) and non-descriminating Glutamyl-tRNA synthetase (GluRS) cataytic core domain. These enzymes attach Gln or Glu, respectively, to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers. Archaea and most bacteria lack GlnRS. In these organisms, the "non-descriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme.
Probab=100.00  E-value=0  Score=575.33  Aligned_cols=219  Identities=32%  Similarity=0.445  Sum_probs=191.0

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCE
Q ss_conf             70563484338878501599999999999971884999970486663886799999999886589888676558876763
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPY   85 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~   85 (492)
                      +|||||||||||+|||||||||||||+|||++||+|+|||||||++|+++|+++.|+++|+||||+|||         ||
T Consensus         1 kV~tRFAPsPtG~lHiG~artal~n~l~Ar~~~G~~iLRiEDTD~~r~~~e~~~~I~~~L~wLGl~~De---------~~   71 (238)
T cd00807           1 KVVTRFPPEPNGYLHIGHAKAAILNFEYAKRYGGKLILRFDDTNPKKEDEEAYDSILEDLEWLGIKPDE---------IT   71 (238)
T ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCC---------CE
T ss_conf             936960889898643899999999999999829969998677898767616899999999984899993---------15


Q ss_pred             ECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             23262899999999999889824514889997766887664310002366555788333001120257740788622431
Q gi|255764513|r   86 RQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQG  165 (492)
Q Consensus        86 ~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~  165 (492)
                      +||+|+++|++++++|+++|+||.+..                                      .|.++          
T Consensus        72 ~QS~r~~~y~~~a~~Li~~G~AY~h~r--------------------------------------~g~k~----------  103 (238)
T cd00807          72 YASDYFDLYYEYAEKLIKMGKAYVHPR--------------------------------------TGDKY----------  103 (238)
T ss_pred             ECCCCHHHHHHHHHHHHHCCCCCCCCC--------------------------------------CCCCC----------
T ss_conf             636679999999999998799874544--------------------------------------69975----------


Q ss_pred             EEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             14304751340213643235641000453248986788764444444311223543024788999998510000010145
Q gi|255764513|r  166 SCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP  245 (492)
Q Consensus       166 ~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~p  245 (492)
                                            ++     +||||||||||||+|||||||||+||++|||+|++||+||||++|.|+|+|
T Consensus       104 ----------------------~v-----~PtY~fa~vVDD~~~gITHViRG~D~l~nt~~q~~l~~aLg~~~P~~~h~~  156 (238)
T cd00807         104 ----------------------CV-----YPTYDFAHPIDDSLEGITHSLRTKEFQDRREKYDWLYEYLGWRKPEQIEFG  156 (238)
T ss_pred             ----------------------EE-----CCCCCCCEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHCCCCCCCEEEEE
T ss_conf             ----------------------01-----455332216216457887688762101387999999998499998678875


Q ss_pred             HHHHHHCCCCCCCCCCCC----------------HHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHH
Q ss_conf             553110132212234330----------------2456662977377998998506766655301101467776520211
Q gi|255764513|r  246 LIKNPDKSKLSKRRNPTS----------------ISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHH  309 (492)
Q Consensus       246 li~~~~g~klSKR~~~~~----------------i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~  309 (492)
                      + ++.+|+|||||+...+                |..||++||+||||+||+++||||++. ...-++.-|.+..+.|+.
T Consensus       157 ~-l~~~~~klSKR~~~~~i~~g~v~gwdDprl~Tl~~~rr~G~~peAi~n~l~~lG~s~~d-~~~~~~~le~~nr~~ld~  234 (238)
T cd00807         157 R-LNLEYTVLSKRKLKKLVEEGEVEGWDDPRLPTLRGLRRRGITPEAIREFILEVGVSKAD-VTISWAKLEAINRKILDP  234 (238)
T ss_pred             E-ECCCCCCCCCCCHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHCCCCCC-CEECHHHHHHHHHHHHCC
T ss_conf             4-87999705461515402458636776754065999998799899999999997899788-676399999988987455


Q ss_pred             C
Q ss_conf             3
Q gi|255764513|r  310 L  310 (492)
Q Consensus       310 I  310 (492)
                      .
T Consensus       235 ~  235 (238)
T cd00807         235 T  235 (238)
T ss_pred             C
T ss_conf             8


No 14 
>TIGR00463 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    Glutamyl-tRNA synthetase (6.1.1.17 from EC) is a class Ic synthetase and shows several similarities with glutaminyl-tRNA synthetase concerning structure and catalytic properties. It is an alpha2 dimer. To date one crystal structure of a glutamyl-tRNA synthetase (Thermus thermophilus) has been solved. The molecule has the form of a bent cylinder and consists of four domains. The N-terminal half (domains 1 and 2) contains the 'Rossman fold' typical for class I synthetases and resembles the corresponding part of E. coli GlnRS, whereas the C-terminal half exhibits a GluRS-specific structure . ; GO: 0000166 nucleotide binding, 0004818 glutamate-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006424 glutamyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=485.86  Aligned_cols=289  Identities=31%  Similarity=0.513  Sum_probs=237.9

Q ss_pred             CCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCC--CCCHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             77056348433887850159999999999997188499997048666--3886799999999886589888676558876
Q gi|255764513|r    5 SKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSK--RSTLESENAVMQSLKWCGLNWDEGPDIGGAY   82 (492)
Q Consensus         5 ~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~--R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~   82 (492)
                      .+|++||||.|+|||||||||+|++|--|||+++|++||||||||+.  |..+||.+.|.+||+|||+.|||-       
T Consensus       100 G~VV~RFaPnPsGpLhiGhArAa~lN~~fa~~Y~GklIlR~dDTdP~tkr~~~Eayd~i~eDLdwLG~k~Dev-------  172 (600)
T TIGR00463       100 GEVVMRFAPNPSGPLHIGHARAAILNQYFAKKYEGKLILRFDDTDPRTKRVKPEAYDMILEDLDWLGVKGDEV-------  172 (600)
T ss_pred             CCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE-------
T ss_conf             7357731854545875233542232046685418817999755878878887246652487787528420068-------


Q ss_pred             CCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH----H----CCCC
Q ss_conf             7632326289999999999988982451488999776688766431000236655578833300112----0----2577
Q gi|255764513|r   83 GPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLS----Q----EQKK  154 (492)
Q Consensus        83 ~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~----~----~g~~  154 (492)
                        .+||.|+++|.+|+.+||+.|+||.|+|++||.-+.|..    |.    ...||+++-||....-    .    +|..
T Consensus       173 --~y~Sdr~~~yYdY~~kLIe~G~AY~C~c~~Eefre~r~~----G~----~c~~R~~sveenL~~wte~M~~G~~E~~~  242 (600)
T TIGR00463       173 --VYQSDRIEIYYDYARKLIEMGKAYVCDCSPEEFRELRNK----GV----ACACRDRSVEENLEIWTEEMLEGEEEEGK  242 (600)
T ss_pred             --EEEECCHHHHHHHHHHHHHCCCCEECCCCCHHHHHHHCC----CC----CCCCCCCCHHHHHHHHHHHHCCCCCCCCC
T ss_conf             --983053015689999998669834327984468886338----88----77778751245788999871577301660


Q ss_pred             CEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECCCC------------CHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             4078862243114304751340213643235641000453------------2489867887644444443112235430
Q gi|255764513|r  155 HVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDG------------MPTYHLANVIDDHLMKITHVARGEEWIS  222 (492)
Q Consensus       155 ~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg------------~ptY~~a~vvDD~~m~ithviRg~d~~~  222 (492)
                      -|+|.|++-              ...++++.|||++|-.-            +|||+|++.||||+.|||||+||-||+.
T Consensus       243 ~~vR~KtD~--------------~h~npaiRD~v~fR~~~~~HprtG~~Y~vYP~~dF~vai~DhllGvTH~LRgkd~~~  308 (600)
T TIGR00463       243 VVVRVKTDL--------------KHKNPAIRDWVIFRIVKTPHPRTGDKYKVYPTMDFSVAIDDHLLGVTHVLRGKDHID  308 (600)
T ss_pred             EEEEEEECC--------------CCCCCCCCCCCEEEEECCCCCCCCCCEEECCCCCCCCHHHHHCCCCHHHHHHHHHHH
T ss_conf             289987136--------------788786347613577757888868822681222665424321023203231024552


Q ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCC--------------CC-CCCC--CCHHHHHHCCCCHHHHHHHHHHCC
Q ss_conf             247889999985100000101455531101322--------------12-2343--302456662977377998998506
Q gi|255764513|r  223 SVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKL--------------SK-RRNP--TSISYYSAMGYLPEALINFLALLF  285 (492)
Q Consensus       223 ~t~~q~~l~~al~~~~p~f~H~pli~~~~g~kl--------------SK-R~~~--~~i~~~~~~GylPeAilNyLalLG  285 (492)
                      |+-+|.+||+.|||.+|+|.|...+.=.+=.+|              |- .|++  -++..+|..|+.||||-|++..+|
T Consensus       309 n~~~q~Y~Y~y~gw~~p~~~hyg~~ki~~v~~Lsts~~~~~i~~g~y~GnWDDpRLpTlRa~rRRG~~pEai~~~~~~~G  388 (600)
T TIGR00463       309 NERKQQYIYKYFGWELPEFIHYGRLKINDVRTLSTSSIKKGIVRGDYSGNWDDPRLPTLRAVRRRGIKPEAIREFMLSIG  388 (600)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEEEHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHCC
T ss_conf             12678899998322388023441155113323210345411012651246568886302332117881578999999719


Q ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHC----CCCCCCCHHHHHHHHHHH
Q ss_conf             7666553011014677765202113----755442015655664355
Q gi|255764513|r  286 VHKSEDDDELMDMQQLIHHFDLHHL----SKAGAVFDKQKLDWLNGR  328 (492)
Q Consensus       286 ws~~~~d~Eifsl~eli~~FdL~~I----~Ks~A~FD~eKL~wlN~q  328 (492)
                      -+.  ++-. +|++.|-. |+=+=|    .+-=++.||.||.=.|+.
T Consensus       389 ~~~--nd~~-~sw~~lYA-~Nk~~id~~A~Ryffi~~PvKl~~~gse  431 (600)
T TIGR00463       389 VKR--NDVK-LSWKNLYA-LNKKIIDKKARRYFFIWNPVKLEIEGSE  431 (600)
T ss_pred             CCE--EEEE-EEHHHHHH-HHHHHCCCCCCCEEEEECCEEEEEECCC
T ss_conf             961--2443-12567766-2355403246803888888899985676


No 15 
>PRK05347 glutaminyl-tRNA synthetase; Provisional
Probab=100.00  E-value=0  Score=417.84  Aligned_cols=289  Identities=26%  Similarity=0.366  Sum_probs=228.6

Q ss_pred             CCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             87705634843388785015999999999999718849999704866638867999999998865898886765588767
Q gi|255764513|r    4 SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYG   83 (492)
Q Consensus         4 ~~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~   83 (492)
                      ..+|+|||||.|+|||||||||+|++|+.||+++||+|+||+||||++...++|++.|.+|++|||+.|++        .
T Consensus        27 ~gkVvtRFpPePnG~LHiGHaka~~lN~~~a~~y~G~~~LRfDDTNP~~e~~e~~~~I~~d~~wLg~~~~~--------~   98 (556)
T PRK05347         27 HTKVHTRFPPEPNGYLHIGHAKSICLNFGLAQDYGGKCNLRFDDTNPEKEDQEYVDSIKEDVRWLGFDWGG--------E   98 (556)
T ss_pred             CCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCC--------E
T ss_conf             68399804989998761888899986699999709989998358998745489999999999874998898--------2


Q ss_pred             CEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH---HHCCC----CCE
Q ss_conf             63232628999999999998898245148899977668876643100023665557883330011---20257----740
Q gi|255764513|r   84 PYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERL---SQEQK----KHV  156 (492)
Q Consensus        84 p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~---~~~g~----~~~  156 (492)
                      .++||++++.|.++|.+||++|+||.|.|++||+.+.|......|.    +..||+.+.||...+   +.+|.    ..|
T Consensus        99 i~~~Sd~f~~~y~~a~~LI~~g~AYv~~~~~ee~~~~Rg~~~~~g~----~sp~R~~~~eenl~lf~~M~~G~~~eg~~v  174 (556)
T PRK05347         99 LRYASDYFDQLYEYAVELIKKGKAYVDDLSAEEIREYRGTLTEPGK----NSPYRDRSVEENLDLFERMRAGEFPEGSAV  174 (556)
T ss_pred             EEEEHHHHHHHHHHHHHHHHCCCCEECCCCHHHHHHHHCCCCCCCC----CCCCCCCCHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             7881342999999999998648813568999999987477766888----796556998999999999866887786289


Q ss_pred             EEEEECCCCEEECCCCCCCCEECCCCCCCCCCEEC---------CCC---CHHHHHHHHHHHHHHHHHHHHCCCCCCCHH
Q ss_conf             78862243114304751340213643235641000---------453---248986788764444444311223543024
Q gi|255764513|r  157 VRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLK---------SDG---MPTYHLANVIDDHLMKITHVARGEEWISSV  224 (492)
Q Consensus       157 iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r---------~dg---~ptY~~a~vvDD~~m~ithviRg~d~~~~t  224 (492)
                      +|+|++-              +-++..+-|+|+.|         .|.   +|||+|||.|+|+.+||||++|+-|+-.+.
T Consensus       175 lR~K~Dm--------------~~~N~~mRDpv~yRi~~~~H~rtg~k~~iyP~YDFa~~i~D~~egiTHsl~t~Ef~~~r  240 (556)
T PRK05347        175 LRAKIDM--------------ASPNINMRDPVLYRIRHAHHHRTGDKWCIYPMYDFAHCISDAIEGITHSLCTLEFEDHR  240 (556)
T ss_pred             EEEEEEC--------------CCCCCCCCCCEEEEECCCCCCCCCCCEEECCCCCCCCCHHHHHCCCCEEEECCCCCCCH
T ss_conf             9998514--------------89995412452578424688886882266124212423145653874242047410054


Q ss_pred             HHHHHHHHHHHH-CCCHHHHHHHHHHHHCCCCCCCCC--------------C--CCHHHHHHCCCCHHHHHHHHHHCCCC
Q ss_conf             788999998510-000010145553110132212234--------------3--30245666297737799899850676
Q gi|255764513|r  225 PKHILLYQYFNF-PIPEFIHLPLIKNPDKSKLSKRRN--------------P--TSISYYSAMGYLPEALINFLALLFVH  287 (492)
Q Consensus       225 ~~q~~l~~al~~-~~p~f~H~pli~~~~g~klSKR~~--------------~--~~i~~~~~~GylPeAilNyLalLGws  287 (492)
                      +.+-++.++|+. ..|...|.+- +|-.+.-||||.=              +  .+|..+|..||.|+||.+|+..+|-+
T Consensus       241 ~~Y~w~~~~l~~~~~P~~~ef~R-ln~~~tvlSKrkl~~lV~~g~v~GWDDPRlpTl~glrRRG~~peAi~~F~~~~Gvs  319 (556)
T PRK05347        241 PLYDWVLDNLPIPPHPRQYEFSR-LNLTYTVMSKRKLKQLVEEKHVDGWDDPRMPTISGLRRRGYTPESIREFCERIGVT  319 (556)
T ss_pred             HHHHHHHHHCCCCCCCEEEEEEE-EEEEEEECCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHCCC
T ss_conf             65766034027888834888634-66520222088999999759767877875056688875699989999999984854


Q ss_pred             CCCCCHHHCCHHHHHHHHHHHHCC----CCCCCCHHHHHH
Q ss_conf             665530110146777652021137----554420156556
Q gi|255764513|r  288 KSEDDDELMDMQQLIHHFDLHHLS----KAGAVFDKQKLD  323 (492)
Q Consensus       288 ~~~~d~Eifsl~eli~~FdL~~I~----Ks~A~FD~eKL~  323 (492)
                      ....   .++++- ++.|.=+.|.    +--|+.|+.|+.
T Consensus       320 k~~~---~i~~~~-l~~~~R~~ld~~a~R~~~V~~Pvkv~  355 (556)
T PRK05347        320 KQDS---VIDMSM-LESCIREDLNENAPRAMAVLDPLKVV  355 (556)
T ss_pred             CCCE---EECHHH-HHHHHHHHHHHCCCCCEEECCCEEEE
T ss_conf             4440---532999-99999998760586204751666999


No 16 
>KOG1147 consensus
Probab=100.00  E-value=3.1e-36  Score=266.39  Aligned_cols=268  Identities=26%  Similarity=0.335  Sum_probs=218.2

Q ss_pred             CCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             87705634843388785015999999999999718849999704866638867999999998865898886765588767
Q gi|255764513|r    4 SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYG   83 (492)
Q Consensus         4 ~~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~   83 (492)
                      ..+|+|||+|.|+||||||+|+.||.|+.||.+..|+.|+|+|||+++...++|++.|++||.-|||.+|-         
T Consensus       198 ~GkVv~RFPPEpSGyLHIGHAKAALLNqYfa~~~~G~LIvRFDDTNPaKE~~eFe~~IleDl~~LgIkpd~---------  268 (712)
T KOG1147         198 MGKVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYQGKLIVRFDDTNPAKENEEFEDVILEDLSLLGIKPDR---------  268 (712)
T ss_pred             CCCEEEECCCCCCCEEEHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCE---------
T ss_conf             17257856989776024116799999999998528629998269992021678999998778870857644---------


Q ss_pred             CEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHH-------HHCCCCCE
Q ss_conf             63232628999999999998898245148899977668876643100023665557883330011-------20257740
Q gi|255764513|r   84 PYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERL-------SQEQKKHV  156 (492)
Q Consensus        84 p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~-------~~~g~~~~  156 (492)
                      .-|-|..++.-..++.+|+.+|+||..-.-.|....-|.    +    +-+.+||+.+-||..+.       -+.|-+.+
T Consensus       269 ~TyTSDyF~~i~dycv~likeGKAYvDDTp~E~Mr~ER~----~----gv~Sk~R~~~vEenl~iw~EM~kGs~~Gl~~C  340 (712)
T KOG1147         269 VTYTSDYFDEIMDYCVKLIKEGKAYVDDTPTEQMRDERE----Q----GVESKCRSNSVEENLRIWEEMKKGSEKGLKCC  340 (712)
T ss_pred             EEECHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH----C----CCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             453135599999999999863743136996899998876----0----52000237887788999999864461311110


Q ss_pred             EEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECCCC------------CHHHHHHHHHHHHHHHHHHHHCCCCCCCHH
Q ss_conf             78862243114304751340213643235641000453------------248986788764444444311223543024
Q gi|255764513|r  157 VRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDG------------MPTYHLANVIDDHLMKITHVARGEEWISSV  224 (492)
Q Consensus       157 iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg------------~ptY~~a~vvDD~~m~ithviRg~d~~~~t  224 (492)
                      +|-|+.-              +-++..+.|+||.|-+-            +|||.|||.+=|.+-||||-+|--|.-.--
T Consensus       341 vRaKIdm--------------~s~NkaMRDPviYRcn~~pHhRTG~KYkvYPTYDFaCPIVDslEGVThaLRttEYhDRn  406 (712)
T KOG1147         341 VRAKIDM--------------SSPNKAMRDPVIYRCNPEPHHRTGDKYKVYPTYDFACPIVDSLEGVTHALRTTEYHDRN  406 (712)
T ss_pred             EEEEECC--------------CCCCCCCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             2466056--------------58875434872576179887767873033045442452200243245665300003541


Q ss_pred             HHHHHHHHHHHHCCCH---HHHHHHHHHHHCCCCCCCCCC----------------CCHHHHHHCCCCHHHHHHHHHHCC
Q ss_conf             7889999985100000---101455531101322122343----------------302456662977377998998506
Q gi|255764513|r  225 PKHILLYQYFNFPIPE---FIHLPLIKNPDKSKLSKRRNP----------------TSISYYSAMGYLPEALINFLALLF  285 (492)
Q Consensus       225 ~~q~~l~~al~~~~p~---f~H~pli~~~~g~klSKR~~~----------------~~i~~~~~~GylPeAilNyLalLG  285 (492)
                      +..-.+.+|||.-.|.   |+.+.+    ...=||||.--                ..|..-+..|..-||+.+|++.-|
T Consensus       407 ~Qyyw~i~al~LRkp~iwefsRlN~----~nTvLSKRKLtwfVd~GlV~GWDDPRfpTVrGv~RrGmtvEgLkqfIl~QG  482 (712)
T KOG1147         407 AQYYWFIDALGLRKPHIWEFSRLNF----VNTVLSKRKLTWFVDEGLVDGWDDPRFPTVRGVRRRGMTVEGLKQFILAQG  482 (712)
T ss_pred             HHHHHHHHHHCCCCCCEEEHHHHHH----HHHHHHHHHEEEEECCCCCCCCCCCCCCHHHHHHHCCCCHHHHHHHHHHHC
T ss_conf             6799999974678611000223224----766653310014541675367778776015778873761999999999748


Q ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             766655301101467776520211375544201565566435555
Q gi|255764513|r  286 VHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWI  330 (492)
Q Consensus       286 ws~~~~d~Eifsl~eli~~FdL~~I~Ks~A~FD~eKL~wlN~qyI  330 (492)
                      -|.+                        -...+++|+..+|++-|
T Consensus       483 ~Sk~------------------------v~~meWdkiWAfNKKvI  503 (712)
T KOG1147         483 PSKN------------------------VVTMEWDKIWAFNKKVI  503 (712)
T ss_pred             CCCC------------------------EEEEEHHHHHHHCCCCC
T ss_conf             7654------------------------26641376554134334


No 17 
>TIGR00440 glnS glutaminyl-tRNA synthetase; InterPro: IPR004514   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .   Glutaminyl-tRNA synthetase (6.1.1.18 from EC) is a class Ic synthetase and shows several similarities with glutamyl-tRNA synthetase concerning structure and catalytic properties. It is an alpha2 dimer. Glutaminyl-tRNA synthetase is a relatively rare synthetase, found in the cytosolic compartment of eukaryotes, in Escherichia coli and a number of other Gram-negative bacteria, and in Deinococcus radiodurans. In contrast, the pathway to Gln-tRNA in mitochondria, Archaea, Gram-positive bacteria, and a number of other lineages is by misacylation with Glu followed by transamidation to correct the aminoacylation to Gln.; GO: 0000166 nucleotide binding, 0004819 glutamine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006425 glutaminyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=100.00  E-value=3.4e-37  Score=272.85  Aligned_cols=298  Identities=24%  Similarity=0.347  Sum_probs=244.9

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEE
Q ss_conf             05634843388785015999999999999718849999704866638867999999998865898886765588767632
Q gi|255764513|r    7 VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYR   86 (492)
Q Consensus         7 v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~~   86 (492)
                      |+|||.|.|+|||||||+.+..+|+-+|+.++|++.||+|||++.....||+++|-.+..|||..|...        +-|
T Consensus         1 V~TRFPPEPNGYLHIGHaK~I~~NFG~Ak~y~G~C~LRFDDTNP~KE~~EY~eSIK~~V~WLGFkw~g~--------~~Y   72 (564)
T TIGR00440         1 VHTRFPPEPNGYLHIGHAKSICLNFGLAKEYKGTCNLRFDDTNPVKEDVEYVESIKRDVEWLGFKWEGK--------IRY   72 (564)
T ss_pred             CCCCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCC--------EEE
T ss_conf             977788557873001024313442032020176364421678886466017888752222225124773--------133


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCC--CCCCCCCCCCHHHHHHHHH--------CCCCCE
Q ss_conf             326289999999999988982451488999776688766431000--2366555788333001120--------257740
Q gi|255764513|r   87 QSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPS--RYDGHCLKLSSQEIERLSQ--------EQKKHV  156 (492)
Q Consensus        87 QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~--~Y~~~~r~l~~~e~~~~~~--------~g~~~~  156 (492)
                      .|+-++--..+|..||++|+||.|-||+||+..-|-.. ..|.|.  +|..+.|+.|-||......        .| +.+
T Consensus        73 sSDYFD~Ly~~A~~LI~~G~AYV~~~t~e~i~~~RG~~-~~GtPGGer~~~~yRD~siE~NL~~F~~Mr~G~f~~G-~A~  150 (564)
T TIGR00440        73 SSDYFDELYRYAVELIKKGLAYVDELTPEEIREYRGTL-TDGTPGGERKNSPYRDRSIEENLALFEKMRDGKFKEG-KAI  150 (564)
T ss_pred             CHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHCCCCC-CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCC-CEE
T ss_conf             30468899999999986796067537878986327602-4788886556787654128899999999726897876-101


Q ss_pred             EEEEECCC-CEEECCCCCCCCEECC-CCCCCCC-CEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             78862243-1143047513402136-4323564-1000453248986788764444444311223543024788999998
Q gi|255764513|r  157 VRLTVPNQ-GSCVFQDKVYGEMEIP-WNAVDMQ-VLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQY  233 (492)
Q Consensus       157 iR~k~p~~-~~~~~~D~i~G~~~~~-~~~~~D~-vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~a  233 (492)
                      +|.|.+-. ..+...|.|-=+|.+. +..-|+. .|     +|+|-|.+.+-|..-+|||-+=--|.-.|--..-++.+.
T Consensus       151 LR~K~D~~SP~~~M~d~v~YRi~~a~H~~TG~KW~I-----YP~YDFTHC~~Da~E~ITHSlCT~EF~~~R~~Y~W~~d~  225 (564)
T TIGR00440       151 LRAKIDLASPFIVMRDPVLYRIKFAEHHQTGTKWCI-----YPMYDFTHCISDALENITHSLCTLEFQDNRRLYDWVLDN  225 (564)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCCEEE-----CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             100121027736774535212003688877881067-----476330466876550123333212233112344443315


Q ss_pred             HHHC--CC---HHHHHHHHHHHHCCCCCCCCCC----------------CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             5100--00---0101455531101322122343----------------3024566629773779989985067666553
Q gi|255764513|r  234 FNFP--IP---EFIHLPLIKNPDKSKLSKRRNP----------------TSISYYSAMGYLPEALINFLALLFVHKSEDD  292 (492)
Q Consensus       234 l~~~--~p---~f~H~pli~~~~g~klSKR~~~----------------~~i~~~~~~GylPeAilNyLalLGws~~~~d  292 (492)
                      ..-.  .|   +|+-    ||-.|.=||||.=.                .+|+.+|..||.|.||..|+-+||-....+.
T Consensus       226 i~i~r~~P~Q~Ef~R----LNl~gTv~SKRKl~~LV~~~~V~GWdDPR~~T~~~lRRRG~~pa~i~~F~~~~GVT~~~~~  301 (564)
T TIGR00440       226 IHIERVRPAQYEFSR----LNLEGTVLSKRKLAKLVDDKFVEGWDDPRLPTISGLRRRGYTPASIREFIKRIGVTKQDNN  301 (564)
T ss_pred             EEEECCCCCCCCCEE----ECCCEEEHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCE
T ss_conf             256037887431101----0210100226888764133400377888503134231178875899999986375433551


Q ss_pred             HHHCCHHHHHHHHHHHHCCCCCCCCHHHHHH
Q ss_conf             0110146777652021137554420156556
Q gi|255764513|r  293 DELMDMQQLIHHFDLHHLSKAGAVFDKQKLD  323 (492)
Q Consensus       293 ~Eifsl~eli~~FdL~~I~Ks~A~FD~eKL~  323 (492)
                      -|+..++-.|...==+.--++=|+.|+.++-
T Consensus       302 i~~~~lEs~iR~~L~~~~PR~M~V~DPV~vV  332 (564)
T TIGR00440       302 IEVVRLESCIREDLNENAPRAMAVIDPVKVV  332 (564)
T ss_pred             EEEEHHHHHHHHHHHCCCCCEEEEECCEEEE
T ss_conf             6520144789865323788157887763788


No 18 
>KOG1148 consensus
Probab=100.00  E-value=1.2e-35  Score=262.32  Aligned_cols=298  Identities=23%  Similarity=0.292  Sum_probs=234.1

Q ss_pred             CCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             88770563484338878501599999999999971884999970486663886799999999886589888676558876
Q gi|255764513|r    3 SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAY   82 (492)
Q Consensus         3 ~~~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~   82 (492)
                      +..+|+|||.|.|+|+||||++...-+|+-|||.+||.+.||+|||+++...++|-++|.+..+|||.++         |
T Consensus       245 TGGkV~TRFPPEPNG~LHIGHaKAInvNFgyAk~~~G~cyLRfDDTNPEkEee~yf~sI~e~V~WLG~~P---------~  315 (764)
T KOG1148         245 TGGKVVTRFPPEPNGILHIGHAKAINVNFGYAKAHGGVCYLRFDDTNPEKEEEEYFESIKEMVAWLGFEP---------Y  315 (764)
T ss_pred             HCCEEEEECCCCCCCEEEECCHHHEEECHHHHHHHCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCC---------E
T ss_conf             3886677179898856563213430101244665097689962789820336899999999998718785---------0


Q ss_pred             CCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHH--------HCCCC
Q ss_conf             7632326289999999999988982451488999776688766431000236655578833300112--------02577
Q gi|255764513|r   83 GPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLS--------QEQKK  154 (492)
Q Consensus        83 ~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~--------~~g~~  154 (492)
                      ..-+.|..++--.+.|.+||.+|+||.|-||.||+.+.|      |.... ...||+.+-||.....        ..|+ 
T Consensus       316 kvTysSDyFdqLy~~av~LIrkG~AYVcHqt~eEik~~r------g~~~~-~spwRdRPieEsL~lF~~Mr~Gk~~eGe-  387 (764)
T KOG1148         316 KVTYSSDYFDQLYELAVELIRKGKAYVCHQTAEEIKERR------GFNER-LSPWRDRPIEESLRLFEDMRDGKYEEGE-  387 (764)
T ss_pred             EEECCHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHC------CCCCC-CCCCCCCCHHHHHHHHHHHHCCCCCCCH-
T ss_conf             441241679999999999986686467735399998623------88888-7834368677899999998657767573-


Q ss_pred             CEEEEEEC-CCCEEECCCCCCCCEECC--CCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
Q ss_conf             40788622-431143047513402136--432356410004532489867887644444443112235430247889999
Q gi|255764513|r  155 HVVRLTVP-NQGSCVFQDKVYGEMEIP--WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLY  231 (492)
Q Consensus       155 ~~iR~k~p-~~~~~~~~D~i~G~~~~~--~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~  231 (492)
                      .++|+|.. +++....-|+|.=+|.+.  +.+-+.+.|     +|||.|++.+=|.+-.|||-+--.|..+.-.-.-+|-
T Consensus       388 AtLRmK~dl~~~~p~m~DlvayRik~~pHpRtg~kwcI-----YPTYDythCl~DSlEnITHSlCT~EF~~rR~SY~WLc  462 (764)
T KOG1148         388 ATLRMKQDLESGNPQMWDLVAYRIKNVPHPRTGDKWCI-----YPTYDYTHCLVDSLENITHSLCTKEFQTRRSSYYWLC  462 (764)
T ss_pred             HHEEEEEECCCCCCCCCCCCEEEEECCCCCCCCCCEEE-----ECCCCHHHHEHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             20333100268985401210034403778878983378-----2044103102214655456777788887544399998


Q ss_pred             HHHHHCCCH---HHHHHHHHHHHCCCCCCCCCC----------------CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             985100000---101455531101322122343----------------3024566629773779989985067666553
Q gi|255764513|r  232 QYFNFPIPE---FIHLPLIKNPDKSKLSKRRNP----------------TSISYYSAMGYLPEALINFLALLFVHKSEDD  292 (492)
Q Consensus       232 ~al~~~~p~---f~H~pli~~~~g~klSKR~~~----------------~~i~~~~~~GylPeAilNyLalLGws~~~~d  292 (492)
                      +||+.-.|.   |+.+    |..+.=+|||.=.                ..+..+|..|+.|+||.||.+.||...+...
T Consensus       463 naL~iY~P~qwEYgRL----Nv~~tv~SKRKi~~Lv~~~~V~~wDDPRLfTL~alRRRG~ppeAIn~F~~~lGvT~a~~~  538 (764)
T KOG1148         463 NALEIYCPVQWEYGRL----NVTYTVVSKRKILKLVTEGYVRGWDDPRLFTLTALRRRGFPPEAINNFCASLGVTTAQTT  538 (764)
T ss_pred             HHHHCCCCHHHHHCEE----EEEEEEEEHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCEEECE
T ss_conf             6553246042211002----101355206778988641640468874101145677559987999999997382100012


Q ss_pred             HHHCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             0110146777652021137554420156556643
Q gi|255764513|r  293 DELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLN  326 (492)
Q Consensus       293 ~Eifsl~eli~~FdL~~I~Ks~A~FD~eKL~wlN  326 (492)
                      -++--++..+..+==...-+.=++.++-|.--.|
T Consensus       539 i~v~~lE~~VRd~Ln~tapR~M~VleplkVti~N  572 (764)
T KOG1148         539 IDVARLEAAVRDYLNDTAPRLMFVLEPLKVTIEN  572 (764)
T ss_pred             ECHHHHHHHHHHHHHCCCCCEEEEECCEEEEEEC
T ss_conf             2299999999998752586257750461899714


No 19 
>cd00802 class_I_aaRS_core Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain. These enzymes are mostly monomers, which aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=99.94  E-value=1.1e-27  Score=208.39  Aligned_cols=134  Identities=32%  Similarity=0.435  Sum_probs=101.6

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEE
Q ss_conf             05634843388785015999999999999718849999704866638867999999998865898886765588767632
Q gi|255764513|r    7 VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYR   86 (492)
Q Consensus         7 v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~~   86 (492)
                      +.|||+|+|||.|||||+|||++||++||.+||+|++||||||..+..+....         +..               
T Consensus         1 ~i~~~~p~ptG~lHiGh~~~~~~~~~~ar~~~~~~~~~idd~~~~~~~~a~~~---------~~~---------------   56 (142)
T cd00802           1 VITRPGPYPTGPLHIGHARTALLNDVLARYGNVLFILGIDDTGLPIEDKAEKE---------GKL---------------   56 (142)
T ss_pred             CEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHH---------CCC---------------
T ss_conf             91414889899641889999999999999819989998657992001167884---------448---------------


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCE
Q ss_conf             32628999999999998898245148899977668876643100023665557883330011202577407886224311
Q gi|255764513|r   87 QSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGS  166 (492)
Q Consensus        87 QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~~  166 (492)
                                                .+++++...+...+.                             +.        
T Consensus        57 --------------------------~~~~~~~~~~~~~~~-----------------------------~~--------   73 (142)
T cd00802          57 --------------------------PKEEVEENIEEIKED-----------------------------LK--------   73 (142)
T ss_pred             --------------------------CHHHHHHHHHHHHHH-----------------------------CE--------
T ss_conf             --------------------------899999999999986-----------------------------52--------


Q ss_pred             EECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHH------HHHHHHHCCCCCCCHHHHHHHHHHHHH--HCC
Q ss_conf             430475134021364323564100045324898678876444------444431122354302478899999851--000
Q gi|255764513|r  167 CVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHL------MKITHVARGEEWISSVPKHILLYQYFN--FPI  238 (492)
Q Consensus       167 ~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~------m~ithviRg~d~~~~t~~q~~l~~al~--~~~  238 (492)
                                                     |.|.+++|+..      +++|||+||+||+.|++.|+.++++||  +.+
T Consensus        74 -------------------------------y~~~~~~~~~~~~~~~~~~~~~~~~G~D~~~~~~~~~~~~~~l~~~~~~  122 (142)
T cd00802          74 -------------------------------YWFDSAADDLLLLGYPFYPVDLVLGGKDQIPHLELTRDLLKALGGKFPP  122 (142)
T ss_pred             -------------------------------ECCCEEECHHHHCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHCCCCCC
T ss_conf             -------------------------------6340164348754667887657886621014769999999983778899


Q ss_pred             CHHHHHHHHHHHHCCCCCCC
Q ss_conf             00101455531101322122
Q gi|255764513|r  239 PEFIHLPLIKNPDKSKLSKR  258 (492)
Q Consensus       239 p~f~H~pli~~~~g~klSKR  258 (492)
                      |.+.|+|++++++|+||||+
T Consensus       123 ~~~~~~~~l~~~~g~KmSKS  142 (142)
T cd00802         123 PEVLHHGLLLGEDGKKMSKS  142 (142)
T ss_pred             CCEEEEEEEECCCCCCCCCC
T ss_conf             86786311488699867899


No 20 
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed
Probab=99.70  E-value=1.6e-14  Score=118.88  Aligned_cols=422  Identities=17%  Similarity=0.200  Sum_probs=226.5

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHH------CCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCE
Q ss_conf             8433887850159999999999997------1884999970486663886799999999886589888676558876763
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAKR------TGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPY   85 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~~------~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~   85 (492)
                      .=||+|..||||+|-.+-.++.+|.      ..-+||.=-||-|.-|-++..+.+--.-=+.+|.-.-.-|+--|.+..|
T Consensus        36 G~~pSG~~HiG~~~Ev~~~~~V~~al~~~~g~~~~~i~~~Dd~D~lRkvp~~~p~~e~~~~~lg~Pl~~iPdP~g~~~Sy  115 (513)
T PRK00750         36 GYGPSGLPHIGTFGEVARTTMVRRALRDLTGIKTRLIYFSDDMDGLRKVPDNVPNQEMLAEHLGKPLTSVPDPFGTHESY  115 (513)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCH
T ss_conf             86899886230452266699999999984599668999851776543468899984999987499664079988875769


Q ss_pred             ECCCCHHHHHHHHHHHHHCCCEEECCCCHHHH-------HHHHHHHHH-----------HHCCC-----CCCCCCCCCCH
Q ss_conf             23262899999999999889824514889997-------766887664-----------31000-----23665557883
Q gi|255764513|r   86 RQSERKNIYQPYVQNLLEKKLAFRCFCSTERL-------EEMRRAQRK-----------RNIPS-----RYDGHCLKLSS  142 (492)
Q Consensus        86 ~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel-------~~~r~~~~~-----------~~~~~-----~Y~~~~r~l~~  142 (492)
                       --+......+.++.+   |.-|. |-|..|+       +..+.....           .|...     .|.-.|.+..+
T Consensus       116 -a~h~~~~~~~~l~~~---gi~~e-~~s~te~Y~sG~f~~~i~~~l~~~~~I~~Il~~~~~~~~~~~~~P~~piC~~cGk  190 (513)
T PRK00750        116 -AEHNNARLREFLDKF---GFEYE-FISATECYKSGRFDEALLKALEKYDEIMAILLPTLGEERQATYSPFLPICPKCGK  190 (513)
T ss_pred             -HHHHHHHHHHHHHHC---CCCEE-EEEHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCC
T ss_conf             -999999999999983---98339-9767876644866999999998599999999984386667871477876188895


Q ss_pred             HHHHHHHHCCCCCEEEEEECCCCEEECCCC--CCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             330011202577407886224311430475--134021364323564100045324898678876444444431122354
Q gi|255764513|r  143 QEIERLSQEQKKHVVRLTVPNQGSCVFQDK--VYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEW  220 (492)
Q Consensus       143 ~e~~~~~~~g~~~~iR~k~p~~~~~~~~D~--i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~  220 (492)
                      -        ....|+-... +.++|.|.|.  -.|++.+...  .-..-+|-| +|.==       ...||+-=-=|.||
T Consensus       191 v--------~~t~v~~~d~-~~~~v~y~~~cG~~~~~~~~~g--~~KL~WrvD-W~mRW-------~~~~Vd~Ep~GKDh  251 (513)
T PRK00750        191 V--------LQVPVISVDA-DAGTITYDDECGHEGEVPVTGG--HVKLQWKVD-WPMRW-------AALGVDFEPAGKDH  251 (513)
T ss_pred             E--------EEEEEEEEEC-CCCEEEEECCCCCEEEECCCCC--CCCCCCCCC-CHHHH-------HHHCCCCCCCCCCC
T ss_conf             5--------2046899977-9988999849998787636688--543466256-55441-------11064303465112


Q ss_pred             CCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHH
Q ss_conf             30247889999985100000101455531101322122343-30245666297737799899850676665530110146
Q gi|255764513|r  221 ISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ  299 (492)
Q Consensus       221 ~~~t~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~  299 (492)
                      .+|...-..|-+.||++||....--++++..|+|+||..|- +++.+.-+- +.||+|+-||..   +|.. .+. ++++
T Consensus       252 ~~S~~~~~~I~~i~g~~pP~~~~YE~fLd~~G~KmSsSkGngit~~ewL~~-~~PEsl~rfm~~---~pkp-aK~-l~fd  325 (513)
T PRK00750        252 ISSYDTSSRICEILGGEPPEGFMYELFLDGKGQKISKSKGNGISIEDWLEY-APPESLARFMYA---RPKP-AKR-LYFD  325 (513)
T ss_pred             CCCHHHHHHHHHHHCCCCCCCCCEEEEECCCCCEECCCCCCCCCHHHHHHH-CCHHHHHHHHHH---CCCC-CCC-CCHH
T ss_conf             120767999999838999999872279837986630568972389999975-599999999971---8898-840-1565


Q ss_pred             ---HHHHHHHH-HHCCCCCCCCHHHHHHHH-HH-HHHHC--------CCCHHHHHHHHHHHHCCCCCCCCHHHHHHH---
Q ss_conf             ---77765202-113755442015655664-35-55512--------699899998644420000123220688872---
Q gi|255764513|r  300 ---QLIHHFDL-HHLSKAGAVFDKQKLDWL-NG-RWIRE--------KLSTTEFLSRVSQWMKEKDRLTQALTLAQS---  362 (492)
Q Consensus       300 ---eli~~FdL-~~I~Ks~A~FD~eKL~wl-N~-qyIr~--------~l~~~el~~~l~~~l~~~~~l~~il~like---  362 (492)
                         .+++.|+- .+.-     |+.+...-. |. .||..        .++..-++..+.-.  ..+.-..+|..++.   
T Consensus       326 ~ipk~~DEY~~~~~~y-----~~~e~~~~~~~~~~~i~~~~~~~~~~~i~F~~L~~L~qi~--~~d~~~~l~~~l~r~~~  398 (513)
T PRK00750        326 VIPKLVDEYDKFLRKY-----AGQEAAKRLANPVWHIHEGNPPIEPYPIPFRLLLNLVSIA--NAEDKDVLWGFIKRYAP  398 (513)
T ss_pred             HHHHHHHHHHHHHHHH-----CCCCHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHHHC--CCCCHHHHHHHHHHHCC
T ss_conf             6667789999999885-----1664113320642440147888788897899999999860--88768999999998378


Q ss_pred             C-----CCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCCC-CCCHHHHHHHHHHHHHHHCCCH
Q ss_conf             5-----320356677556752246788854554331486679999999999840588-8998889999999999957982
Q gi|255764513|r  363 R-----ITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ-IWKRENIETALRNVAQHREKSL  436 (492)
Q Consensus       363 R-----i~tL~Di~~~~~ffF~~~~~~d~e~~~k~~~~~e~~~~iL~~~~~~L~~~~-~w~~e~Ie~~ik~i~e~~giK~  436 (492)
                      .     ...+....+.+...+.+-.   .+. .+....++..+..|..+.+.|+.++ .++.|+|...+-+++++.++..
T Consensus       399 ~~~~~~~~~l~~ri~~A~~w~~~f~---~p~-~~~r~~~e~ek~aL~~L~~~L~~~~~~~~~E~Iq~~Iy~i~K~~~~~~  474 (513)
T PRK00750        399 GATPETHPRLDRLIDYAINYYRDFV---PPT-KKFRAPSEEERAALEDLLDGLESLPDDASAEEIQNLVYDVGKKHGFEP  474 (513)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHC---CHH-HCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             9986678999999999999999856---822-300389989999999999999738778998999999999988628867


Q ss_pred             -HHHCCEEEEEEECCCCCCCHHHHHHHHCHHHHHHHHHH
Q ss_conf             -33101267889648888889999988495999999999
Q gi|255764513|r  437 -KIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH  474 (492)
Q Consensus       437 -k~l~~PLRiALTG~~~GP~L~eil~lLGkeetl~RL~~  474 (492)
                       ++.|+.|--+|.|+.+||-+...+.++|+++|+++|+.
T Consensus       475 ~rd~F~~lY~vLLGq~~GPRlGsFia~~G~e~~~~Li~~  513 (513)
T PRK00750        475 LRDWFKALYEVLLGQDRGPRLGSFIALYGVDETRALIKE  513 (513)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHCHHHHHHHHHC
T ss_conf             899999999998299899866899999798999999619


No 21 
>PRK01611 argS arginyl-tRNA synthetase; Reviewed
Probab=99.45  E-value=6.3e-13  Score=108.10  Aligned_cols=134  Identities=18%  Similarity=0.207  Sum_probs=84.1

Q ss_pred             CCCCEECCCCCHHHHHH---HHHHHHHHHHHHH--HCCCCCCCHHHHHHHHHHHHHHCCCHH---HHH--HHHHHHHCCC
Q ss_conf             56410004532489867---8876444444431--122354302478899999851000001---014--5553110132
Q gi|255764513|r  185 DMQVLLKSDGMPTYHLA---NVIDDHLMKITHV--ARGEEWISSVPKHILLYQYFNFPIPEF---IHL--PLIKNPDKSK  254 (492)
Q Consensus       185 ~D~vi~r~dg~ptY~~a---~vvDD~~m~ithv--iRg~d~~~~t~~q~~l~~al~~~~p~f---~H~--pli~~~~g~k  254 (492)
                      -|.||+||||++||...   ...+=+..+...+  |=|.||-.--.+=..+.++|||....+   .|.  .|+.+.+|+|
T Consensus       298 ~~~vl~ksDGt~~Y~t~DiAy~~~K~~~~~d~~I~V~g~dq~~hf~~l~~~l~~lG~~~~~~~~l~h~~~~lv~~~~~~k  377 (570)
T PRK01611        298 KDRVLQKSDGTYTYFTTDIAYHLYKFERGFDRVIYVVGADHHGHFKRLKAALKALGYDPEKLEVLLHQMVGLVRGGEGVK  377 (570)
T ss_pred             CCEEEEECCCCCEECHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEEEEECCCCCC
T ss_conf             78489915996000146899999998517883899945758889999999999869996334479999987543686764


Q ss_pred             CCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHH-----HHHHHHHHHHCCCCCCCCHHHHHHHHHH
Q ss_conf             2122343-30245666297737799899850676665530110146-----7776520211375544201565566435
Q gi|255764513|r  255 LSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ-----QLIHHFDLHHLSKAGAVFDKQKLDWLNG  327 (492)
Q Consensus       255 lSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~-----eli~~FdL~~I~Ks~A~FD~eKL~wlN~  327 (492)
                      ||+|.|. +++.++.++     |.---...+-++    ++|+-.+.     ..+..|+|+.=..++-.||+++..-+++
T Consensus       378 MStR~G~~v~L~dllde-----a~~~a~~~~~~~----~e~~~~ia~~Vg~~Airy~~L~~~~~~~~~Fd~d~~l~~~g  447 (570)
T PRK01611        378 MSTRAGNVVTLDDLLDE-----AVERARELVEES----EEEKEEIAKAVGIDAVRYFDLSRSRDSDYDFDLDLALSFEG  447 (570)
T ss_pred             CCCCCCCEEEHHHHHHH-----HHHHHHHHHHCC----HHHHHHHHHHHCHHHHHHHHHCCCCCCCCEECHHHHHHHCC
T ss_conf             42467874589999999-----999999876337----76788999763410402644406888882226899863238


No 22 
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis]
Probab=99.38  E-value=4.8e-11  Score=95.29  Aligned_cols=430  Identities=19%  Similarity=0.254  Sum_probs=219.9

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHH-----HCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             705634843388785015999999999999-----718849999704866638867999999998865898886765588
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAK-----RTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGG   80 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~-----~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g   80 (492)
                      ++++-=.=||+|..||||.|--+-....+|     -..-.||-=-||-|.-|-++..+..--.-=+.+|.-..+-|+--|
T Consensus        20 ~~~v~tGisPSG~~HIGn~rEv~t~d~V~ralr~~g~~~r~I~~~DD~D~lRkvp~~lp~~~~~e~Ylg~Plt~IPdP~G   99 (521)
T COG1384          20 EYVVATGISPSGLIHIGNFREVLTADAVRRALRDRGDEVRLIYISDDYDPLRKVPRNLPDPEELEQYLGMPLTEIPDPFG   99 (521)
T ss_pred             CEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCC
T ss_conf             68983476898873214289898999999999974886579998148751012799999868999870996434899766


Q ss_pred             CCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHH-------HHHHHH------HHH-----HHCC-----CCCCCCC
Q ss_conf             7676323262899999999999889824514889997-------766887------664-----3100-----0236655
Q gi|255764513|r   81 AYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERL-------EEMRRA------QRK-----RNIP-----SRYDGHC  137 (492)
Q Consensus        81 ~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel-------~~~r~~------~~~-----~~~~-----~~Y~~~~  137 (492)
                      .++.|-  +++.  +...+.|-.-|.-| -|-|..|+       +..|..      ..+     .+.+     ..|.-.|
T Consensus       100 ~~~Sya--~hf~--~~f~~~l~~~Gi~~-E~~s~se~Yk~G~~~~~i~~ale~rdeI~~il~~~~~~~~~e~~~P~~piC  174 (521)
T COG1384         100 CCDSYA--EHFL--RPFEEFLDEFGIEV-EFVSATELYKSGLYDEAIRIALERRDEIMEILNEYRGRELEEDWSPFMPIC  174 (521)
T ss_pred             CCCHHH--HHHH--HHHHHHHHHCCCCE-EEEEHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEECCCCC
T ss_conf             533599--9999--99999998649864-998767756445589999999865799999999851876667723022256


Q ss_pred             CCCCH-HHHHHHHHCCCCCEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             57883-33001120257740788622431143047513402136432356410004532489867887644444443112
Q gi|255764513|r  138 LKLSS-QEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVAR  216 (492)
Q Consensus       138 r~l~~-~e~~~~~~~g~~~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviR  216 (492)
                      -+..+ ......--++. ..|+++-+. |.-.+-|.-.|+.+..+..  |        +|+==       ...||+-=-=
T Consensus       175 ~kcGri~~t~v~~~d~~-~~v~Y~Ce~-Gh~g~v~ir~g~~KL~WRv--d--------Wp~RW-------~~lgVd~EPf  235 (521)
T COG1384         175 EKCGRILTTPVIEWDGE-GTVEYRCEC-GHEGEVDIRGGEGKLPWRV--D--------WPMRW-------AALGVDFEPF  235 (521)
T ss_pred             CCCCCCCEEEEEEECCC-CEEEEEECC-CCCCEEECCCCCCCCCCCC--C--------CCCHH-------HCCCCCCCCC
T ss_conf             55587030688996378-449998668-8610462233676443576--7--------50010-------0008310357


Q ss_pred             CCCCCCH-----HHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             2354302-----47889999985100000101455531101322122343-30245666297737799899850676665
Q gi|255764513|r  217 GEEWISS-----VPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSE  290 (492)
Q Consensus       217 g~d~~~~-----t~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~  290 (492)
                      |.||.++     |.+-| +-+-||++||.=.---+|+...|+|+||-.|. +++++.-+-+  |--++.|+.... .|..
T Consensus       236 GKDH~a~ggSydtg~~I-~~ei~g~~pP~~~~YE~i~lkg~~~mSsSkG~~i~~~dwlev~--~pE~lry~~~r~-kP~r  311 (521)
T COG1384         236 GKDHAAAGGSYDTGKRI-AREIFGYEPPVPFVYEWILLKGGGKMSSSKGNVISLSDWLEVA--PPEVLRYLIART-KPNR  311 (521)
T ss_pred             CCCCCCCCCCHHHHHHH-HHHHCCCCCCCCCCEEEEEECCCCCCCCCCCCEECHHHHHHHC--CHHHEEEEEEEC-CCCC
T ss_conf             85313456763789999-9986499999777558898548866556878578599998753--984733235405-8874


Q ss_pred             CCHHHCCHH----HHHHHHH-HHHC--CCCCCCCHHHHHHHHHHHHHHC--C--------CC--------------HHHH
Q ss_conf             530110146----7776520-2113--7554420156556643555512--6--------99--------------8999
Q gi|255764513|r  291 DDDELMDMQ----QLIHHFD-LHHL--SKAGAVFDKQKLDWLNGRWIRE--K--------LS--------------TTEF  339 (492)
Q Consensus       291 ~d~Eifsl~----eli~~Fd-L~~I--~Ks~A~FD~eKL~wlN~qyIr~--~--------l~--------------~~el  339 (492)
                       ... |+++    .+++.|+ ++++  ..-.|. ..+.+.  |-.++-+  +        .+              .+++
T Consensus       312 -~~~-~d~~~~il~lvDEydr~e~~Y~~~e~~~-~~e~~~--r~yels~~~~pP~~~~~~vpFr~l~~l~qi~~~~~e~i  386 (521)
T COG1384         312 -HID-FDFDLGILKLVDEYDRLERIYFGEEDAK-EDERLK--RIYELSHPGNPPERLPYQVPFRHLAVLVQIANAEEEDI  386 (521)
T ss_pred             -CEE-CCCCCCHHHHHHHHHHHHHHHHCCCCCH-HHHHHC--CEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHH
T ss_conf             -433-1788774477899999999873232220-456650--72786348998656788998799999998707755889


Q ss_pred             HHHHH-HHHCCCCCCCCHHHHHHHCCCH----HHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             98644-4200001232206888725320----356677556752246788854554331486679999999999840588
Q gi|255764513|r  340 LSRVS-QWMKEKDRLTQALTLAQSRITT----LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ  414 (492)
Q Consensus       340 ~~~l~-~~l~~~~~l~~il~likeRi~t----L~Di~~~~~ffF~~~~~~d~e~~~k~~~~~e~~~~iL~~~~~~L~~~~  414 (492)
                      +..+. -+..+.+  ..-.+.+++|+..    +.+.+. -++.|...    ++. ....+..+..+..|.++.+.+++.+
T Consensus       387 l~~~~~~~~~~~~--~~~~~~l~~~i~~A~~W~~~yaP-~~~kf~~~----e~~-~~~els~~~~~~~L~~~a~~les~~  458 (521)
T COG1384         387 LEILIRRYLPDAD--PDTIEDLDERIEYAINWLRDYAP-EKVKFSIL----EKP-PEAELSEDAKLEALEDLAEFLESIQ  458 (521)
T ss_pred             HHHHHHHCCCCCC--HHHHHHHHHHHHHHHHHHHHHCC-CCEEECCC----CCC-CCCHHCHHHHHHHHHHHHHHHHHCC
T ss_conf             9999970468888--33589999999999999998396-33155556----666-3101146779999999999876313


Q ss_pred             CCCHH-HHHHHHHHHHHHHCCCHHHHCCEEEEEEECCCCCCCHHHHHHHHCHHHHHHHHHHHH
Q ss_conf             89988-899999999999579823310126788964888888999998849599999999999
Q gi|255764513|r  415 IWKRE-NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI  476 (492)
Q Consensus       415 ~w~~e-~Ie~~ik~i~e~~giK~k~l~~PLRiALTG~~~GP~L~eil~lLGkeetl~RL~~aL  476 (492)
                      .+..+ .+...+-+++.+.++..+..|+.+--+|.|+..||-+...+.+||++.|++||+.++
T Consensus       459 ~~~~e~~~~~~vy~~a~~~~~~~~~~F~~~Y~vliGk~~GPRlg~Fla~lg~dfv~~rir~~~  521 (521)
T COG1384         459 KASLEVELHNEVYEVAKKKGILPRAFFQALYRVLIGKERGPRLGSFLALLGVDFVIRRIRLAL  521 (521)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCHHHHHHHHHHCC
T ss_conf             110257888999998875389879999999999808877860889999847599999998309


No 23 
>PRK12451 arginyl-tRNA synthetase; Reviewed
Probab=99.34  E-value=1.4e-11  Score=98.89  Aligned_cols=134  Identities=13%  Similarity=0.128  Sum_probs=81.1

Q ss_pred             CCCCCEECCCCCHHHHHHH---HHHHHHH-HHHHH--HCCCCCCCHHHHHHHHHHHHHHCCCH-HHHHHHH-HHHHCCCC
Q ss_conf             3564100045324898678---8764444-44431--12235430247889999985100000-1014555-31101322
Q gi|255764513|r  184 VDMQVLLKSDGMPTYHLAN---VIDDHLM-KITHV--ARGEEWISSVPKHILLYQYFNFPIPE-FIHLPLI-KNPDKSKL  255 (492)
Q Consensus       184 ~~D~vi~r~dg~ptY~~a~---vvDD~~m-~ithv--iRg~d~~~~t~~q~~l~~al~~~~p~-f~H~pli-~~~~g~kl  255 (492)
                      .+|.||+||||++||.-.-   ..+-... |...+  |=|.||----++=....++||++.+. .-|++.- +..+|+||
T Consensus       293 ~~~~vl~ksDGt~tY~t~DiA~~~~k~~~~~~d~~I~V~gadh~~~~~rv~a~l~~lg~~~~~~~~hv~~~~v~~~g~kM  372 (562)
T PRK12451        293 MPPCLIRKSDGATIYATRDLTAALYRQNTFGFDKALYVVGPEQSLHFNQFFTVLKKLGYTWVDGMEHVPFGFILKDGKKM  372 (562)
T ss_pred             CCCEEEECCCCCCEEECCHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEEECCCCCE
T ss_conf             78638991899721316647899999873099758999567476799999999997499754550689889987488630


Q ss_pred             CCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHH--------HHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             122343-302456662977377998998506766655301101467--------77652021137554420156556643
Q gi|255764513|r  256 SKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ--------LIHHFDLHHLSKAGAVFDKQKLDWLN  326 (492)
Q Consensus       256 SKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~e--------li~~FdL~~I~Ks~A~FD~eKL~wlN  326 (492)
                      |+|.|. +.+.++.++..  +.....+..-..+       +-+.++        .+.-|.|.+=..++-.||++++.-++
T Consensus       373 StR~G~~v~l~dll~e~~--~~a~~~~~~r~~~-------~~~~~~ia~~VG~~Airy~~L~~~~~~~~~FD~d~~~~~~  443 (562)
T PRK12451        373 STRKGRVILLEEVLEEAI--ELAKQNIEEKNPN-------LKQKEEVAKQVGVGAVIFHDLKNERMHNIEFSLENMLKFE  443 (562)
T ss_pred             EECCCCEEEHHHHHHHHH--HHHHHHHHHHCCC-------HHHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCHHHHHHCC
T ss_conf             205787568999999999--9999998752777-------1328999998531130134443167877767899997425


No 24 
>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS). This class I enzyme aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. MetRS, which consists of the core domain and a anti-codon binding domain functions as a monomer. However, in some species, the anti-codon binding domain is followed by an EMAP domain. In this case, MetRS functions as a homodimer. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  As a result of a deletion event, MetRS has a significantly shorter core domain insertion that IleRS, ValRS, and LeuR.  Consequently, the MetRS insertion lacks the editing function.
Probab=99.33  E-value=2.3e-11  Score=97.53  Aligned_cols=249  Identities=20%  Similarity=0.257  Sum_probs=129.1

Q ss_pred             EEECCCCCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEEECCCCC----------------CCCCHHHHHHHHHHHHHCC
Q ss_conf             56348433887850159999999999997--18849999704866----------------6388679999999988658
Q gi|255764513|r    8 RVRIAPSPTGEPHIGTAYTALFNYLIAKR--TGGKFILRIEDTDS----------------KRSTLESENAVMQSLKWCG   69 (492)
Q Consensus         8 ~~RfaPsPtG~lH~G~~rtal~n~l~a~~--~~g~f~lRieDtd~----------------~R~~~~~~~~i~~~l~wlg   69 (492)
                      +|==.|.|+|.+||||+||+++--+++|-  ..|.=+.-|-|||-                .-..+.+.+.+.++|+.||
T Consensus         4 v~~~~Ptv~g~lHiGHar~~v~~Dil~R~lr~~G~~V~~vt~~Dd~~~kIi~kA~~~g~~~~el~~~y~~~~~~~~~~L~   83 (319)
T cd00814           4 ITTALPYVNGVPHLGHLYGTVLADVFARYQRLRGYDVLFVTGTDEHGTKIEQKAEEEGVTPQELCDKYHEIFKELFKWLN   83 (319)
T ss_pred             EECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCC
T ss_conf             96899878898553306889999999999996599569968777870899999998399879999999999999999849


Q ss_pred             CCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEE-----CCCCHH---------------HHHHHHHHHH---H
Q ss_conf             9888676558876763232628999999999998898245-----148899---------------9776688766---4
Q gi|255764513|r   70 LNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFR-----CFCSTE---------------RLEEMRRAQR---K  126 (492)
Q Consensus        70 l~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~-----c~~t~e---------------el~~~r~~~~---~  126 (492)
                      |.+|-=+..       .++...+.-++.+++|+++|.||.     .||...               ++...++...   +
T Consensus        84 I~~d~~~r~-------~~~~~~~~v~~~i~~L~~~G~~y~~~~~~~y~~~~~~~~~e~~~~~~~~~~l~~~~~~~~~~~~  156 (319)
T cd00814          84 ISFDYFGRT-------TSPRHKEIVQEFFKKLYENGYIYEGEYEGLYCVSCERFLPEWREEEHYFFRLSKFQDKLLEWLE  156 (319)
T ss_pred             CCCCCCCCC-------CCHHHHHHHHHHHHHHHHCCCEEEECCEEEECCCCCCCCCEEEECCCEEEEHHHHHHHHHHHHH
T ss_conf             987867667-------8806899999999999978988884102636588764564664226378788997899999996


Q ss_pred             HHCCCCCCCCCCCCCHHHHHHHHHCCCCC--------EEEEEECCC--C-EEECCCCCCCCEECCCCCCCCCCEECCCCC
Q ss_conf             31000236655578833300112025774--------078862243--1-143047513402136432356410004532
Q gi|255764513|r  127 RNIPSRYDGHCLKLSSQEIERLSQEQKKH--------VVRLTVPNQ--G-SCVFQDKVYGEMEIPWNAVDMQVLLKSDGM  195 (492)
Q Consensus       127 ~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~--------~iR~k~p~~--~-~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~  195 (492)
                      .+......    .-...+....+.+|.+.        -|=...|.+  + -..|-|..-|-++....-..      .-|.
T Consensus       157 ~~~~~~~~----~~~~~~~~~~~~~~~~d~~isR~~~~WG~~~P~~~~~~~yvW~da~~gy~~~~~~~~~------~~~~  226 (319)
T cd00814         157 ENPDFIWP----ENARNEVLSWLKEGLKDLSITRDLFKWGIPVPLDPDKVIYVWFDALIGYISATGYYTD------EWGN  226 (319)
T ss_pred             CCCCCCCC----HHHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCCCCCCEEECCHHCCCCCCCCCCCCCC------CCCC
T ss_conf             09876468----0577888776543777200103555458988898885430021012340001466666------5687


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHH----HHHHHHCCCHHH-HHHHHHHHHCCCCCCCCC-CCCHHHHHH
Q ss_conf             48986788764444444311223543024788999----998510000010-145553110132212234-330245666
Q gi|255764513|r  196 PTYHLANVIDDHLMKITHVARGEEWISSVPKHILL----YQYFNFPIPEFI-HLPLIKNPDKSKLSKRRN-PTSISYYSA  269 (492)
Q Consensus       196 ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l----~~al~~~~p~f~-H~pli~~~~g~klSKR~~-~~~i~~~~~  269 (492)
                      +..+..     ..-...|++ |.|.   .|-|-..    ..|.|++.|.+. |... ++.+|+||||-.| .+.+.++.+
T Consensus       227 ~~~~~~-----~~~~~ih~~-G~Di---~~~H~~~~~a~~~a~~~~~~~~~~~~g~-l~~~GeKMSKSlGN~i~~~dll~  296 (319)
T cd00814         227 SWWWND-----PWPELVHFI-GKDI---VPFHAIYWPAMLLGAGLPLPTRIFAHGY-LTVEGKKMSKSRGNVVDPDDLLE  296 (319)
T ss_pred             CCCCCC-----CCCCEEEEE-CCCC---CCHHHHHHHHHHHHCCCCCCCEEEECCE-EEECCEECCCCCCCCCCHHHHHH
T ss_conf             644456-----884126784-4764---3188878999998569987868887023-99899463772997445999998


Q ss_pred             CCCCHHHHHHHHHHC
Q ss_conf             297737799899850
Q gi|255764513|r  270 MGYLPEALINFLALL  284 (492)
Q Consensus       270 ~GylPeAilNyLalL  284 (492)
                      + |-|+++.=||++.
T Consensus       297 ~-~~~d~lR~~lls~  310 (319)
T cd00814         297 R-YGADALRYYLLRE  310 (319)
T ss_pred             H-CCCHHEHHHHHCC
T ss_conf             7-7913566877616


No 25 
>cd00668 Ile_Leu_Val_MetRS_core This is the catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases. These class I enzymes are all monomers. However, in some species, MetRS functions as a homodimer, as a result of an additional C-terminal domain. These enzymes aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  Enzymes in this subfamily share an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids. MetRS has a significantly shorter insertion, which lacks the editing function.
Probab=99.30  E-value=1.4e-10  Score=92.21  Aligned_cols=260  Identities=15%  Similarity=0.051  Sum_probs=124.0

Q ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEEECCCCC--------------------------CCCCHHHHHH
Q ss_conf             63484338878501599999999999971--8849999704866--------------------------6388679999
Q gi|255764513|r    9 VRIAPSPTGEPHIGTAYTALFNYLIAKRT--GGKFILRIEDTDS--------------------------KRSTLESENA   60 (492)
Q Consensus         9 ~RfaPsPtG~lH~G~~rtal~n~l~a~~~--~g~f~lRieDtd~--------------------------~R~~~~~~~~   60 (492)
                      |==.|.|||.|||||+|++++--.+||-.  .|.=++.+--||.                          ....+.+.+.
T Consensus         5 ~~~~P~~nG~LHiGHar~~~~~Dv~~R~~r~~G~~V~~v~g~D~~G~~i~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~   84 (334)
T cd00668           5 TTPPPYVNGVLHLGHALTYTLKDIIARYKRMRGYNVLFPPGWDEHGLPIENKAEKEGGIEGKKEEFLEDPKEWVDKYIEE   84 (334)
T ss_pred             ECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             55998888861466759899999999999816995360686686568999999996871210577775399999999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCEECC--CCHHHHHHHHHHHHHCCCEEECCCCH-------HHHHHHHHHHHHHHCC-
Q ss_conf             9999886589888676558876763232--62899999999999889824514889-------9977668876643100-
Q gi|255764513|r   61 VMQSLKWCGLNWDEGPDIGGAYGPYRQS--ERKNIYQPYVQNLLEKKLAFRCFCST-------ERLEEMRRAQRKRNIP-  130 (492)
Q Consensus        61 i~~~l~wlgl~~De~~~~~g~~~p~~QS--~r~~~y~~~~~~L~~~g~aY~c~~t~-------eel~~~r~~~~~~~~~-  130 (492)
                      +.++++.||+..|-.       -+|+-+  +..+.=+...++|.++|++|.-.-.-       =++...++........ 
T Consensus        85 ~~~~~~~lgi~~D~~-------~~~~T~~~~~~~~v~~~~~~L~~~G~iy~~~~~v~~~~~~f~~~~~~~~~l~~~~~~~  157 (334)
T cd00668          85 FKEQFKRLGISFDWD-------RFYRTTDPEYYEAVQWIFLKLYEKGLIYRGERPVRLTEQWFLKLSKLKDRLLEALEKN  157 (334)
T ss_pred             HHHHHHHHCCCCCCC-------CCEECCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCEEEEEHHHHHHHHHHHHHHC
T ss_conf             999999968976878-------7611599999999999999999879989505667756547778899999999999848


Q ss_pred             CCCCCCCCCCCHHHHHHHHHC-------------CCC-CEEEEEECCCCEEECCCCCCCCEECCCCCCCCC---CEECCC
Q ss_conf             023665557883330011202-------------577-407886224311430475134021364323564---100045
Q gi|255764513|r  131 SRYDGHCLKLSSQEIERLSQE-------------QKK-HVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQ---VLLKSD  193 (492)
Q Consensus       131 ~~Y~~~~r~l~~~e~~~~~~~-------------g~~-~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~---vi~r~d  193 (492)
                      ..++..    ...+...-+..             |.+ |+|+.....  .....+  ......+.+.++-+   .+. --
T Consensus       158 ~~~p~~----~~~~~~~~l~~~~~d~~isR~~~wG~~~P~~~~~~~~--~~~~~~--~~~~~~~~~~~~~Wfds~~~-~~  228 (334)
T cd00668         158 EIWPEN----VRNRFLNWLENGLRDWCISRQRYWGIPIPAWYCEDCG--EVCPKC--GKELKRETDVLDVWFDSGIG-YL  228 (334)
T ss_pred             CCCCHH----HHHHHHHHHHCCCCCCEEEEECCCCCCCCEEECCCCC--CCCCCC--CCCCCCCCCCEEEEECCCCC-CC
T ss_conf             987789----9999998874678775257334678755613325677--556665--31136876534466417565-43


Q ss_pred             CCHHHHHHHH-HHHHHHH--HHHHHCCCCCCCH-HHHHHHHHHHHHHC-CC-HHHHHHHHHHHHCCCCCCCCCC-CCHHH
Q ss_conf             3248986788-7644444--4431122354302-47889999985100-00-0101455531101322122343-30245
Q gi|255764513|r  194 GMPTYHLANV-IDDHLMK--ITHVARGEEWISS-VPKHILLYQYFNFP-IP-EFIHLPLIKNPDKSKLSKRRNP-TSISY  266 (492)
Q Consensus       194 g~ptY~~a~v-vDD~~m~--ithviRg~d~~~~-t~~q~~l~~al~~~-~p-~f~H~pli~~~~g~klSKR~~~-~~i~~  266 (492)
                      +.|-++..+. .+...-+  +..-+=|-||+.+ ...-+....|++-. +| .+.++.+++..+|+||||+.|. +.+.+
T Consensus       229 ~~~~~~~~~~~~~~~~~~~~~di~~~G~D~~~~h~~~~~a~~~a~~~~~~~~~~~~~g~~~~~~G~KMSKS~GN~i~~~~  308 (334)
T cd00668         229 SALGYPNEEEGFEEFEYWYPADLHVIGKDIIRFHLIYWPAMLLALFGKPPPKNVLVHGLVLDEGGRKMSKSLGNVVDPLD  308 (334)
T ss_pred             CCCCCCCCCCHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCCCHHHEEECCCEECCCCCCCCCCCCCCCCHHH
T ss_conf             22678643325668761798169871561363299999999998449850877574201983899573886998889899


Q ss_pred             HHHCCCCHHHHHHHHHHCC
Q ss_conf             6662977377998998506
Q gi|255764513|r  267 YSAMGYLPEALINFLALLF  285 (492)
Q Consensus       267 ~~~~GylPeAilNyLalLG  285 (492)
                      +.++ |-++|+.-||+.-+
T Consensus       309 ~l~~-~g~D~lR~~l~~~~  326 (334)
T cd00668         309 AIEK-YGADALRYYLLSAA  326 (334)
T ss_pred             HHHH-CCCHHHHHHHHHCC
T ss_conf             9987-59489999999429


No 26 
>PRK11893 methionyl-tRNA synthetase; Reviewed
Probab=99.24  E-value=3.8e-10  Score=89.21  Aligned_cols=266  Identities=17%  Similarity=0.199  Sum_probs=136.4

Q ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEEECCCCC----------------CCCCHHHHHHHHHHHHHCCC
Q ss_conf             63484338878501599999999999971--8849999704866----------------63886799999999886589
Q gi|255764513|r    9 VRIAPSPTGEPHIGTAYTALFNYLIAKRT--GGKFILRIEDTDS----------------KRSTLESENAVMQSLKWCGL   70 (492)
Q Consensus         9 ~RfaPsPtG~lH~G~~rtal~n~l~a~~~--~g~f~lRieDtd~----------------~R~~~~~~~~i~~~l~wlgl   70 (492)
                      |==.|-|||.|||||+++.+..-.+||-.  .|.=.+=+-+||.                .-...++.+.|.++++.+||
T Consensus         6 t~p~Py~nG~lHlGHa~~~~~~Dv~~Ry~R~~G~~v~~~~GtD~hg~~i~~~A~~~g~~p~e~~~~~~~~~~~~~~~l~i   85 (512)
T PRK11893          6 TTPIYYPNGKPHIGHAYTTLAADVLARFKRLRGYDVFFLTGTDEHGQKIERKAEEAGISPQELADRNSASFKRLWEALNI   85 (512)
T ss_pred             ECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             68999889973446358799999999999955997074687177519999999985999999999999999999998099


Q ss_pred             CCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEE-----CCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             888676558876763232628999999999998898245-----148899977668876643100023665557883330
Q gi|255764513|r   71 NWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFR-----CFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEI  145 (492)
Q Consensus        71 ~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~-----c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~  145 (492)
                      .+|-=..   .    ......+.-+++..+|.++|.+|.     -||...+--.. ..... +.. ..+..|.       
T Consensus        86 ~~D~f~r---T----~~~~~~~~v~~~f~~L~~~G~iy~~~~~~~yc~~c~~~~~-~~~~~-~~~-~~~~~~~-------  148 (512)
T PRK11893         86 SYDDFIR---T----TDERHKEAVQEIFQRLLANGDIYLGKYSGWYCVRCEEFKT-ESEAR-LGE-DGCPRCP-------  148 (512)
T ss_pred             CCCCCCC---C----CCHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCC-HHHHC-CCC-CCCCCCC-------
T ss_conf             8887877---9----9879999999999999767977432444322688644457-77723-665-7886555-------


Q ss_pred             HHHHHCCCCCEEE------EEECCCCEEECCCCCCCCE-------------ECCCCCCCCCCEECCC---CCH-------
Q ss_conf             0112025774078------8622431143047513402-------------1364323564100045---324-------
Q gi|255764513|r  146 ERLSQEQKKHVVR------LTVPNQGSCVFQDKVYGEM-------------EIPWNAVDMQVLLKSD---GMP-------  196 (492)
Q Consensus       146 ~~~~~~g~~~~iR------~k~p~~~~~~~~D~i~G~~-------------~~~~~~~~D~vi~r~d---g~p-------  196 (492)
                          ..|.++.+|      ||++...+ ...+.+....             .+-.+.+.|..|-|.+   |.|       
T Consensus       149 ----~~g~~~e~~~~~~~flkl~~~~~-~l~~~~~~~~~~~~p~~~~~~~~~~l~~~l~d~~ISR~~~~WGi~vP~~~~~  223 (512)
T PRK11893        149 ----IHGKPVEWVEEESYFFRLSKYQD-KLLELYEANPDFIQPESRRNEVINFVKSGLKDLSISRTNFDWGIPVPGDPKH  223 (512)
T ss_pred             ----CCCCCCEEEECCCCEECCHHHHH-HHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCEECCCCCCCCCCCCCCCC
T ss_conf             ----57997768724761120505467-7999972498651869999999999857787661525678789988888886


Q ss_pred             ----------HHHHHH----HHHHHHH-----HHHHHHCCCCCCCHHHHHHH----HHHHHHHCCCH--HHHHHHHHHHH
Q ss_conf             ----------898678----8764444-----44431122354302478899----99985100000--10145553110
Q gi|255764513|r  197 ----------TYHLAN----VIDDHLM-----KITHVARGEEWISSVPKHIL----LYQYFNFPIPE--FIHLPLIKNPD  251 (492)
Q Consensus       197 ----------tY~~a~----vvDD~~m-----~ithviRg~d~~~~t~~q~~----l~~al~~~~p~--f~H~pli~~~~  251 (492)
                                .|--+.    .-++...     ..-|+ =|-|.+-   -|..    +..++|.+.|.  ++| ..+. .+
T Consensus       224 ~~yvWfda~~~y~s~~~~~~~~~~~~~~~~w~~~vh~-~G~Dii~---fH~~~~~a~l~~~~~~~p~~~~~h-g~l~-~~  297 (512)
T PRK11893        224 VIYVWFDALLNYLTALGYDEPDLEELFRKYWPADVHL-IGKDILR---FHAVYWPAFLMAAGLPLPKRVFAH-GFLT-ND  297 (512)
T ss_pred             CEEEHHHHHHHHHHHHCCCCCCCHHHHHHCCCCEEEE-CCCCCCC---HHHHHHHHHHHHCCCCCCCCCCCC-EEEE-EC
T ss_conf             2011253135567764588765647898448750432-3665120---138889999986699988634311-1488-75


Q ss_pred             CCCCCCCCC-CCCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHH
Q ss_conf             132212234-3302456662977377998998506766655301101467776520
Q gi|255764513|r  252 KSKLSKRRN-PTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD  306 (492)
Q Consensus       252 g~klSKR~~-~~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~Fd  306 (492)
                      |+|+||..| .+.+.++.++ |-++|+.=||+..+  +. +.+--|+.+++++..+
T Consensus       298 G~KmSKS~Gn~I~~~d~l~~-yg~D~lR~~L~~~~--p~-~~D~~Fs~~~f~~~~N  349 (512)
T PRK11893        298 GQKMSKSLGNVIDPFDLVDK-FGVDAVRYFLLREI--PF-GQDGDFSEEAFINRIN  349 (512)
T ss_pred             CCEECCCCCCCCCHHHHHHH-CCCCHHHHHHHHCC--CC-CCCCCCCHHHHHHHHH
T ss_conf             71501347875899999998-59504028776328--87-7787878999998975


No 27 
>pfam00750 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA synthetase sub-families are too dissimilar to be included. This family includes only arginyl tRNA synthetase.
Probab=99.23  E-value=1.7e-10  Score=91.66  Aligned_cols=140  Identities=15%  Similarity=0.166  Sum_probs=79.4

Q ss_pred             CCEECCCCCCC---CCCEECCCCCHHHHH---HHHHHHHH-HHHHH--HHCCCCCCCHHHHHHHHHHHHHHCCC--HHHH
Q ss_conf             40213643235---641000453248986---78876444-44443--11223543024788999998510000--0101
Q gi|255764513|r  175 GEMEIPWNAVD---MQVLLKSDGMPTYHL---ANVIDDHL-MKITH--VARGEEWISSVPKHILLYQYFNFPIP--EFIH  243 (492)
Q Consensus       175 G~~~~~~~~~~---D~vi~r~dg~ptY~~---a~vvDD~~-m~ith--viRg~d~~~~t~~q~~l~~al~~~~p--~f~H  243 (492)
                      |.+.+.....+   |.||+||||+|||..   |...+=.. -+...  -|=|.||----++=..+.++||+.+.  .+.|
T Consensus       187 GA~~~~~~~~gd~~~~vl~rsDGt~~Y~t~DiAy~~~K~~~~~~D~~I~V~g~dq~~h~~~l~~~l~~lg~~~~~~~~~h  266 (345)
T pfam00750       187 GALWLFLTEFGDDKDRVVIKSDGGALYITTDLAYAKERLEQRGFDLIIYVLGADQHGHIQRLFAAAAALGYDPESVEVLH  266 (345)
T ss_pred             CCEEEECCCCCCCCCCEEEECCCCEEECHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCEEE
T ss_conf             98799424347877744781599500024689999999872599868886474275699999999998599942361789


Q ss_pred             HH--HHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHH-----HHHHHHHHHCCCCCC
Q ss_conf             45--5531101322122343-302456662977377998998506766655301101467-----776520211375544
Q gi|255764513|r  244 LP--LIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ-----LIHHFDLHHLSKAGA  315 (492)
Q Consensus       244 ~p--li~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~e-----li~~FdL~~I~Ks~A  315 (492)
                      ++  +++.++|+|||+|.|. +++.++.++..     ---...+.-.+...++|+-.+.+     .+.-|+|+.=..++-
T Consensus       267 ~~~g~v~~~dgkkMStR~G~~v~l~dLl~ea~-----~~a~~~~~~~~~~~~~~~~~ia~~Vgi~Airy~~L~~~~~k~i  341 (345)
T pfam00750       267 IGFGVVLGKDGKRMSTRAGNVVTLDDLLDEAL-----ERAMDIKEKNRDLTADELEAVATAIGVDAARYADLSSNRDTDY  341 (345)
T ss_pred             EEEEEEECCCCCCCCCCCCCEEEHHHHHHHHH-----HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99973876899616778877578999999999-----9999999736689877899999877076765999865889898


Q ss_pred             CCHH
Q ss_conf             2015
Q gi|255764513|r  316 VFDK  319 (492)
Q Consensus       316 ~FD~  319 (492)
                      .||+
T Consensus       342 ~FDl  345 (345)
T pfam00750       342 IFDL  345 (345)
T ss_pred             CCCC
T ss_conf             3589


No 28 
>pfam09334 tRNA-synt_1g tRNA synthetases class I (M). This family includes methionyl tRNA synthetases.
Probab=99.21  E-value=2e-10  Score=91.11  Aligned_cols=93  Identities=22%  Similarity=0.286  Sum_probs=64.6

Q ss_pred             ECCCCCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEEECCCCC----------------CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             348433887850159999999999997--18849999704866----------------638867999999998865898
Q gi|255764513|r   10 RIAPSPTGEPHIGTAYTALFNYLIAKR--TGGKFILRIEDTDS----------------KRSTLESENAVMQSLKWCGLN   71 (492)
Q Consensus        10 RfaPsPtG~lH~G~~rtal~n~l~a~~--~~g~f~lRieDtd~----------------~R~~~~~~~~i~~~l~wlgl~   71 (492)
                      ==.|.|||.|||||+|+.+.--.++|-  ..|.=++-+-+||.                +-....+.+.+.++|+.||+.
T Consensus         5 ~ppP~~nG~lHiGHa~~~~~~Dvl~R~~r~~G~~V~~v~g~D~~g~~i~~ka~~~g~~~~e~~~~y~~~~~~~~~~lgi~   84 (388)
T pfam09334         5 TALPYVNGPPHIGHLYTTIPADVYARYLRLRGYDVLFVTGTDEHGTKIELAAEKEGVTPQELVDRYHEEFKELFKKFNIS   84 (388)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             78988888600224188999999999999569970713864853799999999849999999999999999999983996


Q ss_pred             CCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             88676558876763232628999999999998898245
Q gi|255764513|r   72 WDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFR  109 (492)
Q Consensus        72 ~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~  109 (492)
                      +|.-+..       -+.+..+.-++..++|.++|++|.
T Consensus        85 ~D~~~~t-------~~~~~~~~v~~~f~~L~~~G~iy~  115 (388)
T pfam09334        85 FDDFIRT-------TSERHKELVQEFFLKLYEKGDIYE  115 (388)
T ss_pred             CCCCCCC-------CCHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             7878657-------984689999999875140681553


No 29 
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase. Members of this protein family are MshC, l-cysteine:1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase, an enzyme that uses ATP to ligate a Cys residue to a mycothiol precursor molecule, in the second to last step in mycothiol biosynthesis. This enzyme shows considerable homology to Cys--tRNA ligases, and many instances are misannotated as such. Mycothiol is found in Mycobacterium tuberculosis, Corynebacterium glutamicum, Streptomyces coelicolor, and various other members of the Actinobacteria. Mycothiol is an analog to glutathione.
Probab=99.05  E-value=1.3e-08  Score=78.89  Aligned_cols=230  Identities=16%  Similarity=0.120  Sum_probs=137.8

Q ss_pred             CCCEEEECC-CCCCCCCCHHHHHHHHH-----HHHHHHHCCCEEEEEECCCCC---CC----------CCHHHHHHHHHH
Q ss_conf             877056348-43388785015999999-----999999718849999704866---63----------886799999999
Q gi|255764513|r    4 SSKVRVRIA-PSPTGEPHIGTAYTALF-----NYLIAKRTGGKFILRIEDTDS---KR----------STLESENAVMQS   64 (492)
Q Consensus         4 ~~~v~~Rfa-PsPtG~lH~G~~rtal~-----n~l~a~~~~g~f~lRieDtd~---~R----------~~~~~~~~i~~~   64 (492)
                      ..+|+.--+ |.+-.+.||||+||+++     -||-.+-+.-+++.-|-|.|-   .|          ....+.+...++
T Consensus        34 ~~~v~mYvCGpTVYd~~HiGhaR~~v~fD~l~R~L~~~G~~V~~v~NiTDiDDKii~~A~~~g~~~~ela~~y~~~f~~d  113 (411)
T TIGR03447        34 GPEAGMYVCGITPYDATHLGHAATYLTFDLVNRVWRDAGHRVHYVQNVTDVDDPLFERAERDGVDWRELGTSQIDLFRED  113 (411)
T ss_pred             CCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             98368996588478888622341689999999999983985589961465425999999882989999999999999999


Q ss_pred             HHHCCCCC-CCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEEC---------CCCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             88658988-86765588767632326289999999999988982451---------488999776688766431000236
Q gi|255764513|r   65 LKWCGLNW-DEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC---------FCSTERLEEMRRAQRKRNIPSRYD  134 (492)
Q Consensus        65 l~wlgl~~-De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c---------~~t~eel~~~r~~~~~~~~~~~Y~  134 (492)
                      ++-|++.. |.-|         +-|+.++--.+.+++|+++|.||.-         |...              .-+.|-
T Consensus       114 ~~~Lni~~p~~~p---------raTe~I~~ii~~I~~Li~kG~AY~~~~~~~gdVYFdv~--------------~~~~yG  170 (411)
T TIGR03447       114 MEALRVLPPRDYI---------GAVESIDEVIEMVEKLLAAGAAYEVEGPEYPDVYFSIE--------------ATEQFG  170 (411)
T ss_pred             HHHCCCCCCCCCC---------CCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCEEEEEC--------------CHHHHC
T ss_conf             9974999998776---------74347999999999998689679827987775798725--------------401106


Q ss_pred             CCCCCCCHHHHHHHHHCCCCCEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEEC-------------CCCCHHHHHH
Q ss_conf             655578833300112025774078862243114304751340213643235641000-------------4532489867
Q gi|255764513|r  135 GHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLK-------------SDGMPTYHLA  201 (492)
Q Consensus       135 ~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r-------------~dg~ptY~~a  201 (492)
                      .- -++..++.....+...   .+   ++       +  .+     -..-.||+|+|             ..|-|-.|..
T Consensus       171 ~L-s~~~~~~~~~~~~~~~---~~---~~-------~--~~-----Kr~p~DFaLWK~~k~gep~W~SPWG~GRPGWHIE  229 (411)
T TIGR03447       171 YE-SGYDRATMLELFAERG---GD---PD-------R--PG-----KRDPLDALLWRAAREGEPSWDSPFGPGRPGWHIE  229 (411)
T ss_pred             CC-CCCCHHHHHHHHHHCC---CC---CC-------C--CC-----CCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             52-2579999987751114---77---42-------0--02-----4673567771478888887669988868837799


Q ss_pred             HHH----------HHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHCCCCCCCCCC-CCHHHHH
Q ss_conf             887----------644444443112235430247889999985100--000101455531101322122343-3024566
Q gi|255764513|r  202 NVI----------DDHLMKITHVARGEEWISSVPKHILLYQYFNFP--IPEFIHLPLIKNPDKSKLSKRRNP-TSISYYS  268 (492)
Q Consensus       202 ~vv----------DD~~m~ithviRg~d~~~~t~~q~~l~~al~~~--~p~f~H~pli~~~~g~klSKR~~~-~~i~~~~  268 (492)
                      |++          |=|-=|+.++.-   |-.|.-.|-.-.  .|-.  .--|.|..+ +..+|+||||.-|. +.|.++.
T Consensus       230 CSaMs~~~LG~~~DIHgGG~DL~FP---HHENEiAQsea~--~g~~~~a~yWmH~g~-l~~~geKMSKSlGN~~ti~dl~  303 (411)
T TIGR03447       230 CSAIATNRLGAGFDIQGGGSDLIFP---HHEFSAAHAEAA--TGVRRMARHYVHAGM-IGLDGEKMSKSLGNLVFVSKLR  303 (411)
T ss_pred             HHHHHHHHCCCCEEEECCCCCCCCC---CCHHHHHHHHHH--HCCCHHHHHHHECCE-EEECCEECCCCCCCEEEHHHHH
T ss_conf             9999998759975787886035788---853099999986--688737667653002-3128705566688725799998


Q ss_pred             HCCCCHHHHHHHHHH
Q ss_conf             629773779989985
Q gi|255764513|r  269 AMGYLPEALINFLAL  283 (492)
Q Consensus       269 ~~GylPeAilNyLal  283 (492)
                      ++||-|+++.=||..
T Consensus       304 ~~g~~p~~iR~~lL~  318 (411)
T TIGR03447       304 AAGVDPAAIRLGLLA  318 (411)
T ss_pred             HCCCCHHHHHHHHHC
T ss_conf             649989999999971


No 30 
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated
Probab=99.01  E-value=5.5e-08  Score=74.56  Aligned_cols=225  Identities=22%  Similarity=0.250  Sum_probs=133.0

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHH-----HCCCEEEEEECCCCC---CCC----------CHHHHHHHHHHHHHCCCCC-
Q ss_conf             843388785015999999999999-----718849999704866---638----------8679999999988658988-
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAK-----RTGGKFILRIEDTDS---KRS----------TLESENAVMQSLKWCGLNW-   72 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~-----~~~g~f~lRieDtd~---~R~----------~~~~~~~i~~~l~wlgl~~-   72 (492)
                      .|.+=.+.||||+||+++--+++|     -+.-+|+.-|-|+|-   .|.          ...+.+...++++-||+.. 
T Consensus        30 GPTVYd~~HiG~~r~~v~~D~l~R~l~~~g~~v~~v~NiTDidDKii~~a~~~~~~~~~~~~~~~~~f~~d~~~L~i~~p  109 (460)
T PRK00260         30 GPTVYDYAHIGHARSFVVFDVLRRYLRYRGYKVTYVRNITDIDDKIIKRANEEGESIKELTERYIAAFHEDMDALGVLRP  109 (460)
T ss_pred             CCCCCCCCCHHCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             98488873200030899999999999964993499982375419999999981969999999999999999999489998


Q ss_pred             CCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEEC-----CCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             86765588767632326289999999999988982451-----4889997766887664310002366555788333001
Q gi|255764513|r   73 DEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC-----FCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIER  147 (492)
Q Consensus        73 De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c-----~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~  147 (492)
                      |--|         +-|+..+--.+++++|+++|.||.-     |+..              .-+.| |   .|+....+.
T Consensus       110 ~~~~---------r~t~~i~~~i~~i~~l~~~g~aY~~~~~vyFdv~--------------~~~~Y-G---~Ls~~~~~~  162 (460)
T PRK00260        110 DIEP---------RATEHIPEIIELIERLIEKGHAYEADGDVYFDVR--------------KFPDY-G---KLSGRNLDD  162 (460)
T ss_pred             CCCC---------CCCCCHHHHHHHHHHHHHCCCEEEECCEEEECCC--------------CCCCH-H---HCCCCCCHH
T ss_conf             5224---------3014799999999999857952884787996355--------------55330-3---005653021


Q ss_pred             HHHCCCCCEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECC-------------CCCHHHHHHHHH-HHHHHHHHH
Q ss_conf             120257740788622431143047513402136432356410004-------------532489867887-644444443
Q gi|255764513|r  148 LSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKS-------------DGMPTYHLANVI-DDHLMKITH  213 (492)
Q Consensus       148 ~~~~g~~~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~-------------dg~ptY~~a~vv-DD~~m~ith  213 (492)
                       +..|.    |..+..                .-..-.||+|+|+             .|.|-.|.-|.+ =....|-+-
T Consensus       163 -~~~g~----rv~~~~----------------~K~~p~DFaLWK~~~~ge~~W~SPWG~GRPGWHIECSaM~~~~LG~~~  221 (460)
T PRK00260        163 -LQAGA----RVEVAE----------------EKRDPLDFVLWKAAKPGEPSWDSPWGKGRPGWHIECSAMSTKYLGETF  221 (460)
T ss_pred             -HHCCC----CCCCCC----------------CCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCC
T ss_conf             -21156----567663----------------447855322127888888777698888798742263799998759975


Q ss_pred             HHC--CCC----CCCHHHHHHHHHHHHHHCCC-HHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCC
Q ss_conf             112--235----43024788999998510000-0101455531101322122343-302456662977377998998506
Q gi|255764513|r  214 VAR--GEE----WISSVPKHILLYQYFNFPIP-EFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLF  285 (492)
Q Consensus       214 viR--g~d----~~~~t~~q~~l~~al~~~~p-~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLG  285 (492)
                      =|-  |.|    |-.|--.|-.-  +.|-+.- -|.|...+ ..+|+||||.-|- ++|.++.+. |-|+++.-++..--
T Consensus       222 DIH~GG~DL~FPHHENEiAQs~a--~~~~~~a~yW~H~g~l-~i~g~KMSKSlgN~iti~dll~~-y~~~~lR~~lLs~h  297 (460)
T PRK00260        222 DIHGGGSDLIFPHHENEIAQSEA--ATGKPFANYWMHNGFV-TVNGEKMSKSLGNFFTIRDLLKK-YDPEVLRFFLLSAH  297 (460)
T ss_pred             EEEECCCCCCCCCCCCHHHHHHH--HHCCCCCCEEEEEEEE-EECCEEEECCCCCCCCHHHHHHH-HCHHHHHHHHHHCC
T ss_conf             47624526778996109999988--6489865245651057-63671750357870019999987-07799999998546


Q ss_pred             CCC
Q ss_conf             766
Q gi|255764513|r  286 VHK  288 (492)
Q Consensus       286 ws~  288 (492)
                      |..
T Consensus       298 YR~  300 (460)
T PRK00260        298 YRS  300 (460)
T ss_pred             CCC
T ss_conf             899


No 31 
>pfam01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain. This family includes only cysteinyl tRNA synthetases.
Probab=99.01  E-value=9.2e-09  Score=79.80  Aligned_cols=247  Identities=16%  Similarity=0.132  Sum_probs=136.6

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHH-----CCCEEEEEECCCCCC---------C----CCHHHHHHHHHHHHHCCCCCC
Q ss_conf             8433887850159999999999997-----188499997048666---------3----886799999999886589888
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAKR-----TGGKFILRIEDTDSK---------R----STLESENAVMQSLKWCGLNWD   73 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~~-----~~g~f~lRieDtd~~---------R----~~~~~~~~i~~~l~wlgl~~D   73 (492)
                      -|..=+.+||||+||++..-++||-     ..-.|+-=|+|-|++         .    .....++...++++-|+|..+
T Consensus        16 gPt~Y~~pHIGHa~t~I~~Dvi~R~~r~~G~~V~fv~g~ddhgdKI~~~A~~~g~~p~e~~d~~~~~F~~~~~~L~I~~~   95 (301)
T pfam01406        16 GPTVYDDSHIGHARSAVAFDVLRRYLQALGYDVQFVQNFTDIDDKIIKRAQQQGESFRELAARFITAYTKDMDALNVLPP   95 (301)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99068997522336899999999999974994699967786317999999980986537999999999988998498289


Q ss_pred             CCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEEC------CCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             6765588767632326289999999999988982451------4889997766887664310002366555788333001
Q gi|255764513|r   74 EGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC------FCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIER  147 (492)
Q Consensus        74 e~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c------~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~  147 (492)
                      ..        -.+-|+..+.-++++++|+++|.||.-      |+..+               ....|.|.....++...
T Consensus        96 d~--------~~rtTehi~~v~~~i~~L~~kG~~Y~~~~~~~Yf~~~~---------------~~~yg~l~~~~~~~~~~  152 (301)
T pfam01406        96 DL--------EPRVTEHIDEIIEFIERLIKKGYAYVSDNGDVYFDVSS---------------FPDYGKLSGQNLEQLEA  152 (301)
T ss_pred             CC--------CCCCCCCHHHHHHHHHHHHHCCCEEECCCCCEEEEECC---------------CCCCCCCCCCCHHHHHC
T ss_conf             86--------87754357999999999997797687269988996667---------------46544046435777752


Q ss_pred             HHHCCCCCEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHH----------HHHHHHHHHHHHHHHCC
Q ss_conf             12025774078862243114304751340213643235641000453248986----------78876444444431122
Q gi|255764513|r  148 LSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHL----------ANVIDDHLMKITHVARG  217 (492)
Q Consensus       148 ~~~~g~~~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~----------a~vvDD~~m~ithviRg  217 (492)
                      . +.+. ...+.+.|.+ -+.|.-.-.|++.++..        =..|.|.+|.          .+-+|=|..|+.++.  
T Consensus       153 ~-~~~~-~~~~k~~~~d-f~Lwk~~~~~~~~~~~p--------wg~~~PgWhie~~~~~~~~~g~~~DiH~~G~Di~~--  219 (301)
T pfam01406       153 G-ARGE-VGEGKRDPLD-FALWKASKEGEPSWDSP--------WGKGRPGWHIECSAMARKYLGSQIDIHGGGVDLKF--  219 (301)
T ss_pred             C-CCCC-CCCCCCCCCH-HHEECCCCCCCCCCCCC--------CCCCCCCCCEEEEHHHHHHCCCCCCEECCCEEECC--
T ss_conf             5-7766-4433258035-33211456678775577--------77898975466506778741898733027651013--


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCH-HHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHH
Q ss_conf             35430247889999985100000-101455531101322122343-3024566629773779989985067666553011
Q gi|255764513|r  218 EEWISSVPKHILLYQYFNFPIPE-FIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSEDDDEL  295 (492)
Q Consensus       218 ~d~~~~t~~q~~l~~al~~~~p~-f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~~d~Ei  295 (492)
                       -|-.|-|.|.+  .|.|.++|. |.|+..++ .+|+||||..|- +.+.++.+. |-|+|+.=||..--++.    .==
T Consensus       220 -pH~~~~~A~~~--a~~~~~~~~~~~h~G~l~-~~G~KMSKSlGNvv~~~dl~~~-~g~d~~Ryfll~~~y~~----~~~  290 (301)
T pfam01406       220 -PHHENEIAQSE--AAFDQQLAKYWLHNGHLM-IEGEKMSKSLGNFLTIRDVLKR-YDPRILRYFLLSVHYRS----PLD  290 (301)
T ss_pred             -CCCHHHHHHHH--HHHCCCCCEEEEEEEEEE-ECCEECCCCCCCCCCHHHHHHH-CCHHHHHHHHHHCCCCC----CCC
T ss_conf             -55241999999--851999514999852798-7883866647873779999876-89999999998465899----878


Q ss_pred             CCHHHHHH
Q ss_conf             01467776
Q gi|255764513|r  296 MDMQQLIH  303 (492)
Q Consensus       296 fsl~eli~  303 (492)
                      ||-+-|.+
T Consensus       291 fs~~~l~~  298 (301)
T pfam01406       291 FSEELLEQ  298 (301)
T ss_pred             CCHHHHHH
T ss_conf             79999997


No 32 
>PRK12268 methionyl-tRNA synthetase; Reviewed
Probab=98.99  E-value=4.4e-08  Score=75.19  Aligned_cols=280  Identities=15%  Similarity=0.186  Sum_probs=136.3

Q ss_pred             EEEECCCCCCCCCCHHHHHHH-HHHHHHHH--HCCCEEEEEECCCCC----------------CCCCHHHHHHHHHHHHH
Q ss_conf             056348433887850159999-99999999--718849999704866----------------63886799999999886
Q gi|255764513|r    7 VRVRIAPSPTGEPHIGTAYTA-LFNYLIAK--RTGGKFILRIEDTDS----------------KRSTLESENAVMQSLKW   67 (492)
Q Consensus         7 v~~RfaPsPtG~lH~G~~rta-l~n~l~a~--~~~g~f~lRieDtd~----------------~R~~~~~~~~i~~~l~w   67 (492)
                      ++|-=-|-|||.|||||+.+. |-.-.+||  +..|.=++-+--||.                +-..+.+.+.+.+.++.
T Consensus         6 ~iTt~~Py~nG~lHiGH~~~~~l~aDi~aRy~R~~G~~v~~~~GtD~hG~~i~~~A~k~g~~p~e~~~~~~~~~~~~~~~   85 (558)
T PRK12268          6 LITSAWPYANGPLHLGHLAGSYLPADVYARYQRLKGNEVLFVSGSDEHGTPIELEAEKEGVSPQELADKYHEEHKEDFEK   85 (558)
T ss_pred             EEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             98479988889855231114198999999999837998797584064749999999985999999999999999999998


Q ss_pred             CCCCCCCCCCCCCCCCCEECCC--CHHHHHHHHHHHHHCCCEEEC-----CCCHHHHHHHHHHHHHHHCCCCC--C----
Q ss_conf             5898886765588767632326--289999999999988982451-----48899977668876643100023--6----
Q gi|255764513|r   68 CGLNWDEGPDIGGAYGPYRQSE--RKNIYQPYVQNLLEKKLAFRC-----FCSTERLEEMRRAQRKRNIPSRY--D----  134 (492)
Q Consensus        68 lgl~~De~~~~~g~~~p~~QS~--r~~~y~~~~~~L~~~g~aY~c-----~~t~eel~~~r~~~~~~~~~~~Y--~----  134 (492)
                      |||.||-=         ++-++  ....=++...+|.++|.+|.-     ||...+--. - ...-.|.+|..  +    
T Consensus        86 lgis~D~f---------~rT~~~~~~~~v~~~f~~L~~~G~iy~~~~~~~yc~~~~~fl-~-d~~v~G~cP~c~~~~~~G  154 (558)
T PRK12268         86 LGISYDNY---------TRTTSPEHHELVQEFFLKLYENGYIEKKTIEQAYCPSDGRFL-P-DRYVEGTCPYCGYEKARG  154 (558)
T ss_pred             CCCCCCCC---------CCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCC-C-HHHHCCCCCCCCCCCCCC
T ss_conf             19837768---------668988999999999999998899330135343684112313-1-233154067768743567


Q ss_pred             CCC----CCCCHHHHHHH--HHCCCCCEEE------EEECCCCE---------EECCCCCCCCEE-CCCCCCCCCCEECC
Q ss_conf             655----57883330011--2025774078------86224311---------430475134021-36432356410004
Q gi|255764513|r  135 GHC----LKLSSQEIERL--SQEQKKHVVR------LTVPNQGS---------CVFQDKVYGEME-IPWNAVDMQVLLKS  192 (492)
Q Consensus       135 ~~~----r~l~~~e~~~~--~~~g~~~~iR------~k~p~~~~---------~~~~D~i~G~~~-~~~~~~~D~vi~r~  192 (492)
                      ..|    +.+...+....  ...|.++.+|      ||++.-.+         ..|....+..+. +-...+.|..|-|.
T Consensus       155 d~ce~cg~~~~~~dli~p~~~~~g~~~e~~~~~~~f~~l~~~~~~l~~~~~~~~~~p~~~~~~~~~~l~~~l~D~~ISR~  234 (558)
T PRK12268        155 DQCDNCGALLDPTDLINPRSKISGSTPEFRETEHFFLDLPAFQEALRKWIESGTDWPPNVLNFTLNWLKEGLKPRAITRD  234 (558)
T ss_pred             CHHHHCCCCCCHHHHCCCCCCCCCCCCEEEECCCEEECCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             32532476478577248856778994447734530214187789999998538877889999999998633756545553


Q ss_pred             C--CCH------------------HHHHHHH--------HHHH--------HHHHHHHHCCCCCCCHHHHHHHHHH----
Q ss_conf             5--324------------------8986788--------7644--------4444431122354302478899999----
Q gi|255764513|r  193 D--GMP------------------TYHLANV--------IDDH--------LMKITHVARGEEWISSVPKHILLYQ----  232 (492)
Q Consensus       193 d--g~p------------------tY~~a~v--------vDD~--------~m~ithviRg~d~~~~t~~q~~l~~----  232 (492)
                      -  |.|                  .-.+++.        .++.        ...+.|++ |.|.+   +-|..++-    
T Consensus       235 ~~WGipiP~~~~~~~~iyVW~Da~~~yis~~~~~~~~~~~~~~~~~~W~~~~~~~~~f~-GkDii---~FH~v~wpa~l~  310 (558)
T PRK12268        235 LPWGIPIPFEGAEGKVFYVWFDAPIGYISATKEWAKRKGDPEAWKEFWLDSDTKYYYFI-GKDNI---PFHSVIWPAMLL  310 (558)
T ss_pred             CCCCEECCCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCCHHHHHHHCCCCCCEEEEEC-CCCCC---HHHHHHHHHHHH
T ss_conf             87865788555689679886578722034336545416985679872789984277643-66654---347879999997


Q ss_pred             HHH--HCCCHHH-HHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHH
Q ss_conf             851--0000010-1455531101322122343-302456662977377998998506766655301101467776520
Q gi|255764513|r  233 YFN--FPIPEFI-HLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD  306 (492)
Q Consensus       233 al~--~~~p~f~-H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~Fd  306 (492)
                      +.|  ++.|... .+.. +..+|+|+||..|. +...++.+. |-++|+.=||++.+- .  +.+--||.+++++..+
T Consensus       311 a~~~~~~lP~~i~~~g~-~~~~G~KmSKS~Gnvi~p~~~i~~-yg~D~lRy~L~~~~~-~--~~D~~fs~~~~~~~~N  383 (558)
T PRK12268        311 GSGEPYKLPTAIVSSEY-LTYEGQKFSKSRGWGIWVDDALER-LPPDYLRYYLAANAP-E--NSDTDFTWEEFIRRVN  383 (558)
T ss_pred             HCCCCCCCCCEEEEEEE-EEECCCCCCCCCCCCCCHHHHHHH-CCCHHHHHHHHHCCC-C--CCCCCCCHHHHHHHHH
T ss_conf             33798778877877556-874684114557887798999987-490777899885488-8--8888879999999999


No 33 
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=98.98  E-value=3.2e-09  Score=82.92  Aligned_cols=291  Identities=17%  Similarity=0.162  Sum_probs=137.4

Q ss_pred             CCEEEEC-CCCCCCCCCHHHHHHHHHHHHHHHHCC--CEEEE---EECCCCCCCCCHHHHHHHHHHHHHCCCCCC-CCCC
Q ss_conf             7705634-843388785015999999999999718--84999---970486663886799999999886589888-6765
Q gi|255764513|r    5 SKVRVRI-APSPTGEPHIGTAYTALFNYLIAKRTG--GKFIL---RIEDTDSKRSTLESENAVMQSLKWCGLNWD-EGPD   77 (492)
Q Consensus         5 ~~v~~Rf-aPsPtG~lH~G~~rtal~n~l~a~~~~--g~f~l---RieDtd~~R~~~~~~~~i~~~l~wlgl~~D-e~~~   77 (492)
                      .+|.+-| .|.|||+|||||+|.|++---+||=..  |-=+.   -|.|.-..      ....+-.+.-.|-... ..+.
T Consensus       117 ~kV~iE~sSaNptkplHiGHlR~aiiGDsLaril~~~Gy~V~r~~yvnD~G~Q------~~~l~~~~~~~~~e~~~~~~~  190 (577)
T COG0018         117 KKVVIEYSSANPTGPLHIGHLRNAIIGDSLARILEFLGYDVTRENYVNDWGTQ------IGMLALSYEKRGREALGLTPE  190 (577)
T ss_pred             CEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCHHHH------HHHHHHHHHHHCCCCCCCCCC
T ss_conf             87999874799999852332353688999999999839976678667857999------999999999955410137777


Q ss_pred             CCCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCC---CCCHHHHHHHHH-CCC
Q ss_conf             5887676323262899999999999889824514889997766887664310002366555---788333001120-257
Q gi|255764513|r   78 IGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCL---KLSSQEIERLSQ-EQK  153 (492)
Q Consensus        78 ~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r---~l~~~e~~~~~~-~g~  153 (492)
                              --....+.|.++.+.|.+..-.-. ....+.   .++.+  .+.+..  ..||   +.+-++.+.-+. =|.
T Consensus       191 --------~~~~lg~~y~~i~~~~~~~~~~~~-~~~~~~---~~k~e--~~d~~~--~lw~~~v~~~l~~~k~~l~~l~V  254 (577)
T COG0018         191 --------PDGYLGEYYVKIAKDLEEDPGNDE-EEAREE---VEKLE--SGDEEA--ELWRKFVDLSLEGIKETLDRLGV  254 (577)
T ss_pred             --------CHHHHHHHHHHHHHHHHHCCCCCH-HHHHHH---HHHHH--CCCHHH--HHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             --------206889999999999974846126-788999---99886--477578--99999999999999999999295


Q ss_pred             CCEEEEEECCCCEEECCC--------C--------CCCCEECCCC---CC---CCCCEECCCCCHHHH---HHHHHHHHH
Q ss_conf             740788622431143047--------5--------1340213643---23---564100045324898---678876444
Q gi|255764513|r  154 KHVVRLTVPNQGSCVFQD--------K--------VYGEMEIPWN---AV---DMQVLLKSDGMPTYH---LANVIDDHL  208 (492)
Q Consensus       154 ~~~iR~k~p~~~~~~~~D--------~--------i~G~~~~~~~---~~---~D~vi~r~dg~ptY~---~a~vvDD~~  208 (492)
                      .+-..+ .  +++..+++        +        -.|-..+++.   ..   .|.||.||||++||.   +|...+=+.
T Consensus       255 ~fD~~~-~--E~e~~~~~~~~~vv~~L~~~~~~~e~~GA~~vdl~~~~~~gd~~~~vl~KSDGt~lY~t~DIAy~~~K~~  331 (577)
T COG0018         255 KFDVYD-S--EGESFYNGKVEKVVEDLEEKGLLYEDDGALVVDLLKFKKFGDDKDRVLQKSDGTYLYFTRDIAYHLYKFE  331 (577)
T ss_pred             CCEEEE-C--CCHHHHCCCHHHHHHHHHHCCCEEEECCEEEEEHHHHHHCCCCCCEEEEECCCCEEEEHHHHHHHHHHHH
T ss_conf             300132-3--4265526649999999986697760099589864321111687772899769970542538999999973


Q ss_pred             HHHHHHH--CCCCCCCHHHHHHHHHHHHHHCCCH--HHHHH--HHHHHHCCCCCCCCCC-CCHHHHHHC-CCCHHHHHHH
Q ss_conf             4444311--2235430247889999985100000--10145--5531101322122343-302456662-9773779989
Q gi|255764513|r  209 MKITHVA--RGEEWISSVPKHILLYQYFNFPIPE--FIHLP--LIKNPDKSKLSKRRNP-TSISYYSAM-GYLPEALINF  280 (492)
Q Consensus       209 m~ithvi--Rg~d~~~~t~~q~~l~~al~~~~p~--f~H~p--li~~~~g~klSKR~~~-~~i~~~~~~-GylPeAilNy  280 (492)
                      .+-..+|  =|.||----++=-.+.+++|+.++.  ..|..  |+.+.+|.|||||.|. +.+.+..++ |=-.   .+=
T Consensus       332 ~~~d~~IyV~gadq~~~~~ql~~~l~~~g~~~~~~~~~h~~~~l~~~~~g~kmStR~G~~vtl~dllde~~era---~~~  408 (577)
T COG0018         332 RGFDKLIYVLGADQHGHFKQLKAVLELLGYGPDKEVLLHQGVGLVRGGEGVKMSTRAGNVVTLDDLLDEAGERA---PEE  408 (577)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHH---HHH
T ss_conf             69988999967862449999999999846998656189997752577877634224886578999999998876---667


Q ss_pred             HHHCCCCCCCCCHHHCCH--HHHHHHHHHHHCCCCCCCCHHHHHHHHHH
Q ss_conf             985067666553011014--67776520211375544201565566435
Q gi|255764513|r  281 LALLFVHKSEDDDELMDM--QQLIHHFDLHHLSKAGAVFDKQKLDWLNG  327 (492)
Q Consensus       281 LalLGws~~~~d~Eifsl--~eli~~FdL~~I~Ks~A~FD~eKL~wlN~  327 (492)
                      +.-.   +.. .+++-..  -..+..|+++.=.-++-.||+++..-+++
T Consensus       409 ~~~~---~~~-~~~iA~~vgi~Avry~~l~~~~~~~~~Fd~d~~lsfeg  453 (577)
T COG0018         409 MEEK---EEK-NEEIAEVVGIDAVRYADLSRSRDKDYVFDWDKALSFEG  453 (577)
T ss_pred             HHHH---HHH-HHHHHHHHHHHHHHHHHHHCCCCCCCEEEHHHHHHCCC
T ss_conf             6543---211-57777775240678998862899994753999974459


No 34 
>PRK00133 metG methionyl-tRNA synthetase; Reviewed
Probab=98.97  E-value=4.3e-09  Score=82.05  Aligned_cols=286  Identities=17%  Similarity=0.241  Sum_probs=144.0

Q ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEEECCCCC----------------CCCCHHHHHHHHHHHHHCCC
Q ss_conf             63484338878501599999999999971--8849999704866----------------63886799999999886589
Q gi|255764513|r    9 VRIAPSPTGEPHIGTAYTALFNYLIAKRT--GGKFILRIEDTDS----------------KRSTLESENAVMQSLKWCGL   70 (492)
Q Consensus         9 ~RfaPsPtG~lH~G~~rtal~n~l~a~~~--~g~f~lRieDtd~----------------~R~~~~~~~~i~~~l~wlgl   70 (492)
                      |-=-|=|+|.+||||++|.+..-.+||-.  .|.=++=+--||.                .-....+.+.+.+.+++|||
T Consensus         7 Tt~ipY~Ng~~HiGH~~~~i~aDv~aRy~Rl~G~~v~f~~GtDeHG~~i~~~A~~~g~tp~e~~d~~~~~~~~~~~~l~I   86 (666)
T PRK00133          7 TCALPYANGPIHLGHLLEYIQADIWVRYQRMRGHEVLFVCADDAHGTPIMLKAEKEGITPEELIARYHAEHKRDFAGFGI   86 (666)
T ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             17987888984312467699999999999836995498474278848999999985999999999999999999998399


Q ss_pred             CCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEEC-----CCCHHH--HHHHHHHHHHHHCCCC------CCCCC
Q ss_conf             8886765588767632326289999999999988982451-----488999--7766887664310002------36655
Q gi|255764513|r   71 NWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC-----FCSTER--LEEMRRAQRKRNIPSR------YDGHC  137 (492)
Q Consensus        71 ~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c-----~~t~ee--l~~~r~~~~~~~~~~~------Y~~~~  137 (492)
                      .+|.=..       --..+....=++...+|.++|.+|.-     ||...+  |.. |   .-.|.+|.      |-..|
T Consensus        87 s~D~f~r-------Tt~~~h~~~vq~~f~~l~~~G~iy~~~~~~~Yc~~~e~fl~D-r---~V~GtCP~C~~~~~~GD~C  155 (666)
T PRK00133         87 SFDNYGS-------THSEENRELAQEIYLKLKENGYIYERTIEQLYDPEKGMFLPD-R---FVKGTCPKCGAEDQYGDNC  155 (666)
T ss_pred             CCCCCCC-------CCCHHHHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCCCCCC-C---EEEEECCCCCCHHHCCCCC
T ss_conf             5787857-------898899999999999999789989740355566875655254-2---3420257778712048742


Q ss_pred             C----CCCHHHHHH--HHHCCCCCEEE------EEECCCC--------EEECCCCCCCCEE-CCCCCCCCCCEECCC---
Q ss_conf             5----788333001--12025774078------8622431--------1430475134021-364323564100045---
Q gi|255764513|r  138 L----KLSSQEIER--LSQEQKKHVVR------LTVPNQG--------SCVFQDKVYGEME-IPWNAVDMQVLLKSD---  193 (492)
Q Consensus       138 r----~l~~~e~~~--~~~~g~~~~iR------~k~p~~~--------~~~~~D~i~G~~~-~~~~~~~D~vi~r~d---  193 (492)
                      -    .+...|...  ....|.++++|      ||++.-.        +-.|...++..+. +=...+.|..|-|.-   
T Consensus       156 e~cG~~~~p~eL~~p~~~~~g~~~e~~~~e~~ff~Ls~~~~~L~~~~~~~~~~~~~~n~~~~~l~~gL~D~~ISR~~~W~  235 (666)
T PRK00133        156 EVCGATYSPTELINPKSAISGATPVLKESEHFFFKLPDFEEFLKEWTRSGALQPNVANKMKEWLEEGLQDWDISRDAPYF  235 (666)
T ss_pred             CCCCCCCCCHHHCCCCCCCCCCCCEEECCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCCC
T ss_conf             24565167344238643457985166035333313877778998751048898789999999985788775304027844


Q ss_pred             CCHH-----------------HHHH--HHHH------------HHHHHHHHHHCCCCCCCHHHHHHHHH----HHHHHCC
Q ss_conf             3248-----------------9867--8876------------44444443112235430247889999----9851000
Q gi|255764513|r  194 GMPT-----------------YHLA--NVID------------DHLMKITHVARGEEWISSVPKHILLY----QYFNFPI  238 (492)
Q Consensus       194 g~pt-----------------Y~~a--~vvD------------D~~m~ithviRg~d~~~~t~~q~~l~----~al~~~~  238 (492)
                      |.|.                 |-=+  .-.+            |-.-.+.|+| |.|.   ++-|-.++    .+.|++.
T Consensus       236 GipvP~~~~kv~YVW~DA~igYis~t~~~~~~~~~~~~~~W~~d~~~~~vhfi-GKDi---i~FH~i~wPa~L~~~g~~l  311 (666)
T PRK00133        236 GFEIPGAPGKVFYVWLDAPIGYISSTKNLCDKRGLDWDEYWKKDSDTELYHFI-GKDI---IYFHTLFWPAMLEGAGYRL  311 (666)
T ss_pred             CEECCCCCCEEEEEEECCCHHHHHHHHHHCCCCCCCHHHCCCCCCCCCEEEEC-CCCH---HHHHHHHHHHHHHHCCCCC
T ss_conf             45888987648999615645377764433143565587638899876336753-4431---1464767999998467788


Q ss_pred             CH--HHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCC
Q ss_conf             00--101455531101322122343-30245666297737799899850676665530110146777652021137554
Q gi|255764513|r  239 PE--FIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAG  314 (492)
Q Consensus       239 p~--f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks~  314 (492)
                      |.  |+| .. ++.+|+|+||-.|- +...++.+. |-++|+.=||++-.- .+..|- =||.+++++..+-+-++.=|
T Consensus       312 P~~v~~h-g~-l~~~G~KmSKS~Gnvv~p~~~l~~-yg~D~lRY~l~~~~p-~~~~D~-dfs~~~~~~r~NsdLan~lG  385 (666)
T PRK00133        312 PTNVFAH-GF-LTVEGAKMSKSRGTFIWARTYLDH-LDPDYLRYYLAAKLP-SRIDDI-DFNWEDFQQRVNSDLVGKLV  385 (666)
T ss_pred             CCCCCCC-CC-EEECCEEEECCCCEEEEHHHHHHH-CCCCCEEHHHHHCCC-CCCCCC-CCCHHHHHHHHHHHHHHHHH
T ss_conf             8612114-64-877880600126717617999986-696453020331078-987677-86999999998688887666


No 35 
>PRK12418 cysteinyl-tRNA synthetase; Provisional
Probab=98.93  E-value=7e-08  Score=73.81  Aligned_cols=224  Identities=17%  Similarity=0.140  Sum_probs=135.9

Q ss_pred             CCCCCCCCCCHHHHHHHHH-----HHHHHHHCCCEEEEEECCCCC---CCC----------CHHHHHHHHHHHHHCCCCC
Q ss_conf             4843388785015999999-----999999718849999704866---638----------8679999999988658988
Q gi|255764513|r   11 IAPSPTGEPHIGTAYTALF-----NYLIAKRTGGKFILRIEDTDS---KRS----------TLESENAVMQSLKWCGLNW   72 (492)
Q Consensus        11 faPsPtG~lH~G~~rtal~-----n~l~a~~~~g~f~lRieDtd~---~R~----------~~~~~~~i~~~l~wlgl~~   72 (492)
                      -.|.+-.+.||||+||+++     -||-..-+.-+++.-|-|.|-   .|.          .+.+.+..++|++.|++..
T Consensus        15 CGPTVYd~~HiGhaRt~v~fD~l~R~L~~~gy~V~~v~NiTDVDDKii~~A~~~g~~~~ela~~~~~~f~~d~~~Lnv~~   94 (384)
T PRK12418         15 CGITPYDATHLGHAATYLAFDLVQRVWLDAGHDVHYVQNVTDVDDPLLERAARDGVDWRDLAAREIALFREDMAALRVLP   94 (384)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             68868888542335168999999999998099649998105063899999998593999999999999999999829999


Q ss_pred             -CCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEE---------CCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCH
Q ss_conf             -8676558876763232628999999999998898245---------148899977668876643100023665557883
Q gi|255764513|r   73 -DEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFR---------CFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSS  142 (492)
Q Consensus        73 -De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~---------c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~  142 (492)
                       |.-|         +-|+.++.-.+.+++|+++|+||.         .|-..              .-+.| |+--+++.
T Consensus        95 p~~~p---------raTe~I~~ii~~I~~Li~~G~AY~~~~~~~G~VYFdv~--------------~~~~Y-G~ls~~~~  150 (384)
T PRK12418         95 PRDYV---------GAVESIPEVVELVEKLLASGAAYVVDDPEYGDVYFSVD--------------ATPQF-GYESGYDR  150 (384)
T ss_pred             CCEEC---------CCCCCHHHHHHHHHHHHHCCCEEECCCCCCCCEEEEEC--------------CHHHH-CCCCCCCH
T ss_conf             95003---------21137999999999999679557756888886899952--------------42211-45015998


Q ss_pred             HHHHHHHHC-CCCCEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECC-------------CCCHHHHHHHHH----
Q ss_conf             330011202-57740788622431143047513402136432356410004-------------532489867887----
Q gi|255764513|r  143 QEIERLSQE-QKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKS-------------DGMPTYHLANVI----  204 (492)
Q Consensus       143 ~e~~~~~~~-g~~~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~-------------dg~ptY~~a~vv----  204 (492)
                      ++....... |..+- +               .+     -..--||+|+|+             .|-|-.|.-|++    
T Consensus       151 ~~~~~~~~e~~~~~~-~---------------~~-----Kr~p~DFaLWK~~~~gEp~W~SPWG~GRPGWHIECSaMs~~  209 (384)
T PRK12418        151 ETMLELFAERGGDPD-R---------------PG-----KRDPLDALLWRAARPGEPSWPSPFGPGRPGWHIECSAIALN  209 (384)
T ss_pred             HHHHHHHHHCCCCCC-C---------------CC-----CCCCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             999877533157754-3---------------35-----78866603557577778887699888088430565899998


Q ss_pred             ------HHHHHHHHHHHCCCCCCCHHHHHHHHHHHH-HHC--CCHHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCH
Q ss_conf             ------644444443112235430247889999985-100--000101455531101322122343-3024566629773
Q gi|255764513|r  205 ------DDHLMKITHVARGEEWISSVPKHILLYQYF-NFP--IPEFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLP  274 (492)
Q Consensus       205 ------DD~~m~ithviRg~d~~~~t~~q~~l~~al-~~~--~p~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylP  274 (492)
                            |=|-=|+.++.-   |-.|.-.|-   +|+ |-.  .--|.|..++ ..+|+||||.-|. +.|.++.++||-|
T Consensus       210 ~LG~~~DIHgGG~DL~FP---HHENEiAQs---ea~~g~~~~a~yW~H~g~l-~~~geKMSKSlGN~i~i~dl~~~g~~p  282 (384)
T PRK12418        210 RLGSGFDIQGGGSDLIFP---HHEFSAAHA---EAATGERRFARHYVHAGMI-GLDGEKMSKSRGNLVFVSRLRAAGVDP  282 (384)
T ss_pred             HCCCCEEEECCCCCCCCC---CCHHHHHHH---HHHHCCCHHHHHHHHHCEE-EECCEECCCCCCCEEEHHHHHHCCCCH
T ss_conf             759976784686256588---835499999---9865897487888600426-688867456688714699998638987


Q ss_pred             HHHHHHHHHCCC
Q ss_conf             779989985067
Q gi|255764513|r  275 EALINFLALLFV  286 (492)
Q Consensus       275 eAilNyLalLGw  286 (492)
                      +++.-||..--|
T Consensus       283 ~~~R~~lL~~hY  294 (384)
T PRK12418        283 AAIRLALLAGHY  294 (384)
T ss_pred             HHHHHHHHCCCC
T ss_conf             999999970567


No 36 
>PRK12267 methionyl-tRNA synthetase; Reviewed
Probab=98.84  E-value=6.7e-09  Score=80.76  Aligned_cols=284  Identities=14%  Similarity=0.166  Sum_probs=144.3

Q ss_pred             CCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEEECCCC----------------CCCCCHHHHHHHH
Q ss_conf             9888770563484338878501599999999999971--884999970486----------------6638867999999
Q gi|255764513|r    1 MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRT--GGKFILRIEDTD----------------SKRSTLESENAVM   62 (492)
Q Consensus         1 ~~~~~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~--~g~f~lRieDtd----------------~~R~~~~~~~~i~   62 (492)
                      ||...=..|-=-|=++|.+||||++|.+..-.+||-.  .|.=.+=+=.||                ++-..+++...+.
T Consensus         1 mm~k~~~iTt~ipY~Ng~~HiGHa~~~i~aDv~aRy~R~~G~~v~f~~GtDehG~kI~~~A~~~g~tP~e~~d~~~~~~~   80 (644)
T PRK12267          1 MMKKTFYITTPIYYPSGKLHIGHAYTTIAADVLARYKRLQGYDVFFLTGTDEHGQKIQQKAEEAGITPQEYVDEISAGFK   80 (644)
T ss_pred             CCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             99999899689988899855453487899999999998469975984876875299999999859999999999999999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEEC-----CCCHHHHHHHHHHHHH-HHCCCCCCCC
Q ss_conf             998865898886765588767632326289999999999988982451-----4889997766887664-3100023665
Q gi|255764513|r   63 QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC-----FCSTERLEEMRRAQRK-RNIPSRYDGH  136 (492)
Q Consensus        63 ~~l~wlgl~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c-----~~t~eel~~~r~~~~~-~~~~~~Y~~~  136 (492)
                      +.+++|||.+|.=..       -..-+..+.=++..++|.++|.+|.-     ||...|--. .+.+.. .|.+|.....
T Consensus        81 ~~~~~l~Is~D~f~r-------Tt~~~h~~~vq~if~~L~~kG~Iy~~~~~~~Yc~~ce~f~-~~~~l~d~g~cp~cg~~  152 (644)
T PRK12267         81 DLWDKLDISYDKFIR-------TTDERHKKVVQKVFEKLYDQGDIYLGEYEGWYCVSCETFF-TESQLVDGGKCPDSGHE  152 (644)
T ss_pred             HHHHHCCCCCCCCCC-------CCCHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCC-CHHHCCCCCCCCCCCCC
T ss_conf             999986996787854-------8988999999999999998899786655123258754333-62440457868778997


Q ss_pred             CC---------CCCHH----------------------HH-HHHHHCCC--------CCEEEEEECCCC---EEECCCCC
Q ss_conf             55---------78833----------------------30-01120257--------740788622431---14304751
Q gi|255764513|r  137 CL---------KLSSQ----------------------EI-ERLSQEQK--------KHVVRLTVPNQG---SCVFQDKV  173 (492)
Q Consensus       137 ~r---------~l~~~----------------------e~-~~~~~~g~--------~~~iR~k~p~~~---~~~~~D~i  173 (492)
                      ..         .|++-                      |+ ...+..|-        .+-|-+.+|.+.   -++|-|..
T Consensus       153 ~e~~~ee~yffkL~~~~~~L~~~~~~~p~~i~p~~~~ne~~~~~l~~gL~D~~ISR~~~~WGipvP~d~~~v~YVWfDA~  232 (644)
T PRK12267        153 VELVKEESYFFRMSKYADRLLEFYEENPDFIQPESRKNEMLNNFIKPGLEDLAVSRTSFDWGIPVPSDPKHVVYVWIDAL  232 (644)
T ss_pred             CEEECCCCEEEEHHHHHHHHHHHHHCCCCEECCHHHHHHHHHHHHHCCCCCCCEECCCCCCCCCCCCCCCEEEEEEECCC
T ss_conf             64640565144346678999999960997467625887999999857785543024778888857898760799842243


Q ss_pred             CCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHH-HHHHHHHHHHCCCH--HHHHHHHHHH
Q ss_conf             34021364323564100045324898678876444444431122354302478-89999985100000--1014555311
Q gi|255764513|r  174 YGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPK-HILLYQYFNFPIPE--FIHLPLIKNP  250 (492)
Q Consensus       174 ~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~-q~~l~~al~~~~p~--f~H~pli~~~  250 (492)
                      -|-++.-             |+|.-+ ..--++.--.-.|+| |.|.+.--.. -..+..++|.++|+  |+| ..+ .-
T Consensus       233 i~Yisa~-------------g~~~~~-~~~~~~~Wp~~~h~i-GkDii~FH~i~wpamL~~~~~~~p~~v~~h-g~~-~~  295 (644)
T PRK12267        233 LNYITAL-------------GYGSDD-DELFMKFWPADVHLV-GKDILRFHAIYWPIMLMALDLPLPKHLFAH-GWW-LM  295 (644)
T ss_pred             CCHHHHH-------------CCCCCC-CHHHHHHCCHHHCCC-CCCHHHHHHHHHHHHHHHCCCCCCCEEECC-CEE-EC
T ss_conf             0034341-------------386212-266776373133026-855323668899999997699986445104-418-71


Q ss_pred             HCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCC
Q ss_conf             01322122343-3024566629773779989985067666553011014677765202113755
Q gi|255764513|r  251 DKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKA  313 (492)
Q Consensus       251 ~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks  313 (492)
                      +|+|+||-.|. +...++.+. |-++|+.=||++-. +.+ .|. =||.+++++..+-+-+++=
T Consensus       296 ~g~KmSKS~Gn~i~~~~~~~~-~g~D~lRyyl~~~~-~~~-~D~-dfs~~~f~~r~NsdL~n~l  355 (644)
T PRK12267        296 KDGKMSKSKGNVVDPEELVDR-YGLDALRYYLLREV-PFG-SDG-DFSPEAFVERINSDLANDL  355 (644)
T ss_pred             CCCEECCCCCCEECHHHHHHH-CCCCCEEEEEEECC-CCC-CCC-CCCHHHHHHHHHHHHHHHH
T ss_conf             786005536842237999875-59404364644448-878-777-7899999999889988777


No 37 
>cd00671 ArgRS_core This is the catalytic core domain of Arginyl tRNA synthetase (ArgRS). This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. There are at least three subgroups of ArgRS. One type contains both characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The other subtype lacks the KMSKS motif; however, it has a lysine N-terminal to the HIGH motif, which serves as the functional counterpart to the second lysine of the KMSKS motif. A third group, which is found  primarily in archaea and a few bacteria,  lacks both the KMSKS motif and the HIGH loop lysine.
Probab=98.79  E-value=3.8e-08  Score=75.62  Aligned_cols=84  Identities=23%  Similarity=0.405  Sum_probs=57.0

Q ss_pred             CCEECCCCCC---CCCCEECCCCCHHHH---HHHHHHHHH-HHHHHH--HCCCCCCCHHHHHHHHHHHHHHCCC-HHHHH
Q ss_conf             4021364323---564100045324898---678876444-444431--1223543024788999998510000-01014
Q gi|255764513|r  175 GEMEIPWNAV---DMQVLLKSDGMPTYH---LANVIDDHL-MKITHV--ARGEEWISSVPKHILLYQYFNFPIP-EFIHL  244 (492)
Q Consensus       175 G~~~~~~~~~---~D~vi~r~dg~ptY~---~a~vvDD~~-m~ithv--iRg~d~~~~t~~q~~l~~al~~~~p-~f~H~  244 (492)
                      |.+.+.....   .|.||+||||.|||-   +|...+=.. .+...+  |=|.||-.-.++=..+.++|||+.+ .+-|+
T Consensus       172 GA~~~~~~~~gd~~~~vl~ksDG~~tY~~~DiAy~~~K~~~~~~D~~I~V~g~dq~~hf~~v~~~l~~lg~~~~~~l~h~  251 (267)
T cd00671         172 GALWLDLTEFGDDKDRVLVKSDGTYTYFTRDIAYHLDKFEERGADKIIYVVGADHHGHFKRLFAALELLGYPEAKKLEHI  251 (267)
T ss_pred             CEEEEECHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             80999620117887723672589765345799999999975898989999798779999999999997599988875999


Q ss_pred             --HHHHHHHCCCCCCC
Q ss_conf             --55531101322122
Q gi|255764513|r  245 --PLIKNPDKSKLSKR  258 (492)
Q Consensus       245 --pli~~~~g~klSKR  258 (492)
                        .++..++|+|||+|
T Consensus       252 ~~g~V~l~~~~kmStR  267 (267)
T cd00671         252 LYGMVNLPDEGKMSTR  267 (267)
T ss_pred             EEEEEECCCCCCCCCC
T ss_conf             8546998999988898


No 38 
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=98.67  E-value=1.4e-07  Score=71.71  Aligned_cols=230  Identities=20%  Similarity=0.176  Sum_probs=133.4

Q ss_pred             CCCCCCCCCHHHHHHHHHHHH---HHHHCCC--EEEEEECCCCC---CC----------CCHHHHHHHHHHHHHCCCC-C
Q ss_conf             843388785015999999999---9997188--49999704866---63----------8867999999998865898-8
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYL---IAKRTGG--KFILRIEDTDS---KR----------STLESENAVMQSLKWCGLN-W   72 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l---~a~~~~g--~f~lRieDtd~---~R----------~~~~~~~~i~~~l~wlgl~-~   72 (492)
                      .|.+-.+.||||+||+++=-+   +=+..|+  +|+--|-|.|-   .|          ..+-+.+...+|++-||+. +
T Consensus        29 GpTVYd~~HIGhaRt~V~fDvl~R~L~~~Gy~V~yV~NiTDIDDKIi~rA~~~g~~~~ev~~~~i~~f~~D~~aL~v~~p  108 (464)
T COG0215          29 GPTVYDYAHIGHARTYVVFDVLRRYLRYLGYKVTYVRNITDIDDKIINRAREEGLSIREVAERYIAAFFEDMDALNVLPP  108 (464)
T ss_pred             CCCCCCCCCCCCCCCEEHHHHHHHHHHHHCCEEEEEECCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             88257764456676520299999999982970799964666638999999982999999999999999999998299998


Q ss_pred             CCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCC
Q ss_conf             86765588767632326289999999999988982451488999776688766431000236655578833300112025
Q gi|255764513|r   73 DEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQ  152 (492)
Q Consensus        73 De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g  152 (492)
                      |--|         +-++..+--.+++++|+++|.||.----.        .--.-..-+.|---++.-+.++    +..|
T Consensus       109 ~~~P---------raTe~I~~iI~~I~~Li~kG~AY~~~~G~--------VYFdv~~f~~YG~LS~~~~le~----l~~g  167 (464)
T COG0215         109 DIEP---------RATEHIDEIIEFIEKLIEKGYAYVADDGD--------VYFDVSKFKDYGKLSGRDSLEE----LQAG  167 (464)
T ss_pred             CCCC---------CHHHCHHHHHHHHHHHHHCCCEEEECCCC--------EEEECCCHHHHHHHCCCCCHHH----HHHC
T ss_conf             6557---------47647999999999999779658846982--------8995243031786528987667----7513


Q ss_pred             CCCEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECC-------------CCCHHHHHHHHH-HHHHHHHHHHHC--
Q ss_conf             7740788622431143047513402136432356410004-------------532489867887-644444443112--
Q gi|255764513|r  153 KKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKS-------------DGMPTYHLANVI-DDHLMKITHVAR--  216 (492)
Q Consensus       153 ~~~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~-------------dg~ptY~~a~vv-DD~~m~ithviR--  216 (492)
                      .    |..+                .-.-.+-.||||+|+             -|-|-.|.-|.+ =....|-+.=|-  
T Consensus       168 a----r~~~----------------~~~Krnp~DFvLWK~sk~gEp~W~SPWG~GRPGWHIECSaM~~~~LG~~~DIHgG  227 (464)
T COG0215         168 A----RVEV----------------DEEKRNPLDFVLWKAAKPGEPSWDSPWGKGRPGWHIECSAMSTKYLGETFDIHGG  227 (464)
T ss_pred             C----CCCC----------------CCCCCCCHHHEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEECC
T ss_conf             5----4566----------------5455880011244258999988779988999944688999999870897512468


Q ss_pred             CCC----CCCHHHHHHHHHHHHHH-C--CCHHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCC
Q ss_conf             235----43024788999998510-0--000101455531101322122343-30245666297737799899850676
Q gi|255764513|r  217 GEE----WISSVPKHILLYQYFNF-P--IPEFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVH  287 (492)
Q Consensus       217 g~d----~~~~t~~q~~l~~al~~-~--~p~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws  287 (492)
                      |.|    |=.|.-.|-   +|..- +  .--|-|..+| +.+|+||||.-|. +.|.++.+. |-|+++.-||..--+.
T Consensus       228 G~DLiFPHHENEiAQs---ea~~g~~~~a~yWmH~G~l-~i~geKMSKSLGNfiti~d~l~~-~~p~~lR~~lls~HYR  301 (464)
T COG0215         228 GSDLIFPHHENEIAQS---EAATGVKPFAKYWMHNGFL-NIDGEKMSKSLGNFITVRDLLKK-YDPEVLRLFLLSSHYR  301 (464)
T ss_pred             CCCCCCCCCCCHHHHH---HHHHCCCCCEEEEEECCEE-EECCCCCCCCCCCEEEHHHHHHH-CCHHHHHHHHHHHHHC
T ss_conf             5025588863089998---7642997600586882645-24672765235776679999865-4879999999987757


No 39 
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=98.61  E-value=6.8e-07  Score=67.12  Aligned_cols=292  Identities=17%  Similarity=0.260  Sum_probs=157.5

Q ss_pred             CCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEEECCCCC----------------CCCCHHHHHHHHHHH
Q ss_conf             877056348433887850159999999999997--18849999704866----------------638867999999998
Q gi|255764513|r    4 SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKR--TGGKFILRIEDTDS----------------KRSTLESENAVMQSL   65 (492)
Q Consensus         4 ~~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~--~~g~f~lRieDtd~----------------~R~~~~~~~~i~~~l   65 (492)
                      ..-.+|-=-|-|+|.+||||++|-|-.-.+||-  ..|.=.+=+--||.                +-......+.+.+.+
T Consensus         5 ~~~~VTtalpY~Ng~~HlGH~~~~l~ADv~aRy~Rl~G~~v~fvtGtDeHGt~I~~~A~~~g~tP~el~d~~~~~~~~~~   84 (558)
T COG0143           5 KKILVTTALPYPNGPPHLGHLYTYLAADVYARYLRLRGYEVFFLTGTDEHGTKIELKAEKEGITPQELVDKNHEEFKELF   84 (558)
T ss_pred             CCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             73899558988999864136788878999999998269758999514787778899999859998999999999999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEE-------CCCCHHHHHHHHHHHHHHHCCCC------
Q ss_conf             86589888676558876763232628999999999998898245-------14889997766887664310002------
Q gi|255764513|r   66 KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFR-------CFCSTERLEEMRRAQRKRNIPSR------  132 (492)
Q Consensus        66 ~wlgl~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~-------c~~t~eel~~~r~~~~~~~~~~~------  132 (492)
                      +||+|.+|-       |+.--.+...+.=++..++|.++|..|.       |--...-+..    ..-.|.+|.      
T Consensus        85 ~~l~IsfD~-------F~rTt~~~h~~~vq~~f~~L~~~G~I~~~~~~~~Yc~~~e~fl~d----r~v~g~cp~cg~~~a  153 (558)
T COG0143          85 KALNISFDN-------FIRTTSPEHKELVQEFFLKLYENGDIYLREYEGLYCVSCERFLPD----RYVEGTCPKCGGEDA  153 (558)
T ss_pred             HHHCCCCCE-------ECCCCCHHHHHHHHHHHHHHHHCCCEECCCEEEEECCCCCCCCCC----HHEECCCCCCCCCCC
T ss_conf             980985430-------016897779999999999999789873144356473543564562----102055898675345


Q ss_pred             CCCC---C-CCCCHHH--HHHHHHCCCCCEEE------EEECCCC-----------EEECCCCCCCCE-ECCCCCCCCCC
Q ss_conf             3665---5-5788333--00112025774078------8622431-----------143047513402-13643235641
Q gi|255764513|r  133 YDGH---C-LKLSSQE--IERLSQEQKKHVVR------LTVPNQG-----------SCVFQDKVYGEM-EIPWNAVDMQV  188 (492)
Q Consensus       133 Y~~~---~-r~l~~~e--~~~~~~~g~~~~iR------~k~p~~~-----------~~~~~D~i~G~~-~~~~~~~~D~v  188 (492)
                      +--.   | +.+.+.+  .....-.|.+|++|      |+++.-.           ...+..-++-++ .|-...+.|.-
T Consensus       154 ~GD~Ce~Cg~~~~P~~l~~p~~~i~g~~p~~r~~~hyFf~L~~~~~~L~~~~~~~~~~~~p~~~~ne~~~~i~~GL~d~~  233 (558)
T COG0143         154 RGDQCENCGRTLDPTELINPVCVISGATPEVREEEHYFFRLSKFQDKLLEWYESNPDFIWPANRRNEVLNFLKEGLKDLS  233 (558)
T ss_pred             CCCHHHHCCCCCCCHHCCCCEEEEECCCCCCCCCEEEEEEHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCC
T ss_conf             76434322675792121798168647976433540599887986999999997396545886899999999976686643


Q ss_pred             EECCC---CCH---------------HHHHHHHHHHH----------------HHHHHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             00045---324---------------89867887644----------------444443112235430247889999985
Q gi|255764513|r  189 LLKSD---GMP---------------TYHLANVIDDH----------------LMKITHVARGEEWISSVPKHILLYQYF  234 (492)
Q Consensus       189 i~r~d---g~p---------------tY~~a~vvDD~----------------~m~ithviRg~d~~~~t~~q~~l~~al  234 (492)
                      |-|.|   |.|               ..+.-+..-..                .-++-|+| |.|   +++-|-.++-|+
T Consensus       234 IsR~~~~WGipvP~~p~kv~YVWfDAligYisa~~~~~~~~~~~~~~~~W~~~~~e~vhfI-GKD---ii~FHav~wPam  309 (558)
T COG0143         234 ITRTDLDWGIPVPGDPGKVIYVWFDALIGYISALGELAEIGDDEDFKKFWPADDTELVHFI-GKD---IIRFHAVYWPAM  309 (558)
T ss_pred             EECCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHCCHHCCCCHHHHHHHCCCCCCEEEEEE-CCC---CCCCHHHHHHHH
T ss_conf             1458988772579999877999634488999995412105876789863778884599996-245---674324578999


Q ss_pred             ----HHCCCHHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHH
Q ss_conf             ----100000101455531101322122343-302456662977377998998506766655301101467776520211
Q gi|255764513|r  235 ----NFPIPEFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHH  309 (492)
Q Consensus       235 ----~~~~p~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~  309 (492)
                          |...|.-.+..=-+.-+|.|+||-.|. +...++.+. |-|+++.=||++-.  | .+.+--||.+++++.-+-+-
T Consensus       310 L~~~~~~lP~~i~ahg~l~~~G~KmSKSrG~~V~~~~~~~~-~~~D~lRYyL~~~~--p-~~~D~dFs~~~f~~rvN~dL  385 (558)
T COG0143         310 LMAAGLPLPTRIFAHGFLTLEGQKMSKSRGNVVDPDELLEQ-YGVDALRYYLAREL--P-EGSDGDFSWEDFVERVNADL  385 (558)
T ss_pred             HHHCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEHHHHHHH-CCCHHHHHHHHHHC--C-CCCCCCCCHHHHHHHHHHHH
T ss_conf             97389998877984013997794124428818717999987-48238579888737--7-88888889999999998998


Q ss_pred             CCCCC
Q ss_conf             37554
Q gi|255764513|r  310 LSKAG  314 (492)
Q Consensus       310 I~Ks~  314 (492)
                      +++=+
T Consensus       386 ~n~lg  390 (558)
T COG0143         386 ANKLG  390 (558)
T ss_pred             HHHHH
T ss_conf             87888


No 40 
>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed
Probab=98.58  E-value=9.8e-06  Score=59.26  Aligned_cols=195  Identities=20%  Similarity=0.301  Sum_probs=103.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECC----CCCCCCCHHHHHHHHHHH-HH--CCCCCCCCCCCCCCCCCEE
Q ss_conf             3388785015999999999999718849999704----866638867999999998-86--5898886765588767632
Q gi|255764513|r   14 SPTGEPHIGTAYTALFNYLIAKRTGGKFILRIED----TDSKRSTLESENAVMQSL-KW--CGLNWDEGPDIGGAYGPYR   86 (492)
Q Consensus        14 sPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieD----td~~R~~~~~~~~i~~~l-~w--lgl~~De~~~~~g~~~p~~   86 (492)
                      -|||.+||||.-.|+.||..-.. .+..+.=|-|    |+.....++--+.+++.. .|  +||+++-..       -|.
T Consensus        10 qPTG~~HLGnylGai~~~v~lQ~-~~~~~~~IaDlHalT~~~~~~~~l~~~~~~~aa~~lA~GlDP~k~~-------if~   81 (333)
T PRK12282         10 RPTGKLHLGHYVGSLKNRVALQN-EHKQFVLIADTQALTDNAHNPEKIRENILEVALDYLAVGIDPAKST-------IFV   81 (333)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHC-CCCCEEEEECHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEE-------EEE
T ss_conf             87883548878999999999971-6880799844788745899999999999999999997589856428-------997


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCE
Q ss_conf             32628999999999998898245148899977668876643100023665557883330011202577407886224311
Q gi|255764513|r   87 QSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGS  166 (492)
Q Consensus        87 QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~~  166 (492)
                      ||+--+++. .       ...|-|+|+--+|+.+  .+-+.+                .   ...|              
T Consensus        82 QS~v~eh~e-L-------~w~l~~~~~~~~l~r~--~~~K~k----------------~---~~~~--------------  118 (333)
T PRK12282         82 QSQIPALAE-L-------TMYYMNLVTVARLERN--PTVKTE----------------I---AQKG--------------  118 (333)
T ss_pred             CCCCHHHHH-H-------HHHHHHCCCHHHHHHC--CHHHHH----------------H---HCCC--------------
T ss_conf             378668899-9-------9999830848898734--359999----------------8---6128--------------


Q ss_pred             EECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH--H-----CCC
Q ss_conf             430475134021364323564100045324898678876444444431122354302478899999851--0-----000
Q gi|255764513|r  167 CVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN--F-----PIP  239 (492)
Q Consensus       167 ~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~--~-----~~p  239 (492)
                        +.+.+      +            =|..||-.--+-|=.+.+-+||-=|+|-..-.-.-.-|-+.||  |     ..|
T Consensus       119 --~~~~i------~------------~Gl~~YPvLmAADILly~a~~VPVG~DQ~qHlELtRdiA~rfN~~yg~~~f~~P  178 (333)
T PRK12282        119 --FGRSI------P------------AGFLTYPVSQAADITAFKATLVPVGDDQLPMIEQTNEIVRRFNHTYGTDVLVEP  178 (333)
T ss_pred             --CCCCC------C------------CCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             --88887------6------------311037698602045137880766652599999999999999987098656886


Q ss_pred             --HHHHHHHHHHHHCC-CCCCCCCCCCHHHHHHCCCCHHHHHHHHHHC
Q ss_conf             --01014555311013-2212234330245666297737799899850
Q gi|255764513|r  240 --EFIHLPLIKNPDKS-KLSKRRNPTSISYYSAMGYLPEALINFLALL  284 (492)
Q Consensus       240 --~f~H~pli~~~~g~-klSKR~~~~~i~~~~~~GylPeAilNyLalL  284 (492)
                        .+.+.+-|++-||. ||||-.+.. |    ..-=.|+.|.+=+...
T Consensus       179 ~~~~~~~~ri~~Ldg~~KMSKS~~n~-I----~L~D~~~~I~kKI~ka  221 (333)
T PRK12282        179 EALLPEAGRLPGLDGKAKMSKSLGNA-I----YLSDSADTIKKKVMSM  221 (333)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-E----ECCCCHHHHHHHHHHC
T ss_conf             23045456672999850105999996-2----1448999999998838


No 41 
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS). This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. In Aquifex aeolicus, the gene encoding LeuRS is split in two, just before the KMSKS motif. Consequently, LeuRS is a heterodimer, which likely superimposes with the LeuRS monomer found in most other organisms. LeuRS has an insertion in the core domain, which is subject to both deletions and rearrangements and thus differs between prokaryotic LeuRS and archaeal/eukaryotic LeuRS. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
Probab=98.56  E-value=4.5e-07  Score=68.33  Aligned_cols=67  Identities=16%  Similarity=0.080  Sum_probs=45.4

Q ss_pred             CCCCCCH-----HHHHHHHHHHHHHCCCHH-HHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCC
Q ss_conf             2354302-----478899999851000001-01455531101322122343-302456662977377998998506
Q gi|255764513|r  217 GEEWISS-----VPKHILLYQYFNFPIPEF-IHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLF  285 (492)
Q Consensus       217 g~d~~~~-----t~~q~~l~~al~~~~p~f-~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLG  285 (492)
                      |.|.+..     ..-+..|+.+-...+|+. .|+..++ .+|+||||..|- +...++.++ |-++|+.=||++-+
T Consensus       295 GkDii~fH~~~~~~~~~~l~~~~~~~~p~~v~~hG~l~-~~G~KMSKS~Gn~v~p~~~l~~-yg~D~lR~~Ll~~~  368 (376)
T cd00812         295 GKEHAVNHLLYSRFNHKALFDEGTKEPPKGLRVQGMVL-LEGEKMSKSKGNVVTPDEAIKK-YGADATRLYLLFAA  368 (376)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCEE-CCCEECCCCCCCCCCHHHHHHH-CCCHHHHHHHHHCC
T ss_conf             33542013679999999998646777982668757296-6996637789988498999988-59549999999449


No 42 
>cd00395 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain. These enzymes attach Tyr or Trp, respectively, to the appropriate tRNA. These class I enzymes are homodimers, which aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the class I characteristic HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=98.56  E-value=6.3e-06  Score=60.57  Aligned_cols=201  Identities=21%  Similarity=0.236  Sum_probs=120.3

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCC-----CC---CCCCHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             056348433887850159999999999997188499997048-----66---6388679999999988658988867655
Q gi|255764513|r    7 VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDT-----DS---KRSTLESENAVMQSLKWCGLNWDEGPDI   78 (492)
Q Consensus         7 v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDt-----d~---~R~~~~~~~~i~~~l~wlgl~~De~~~~   78 (492)
                      |-+=|.  |||.|||||+-.++.+|.+-+. |.+.++=|=|.     |+   ..........+..++.-+|++++..   
T Consensus         3 vy~G~~--PTg~lHlG~~v~~~~~~~~q~~-g~~~~~~iaD~~a~~~d~~~~~~~i~~~~~~~~~~~~a~g~d~~k~---   76 (274)
T cd00395           3 VYSGID--PTGSLHLGHYVGAIKLKVLQQA-GHEVIILIADLHALTGDPSLDPEEIRKNAREIAKQILALGLDPEKA---   76 (274)
T ss_pred             EEEEEC--CCCCCHHHHHHHHHHHHHHHHC-CCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCHHHC---
T ss_conf             999058--8871468999999999999988-9988999907711437999999999999999999999977994772---


Q ss_pred             CCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEE
Q ss_conf             88767632326289999999999988982451488999776688766431000236655578833300112025774078
Q gi|255764513|r   79 GGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVR  158 (492)
Q Consensus        79 ~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR  158 (492)
                          .-+.||+.... .++.+-+..-    -|..|-.++...  .        .|            ..+...+..    
T Consensus        77 ----~i~~~S~~~~~-~~~~~l~~~l----~~~~~~~~l~~~--~--------~~------------k~r~~~~~~----  121 (274)
T cd00395          77 ----TIVFQSDWLLK-LEHLELLRLL----GKHVTVGRLLRM--D--------GF------------KDRLAEEEG----  121 (274)
T ss_pred             ----EEEEHHHHCCC-HHHHHHHHHH----HCCCCHHHHHHH--H--------HH------------HHHHHCCCC----
T ss_conf             ----78632310772-5699999999----673768899733--6--------78------------877623689----


Q ss_pred             EEECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH-HHC
Q ss_conf             8622431143047513402136432356410004532489867887644444443112235430247889999985-100
Q gi|255764513|r  159 LTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYF-NFP  237 (492)
Q Consensus       159 ~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al-~~~  237 (492)
                              +.     .|...                   |-+-=+.|=.....++|+=|.|-..+--.-..+.+.+ +++
T Consensus       122 --------~~-----~~~~~-------------------YP~lQaaDil~~~~~~v~~G~DQ~~~~~l~Rdia~k~~~~~  169 (274)
T cd00395         122 --------IS-----LGEFT-------------------YPVLQAADILLLKADLVPGGSDQDPHIELGRDLARRFNGFK  169 (274)
T ss_pred             --------CC-----CCEEE-------------------CCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             --------77-----00232-------------------43076531776506545556117999999999999944999


Q ss_pred             CCHHHHHHHHHHHHC-CCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHC
Q ss_conf             000101455531101-32212234330245666297737799899850
Q gi|255764513|r  238 IPEFIHLPLIKNPDK-SKLSKRRNPTSISYYSAMGYLPEALINFLALL  284 (492)
Q Consensus       238 ~p~f~H~pli~~~~g-~klSKR~~~~~i~~~~~~GylPeAilNyLalL  284 (492)
                      .|.-.|.|+|.+.+| +|+||..+...+ .+.+   .|+.|-.++...
T Consensus       170 ~p~~l~~~~l~~l~G~~KMSKS~~ns~i-~l~D---sp~~i~~KI~~a  213 (274)
T cd00395         170 KPVALTSPLLTGLDGGKKMSKSDGNAII-FLLD---SPEEIYKKIMKA  213 (274)
T ss_pred             CCEEEECCCCCCCCCCCCCCCCCCCCEE-ECCC---CHHHHHHHHEEC
T ss_conf             9868723774468997674578998446-5469---999999987224


No 43 
>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS). This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.
Probab=98.53  E-value=3.9e-06  Score=61.97  Aligned_cols=253  Identities=19%  Similarity=0.200  Sum_probs=136.5

Q ss_pred             CCEEEECCCCCCCCCCHHHHHHHHHHHHHHHH-----CCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             77056348433887850159999999999997-----1884999970486663886799999999886589888676558
Q gi|255764513|r    5 SKVRVRIAPSPTGEPHIGTAYTALFNYLIAKR-----TGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIG   79 (492)
Q Consensus         5 ~~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~-----~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~   79 (492)
                      .++++.=.=||+|..||||+|-.+-.++.+|.     ..-+||.=.||.|.-|-++..+..-++  +.+|.---.-|+-.
T Consensus        19 ~~~v~~tG~~PSG~~HIGn~rEv~~~~~V~ral~~~g~~~~~i~~~DD~D~lRKVp~~lpe~~~--~ylg~PL~~IPdP~   96 (354)
T cd00674          19 EKYVVASGISPSGLIHIGNFREVVTADAVRRALRDLGFEVRLIYSWDDYDPLRKVPDNVPESLE--QYIGMPLSSVPDPF   96 (354)
T ss_pred             CCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEECCCHHCCCCCCCCHHHH--HHCCCCCEECCCCC
T ss_conf             8589947879998863205501788999999999759967999984055510037557879999--86299630068977


Q ss_pred             CCCCCEECCCCHHHHHHHHHHHHHCCCEE------ECCCC---HHHHHHH---HHHHHH-----HHCC-----CCCCCCC
Q ss_conf             87676323262899999999999889824------51488---9997766---887664-----3100-----0236655
Q gi|255764513|r   80 GAYGPYRQSERKNIYQPYVQNLLEKKLAF------RCFCS---TERLEEM---RRAQRK-----RNIP-----SRYDGHC  137 (492)
Q Consensus        80 g~~~p~~QS~r~~~y~~~~~~L~~~g~aY------~c~~t---~eel~~~---r~~~~~-----~~~~-----~~Y~~~~  137 (492)
                      |.+..|-  +++.  ....+.|-.-|.-|      -||-|   .+.+...   ++...+     .|..     ..|.-.|
T Consensus        97 G~~~Sya--eHf~--~~f~~~L~~~gi~~e~~s~te~Y~sG~f~~~i~~~l~~~~~I~~Il~~~~g~e~~~~y~P~~piC  172 (354)
T cd00674          97 GCHESYA--EHFN--APFEESLDRFGIEVEFISASEMYKSGLYDEQIKRALEKRDEIMEILNEYRGRELQETWYPYMPYC  172 (354)
T ss_pred             CCCCCHH--HHHH--HHHHHHHHHCCCEEEEEEHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEC
T ss_conf             7754599--9999--99999999849828998856602257627999999982899999999854755578647776405


Q ss_pred             CCCCHHHHHHHHHCCCCCEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             57883330011202577407886224311430475134021364323564100045324898678876444444431122
Q gi|255764513|r  138 LKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARG  217 (492)
Q Consensus       138 r~l~~~e~~~~~~~g~~~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg  217 (492)
                      .+..........-+.....|+++-+. +.-...|.-.|+.+.         -+|-| +|.       -=..++|+-=.=|
T Consensus       173 ~~cGk~~t~v~~~d~~~~~V~Y~c~c-G~~~~~~~~~g~gKL---------~WrvD-W~m-------RW~~lgVd~Ep~G  234 (354)
T cd00674         173 EKCGKDTTTVEEYDAEAETVRYRCEC-GHEGEVDIRGGGGKL---------QWRVD-WAM-------RWAALGVDFEPFG  234 (354)
T ss_pred             CCCCCCEEEEEEEECCCCEEEEECCC-CCEEEEECCCCCCEE---------EEEEC-CEE-------EEEECCEEEEECC
T ss_conf             88881167689994899979999599-988888437886203---------00103-514-------5534051588357


Q ss_pred             CCCCC---HHHHHHHHHH-HHHHCCCHHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHH
Q ss_conf             35430---2478899999-85100000101455531101322122343-3024566629773779989985
Q gi|255764513|r  218 EEWIS---SVPKHILLYQ-YFNFPIPEFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLAL  283 (492)
Q Consensus       218 ~d~~~---~t~~q~~l~~-al~~~~p~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLal  283 (492)
                      .||.+   |...-..|-+ .||+++|...---+++...|+|+||..|- +++.+..+.+ .||+ +.||..
T Consensus       235 KDh~~~GgS~d~~~~I~~~i~g~~pP~~~~YE~~~~kgg~KmSsSkGn~it~~e~L~~~-~pE~-lr~l~~  303 (354)
T cd00674         235 KDHASSGGSYDTSKEIAREIFGGEPPEGVMYEFIGLKGGGKMSSSKGNVITPRDWLEVA-PPES-LRFLYA  303 (354)
T ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHC-CHHH-HHHHHH
T ss_conf             42024675255789999997099999884169999069987224678612899999765-9999-999986


No 44 
>pfam00579 tRNA-synt_1b tRNA synthetases class I (W and Y).
Probab=98.53  E-value=1.8e-06  Score=64.20  Aligned_cols=184  Identities=22%  Similarity=0.260  Sum_probs=100.1

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECC-----CCCCCCC-------HHHHHHHHHHHHHCCCCCCC
Q ss_conf             05634843388785015999999999999718849999704-----8666388-------67999999998865898886
Q gi|255764513|r    7 VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIED-----TDSKRST-------LESENAVMQSLKWCGLNWDE   74 (492)
Q Consensus         7 v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieD-----td~~R~~-------~~~~~~i~~~l~wlgl~~De   74 (492)
                      |-+=|.|  ||.|||||+ .++.++..-...|-..++=|-|     .|+.+..       ....+++.+ .--+|++++.
T Consensus         8 vy~G~~P--Tg~lHlGhl-~~~~~~~~lq~~g~~~~~liad~~a~~~d~~~~~~~~~~~~~~~~~n~~~-~ia~g~d~~k   83 (291)
T pfam00579         8 VYTGFDP--TGPLHLGYL-VPLMKLVQFQQAGHEVFFLIGDLTAIIGDPSKSEERKLLSREEVLENAKA-QLACGLDPEK   83 (291)
T ss_pred             EEEEECC--CCHHHHHHH-HHHHHHHHHHHCCCCEEEEECCCEEECCCCCCCCHHHHHHHHHHHHHHHH-HHHCCCCCCC
T ss_conf             9973488--963077989-99999999997899099997383313349896357775148999999999-9984778221


Q ss_pred             CCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             76558876763232628999999999998898245148899977668876643100023665557883330011202577
Q gi|255764513|r   75 GPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKK  154 (492)
Q Consensus        75 ~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~  154 (492)
                      .       ..|.||+-.... +++..|..-+...       ++.                   |.++.+.+..+      
T Consensus        84 ~-------~i~~~s~~~~~~-~~~~~l~~~~~~~-------~v~-------------------~~~~~~~~~~r------  123 (291)
T pfam00579        84 S-------EIVNNSDWLEHL-ELAWLLRDLGNHF-------SLN-------------------RMLQFKDVKKR------  123 (291)
T ss_pred             E-------EEEECCCCCCCC-CHHHHHHHHHCCC-------HHH-------------------HHHHHHHHHHH------
T ss_conf             5-------999750156200-3999999873424-------476-------------------66404879876------


Q ss_pred             CEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             40788622431143047513402136432356410004532489867887644444443112235430247889999985
Q gi|255764513|r  155 HVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYF  234 (492)
Q Consensus       155 ~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al  234 (492)
                          +..+.  .+.     .|+...+.-.--|+..+                   ..+.|+=|.|-..|--.-..+-+.+
T Consensus       124 ----~~~~~--~~~-----~~~~~YP~lQa~D~~~l-------------------~~~i~~gG~DQ~~~~~l~rdl~~k~  173 (291)
T pfam00579       124 ----LKQNP--GIS-----LGEFTYPLLQAADILLL-------------------KADLQPGGSDQWGHIELGRDLARRF  173 (291)
T ss_pred             ----HCCCC--CCC-----HHHHCCHHHHHCCCHHC-------------------CCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             ----42578--876-----65501521763230001-------------------4675665600489999999999995


Q ss_pred             H---HCCCHHHHHHHHHHHHC-CCCCCCCCCCCH
Q ss_conf             1---00000101455531101-322122343302
Q gi|255764513|r  235 N---FPIPEFIHLPLIKNPDK-SKLSKRRNPTSI  264 (492)
Q Consensus       235 ~---~~~p~f~H~pli~~~~g-~klSKR~~~~~i  264 (492)
                      |   +..|.-.|.|++.+.+| +|+||..+...|
T Consensus       174 ~~~~~~~p~~l~~~ll~~~~G~~KMSKS~~nsaI  207 (291)
T pfam00579       174 NKKVFKKPVGLTNPLLTGLDGGKKMSKSAGNSAI  207 (291)
T ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEE
T ss_conf             7856788348741662266787663678999726


No 45 
>pfam01921 tRNA-synt_1f tRNA synthetases class I (K). This family includes only lysyl tRNA synthetases from prokaryotes.
Probab=98.39  E-value=5.8e-06  Score=60.82  Aligned_cols=257  Identities=18%  Similarity=0.199  Sum_probs=127.0

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHH-----HCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             705634843388785015999999999999-----718849999704866638867999999998865898886765588
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAK-----RTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGG   80 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~-----~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g   80 (492)
                      +++.-=.=||+|..||||+|-.+-.++.+|     -..-+||.=.||.|.=|-++..+..--.-=+.+|.---.-|+-.|
T Consensus        20 ~~v~~tG~~PSG~~HIGnfrEv~~~~~V~~al~~~g~~~~~i~~~DD~D~lRKVP~nlp~~e~~~~ylg~Pl~~IPdP~g   99 (355)
T pfam01921        20 EILVETGIGPSGLPHIGNFREVLRTDAVRRALRKRGFETRLIYFSDDMDGLRKVPDNVPNSEMLEKYLGKPLTRIPDPFG   99 (355)
T ss_pred             CEEEECCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCHHHHHHCCCCCCEECCCCCC
T ss_conf             58995266899886421560179999999999974987699998215651013788999989998736975213479888


Q ss_pred             CCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHH-----------------HHHHHHHHH-HHHCC--C---CCCCCC
Q ss_conf             767632326289999999999988982451488999-----------------776688766-43100--0---236655
Q gi|255764513|r   81 AYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTER-----------------LEEMRRAQR-KRNIP--S---RYDGHC  137 (492)
Q Consensus        81 ~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~ee-----------------l~~~r~~~~-~~~~~--~---~Y~~~~  137 (492)
                      .+..|- -+....+   .+.|-.-|.-|. |-+..|                 -++.++... ..|..  .   .|.-.|
T Consensus       100 ~~~Sya-~h~~~~~---~~~L~~~gi~~e-f~s~te~Y~sG~~~~~i~~~l~~~~~I~~Il~~~~g~e~~~~y~Pf~piC  174 (355)
T pfam01921       100 CHESYA-EHFNAPF---LEFLDRFGIEYE-FISATELYKSGLYDEAILIALENRDEIMEILLPYRGEERQETYSPFLPIC  174 (355)
T ss_pred             CCCCHH-HHHHHHH---HHHHHHCCCEEE-EEEHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEC
T ss_conf             745599-9999999---999998398289-98678855246559999999985899999999852866688736898885


Q ss_pred             CCCCHHHHHHHHHCCCCCEEEEEECCCCEEECCCC--CCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             57883330011202577407886224311430475--1340213643235641000453248986788764444444311
Q gi|255764513|r  138 LKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDK--VYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVA  215 (492)
Q Consensus       138 r~l~~~e~~~~~~~g~~~~iR~k~p~~~~~~~~D~--i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithvi  215 (492)
                      .+..+-        ....|+.+-. ..++|.|.+.  -.|++.+....  -..-+|-| +|.=       =..++|+-=-
T Consensus       175 ~~cGrv--------~~t~v~~~d~-~~~~v~Y~c~cG~~~~~~~~~g~--~KL~WkvD-W~mR-------W~~lgVdfEp  235 (355)
T pfam01921       175 PKCGRV--------LTTPVVEYDA-EGGTITYRCECGHEGEVDITGGN--GKLQWKVD-WAMR-------WAALGVDFEP  235 (355)
T ss_pred             CCCCCE--------EEEEEEEEEC-CCCEEEEECCCCCEEEEEECCCC--CCCCCCCC-CHHE-------EEEECCEEEC
T ss_conf             888937--------2568999967-89879998699988998411576--66787566-3330-------5785634862


Q ss_pred             CCCCCCC---HHHHHHHHH-HHHHHCCCHHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCC
Q ss_conf             2235430---247889999-985100000101455531101322122343-3024566629773779989985067666
Q gi|255764513|r  216 RGEEWIS---SVPKHILLY-QYFNFPIPEFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKS  289 (492)
Q Consensus       216 Rg~d~~~---~t~~q~~l~-~al~~~~p~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~  289 (492)
                      =|.||.+   |...-..|- +.||+++|....--+++...|+|+||..|- +++.+.-+-+ .|| ++.|+.. ...|.
T Consensus       236 ~GKDh~~~GGS~~~~~~I~~~i~g~~pP~~~~YE~~~~kgg~KmSsSkGn~is~~e~L~~~-~pE-~Lr~l~~-~~~P~  311 (355)
T pfam01921       236 FGKDHAAPGGSYDTSSRIAREILGGEPPEPFPYELILLKGGGKMSSSKGNGITIEEWLEYA-PPE-SLRFLMF-RVKPK  311 (355)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHC-CHH-HHHHHHC-CCCCC
T ss_conf             5743246787622289999997099999988657899669971046889876999999866-999-9999980-42888


No 46 
>PRK12283 tryptophanyl-tRNA synthetase; Reviewed
Probab=98.37  E-value=5.6e-05  Score=54.11  Aligned_cols=91  Identities=15%  Similarity=0.147  Sum_probs=60.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCC----CCCCC---CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEE
Q ss_conf             33887850159999999999997188499997048----66638---867999999998865898886765588767632
Q gi|255764513|r   14 SPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDT----DSKRS---TLESENAVMQSLKWCGLNWDEGPDIGGAYGPYR   86 (492)
Q Consensus        14 sPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDt----d~~R~---~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~~   86 (492)
                      -|||.|||||--.|+-||..-. +++..+.=|=|.    ..-..   ..+....+..++--+|||++...       .|+
T Consensus        10 qPTG~lHLGNylGai~~~v~lQ-~~~~~~~~IaDlHAlT~~~~~p~~l~~~~~~~~a~~LA~GlDP~ks~-------if~   81 (398)
T PRK12283         10 RPTGRLHLGHYHGVLKNWVKLQ-HEYPCFFFVADWHALTTHYETPEVIEKNVWDMVIDWLAAGVDPAQAT-------LFI   81 (398)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHH-HCCCEEEEEECHHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCE-------EEE
T ss_conf             7899861688999999999986-03770899953655207878999999999999999997588813075-------886


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHH
Q ss_conf             3262899999999999889824514889997766
Q gi|255764513|r   87 QSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM  120 (492)
Q Consensus        87 QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~  120 (492)
                      ||+--+ +.+.       ....-|.|+--+|+.+
T Consensus        82 QS~Vpe-h~eL-------~wiL~~~~~~g~L~Rm  107 (398)
T PRK12283         82 QSKVPE-HAEL-------HLLLSMITPLGWLERV  107 (398)
T ss_pred             CCCCHH-HHHH-------HHHHCCCCCHHHHHHC
T ss_conf             788689-9999-------9997277877998726


No 47 
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) . This enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  ValRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
Probab=98.31  E-value=4.2e-06  Score=61.74  Aligned_cols=96  Identities=28%  Similarity=0.270  Sum_probs=61.8

Q ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEEECCCCCC--------------------------------CCC
Q ss_conf             6348433887850159999999999997--188499997048666--------------------------------388
Q gi|255764513|r    9 VRIAPSPTGEPHIGTAYTALFNYLIAKR--TGGKFILRIEDTDSK--------------------------------RST   54 (492)
Q Consensus         9 ~RfaPsPtG~lH~G~~rtal~n~l~a~~--~~g~f~lRieDtd~~--------------------------------R~~   54 (492)
                      |-=-|=++|.+|||||+|.+..-.+||=  ..|.=++.+--||.-                                ...
T Consensus         6 tTpipYaNG~~HiGHa~~~i~aDv~aRy~rm~G~~V~f~~G~DeHGlpie~~~ek~~~~~~~~~~~~~~~~f~~~~~~~~   85 (363)
T cd00817           6 DTPPPNVTGSLHIGHALTNTIQDIIARYKRMKGYNVLWPPGTDHAGIATQVVVEKKLGIEGKTRHDLGREEFLEKCWEWK   85 (363)
T ss_pred             ECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHCCHHHHHHHHHHHH
T ss_conf             48999888861352789899999999999816997788784575668999999998360566500079899999999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEECCC--CHHHHHHHHHHHHHCCCEEECC
Q ss_conf             67999999998865898886765588767632326--2899999999999889824514
Q gi|255764513|r   55 LESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSE--RKNIYQPYVQNLLEKKLAFRCF  111 (492)
Q Consensus        55 ~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~~QS~--r~~~y~~~~~~L~~~g~aY~c~  111 (492)
                      .++.+.+.+.++-||+..|-.       ..|+-|+  ..+.=++...+|.++|..|...
T Consensus        86 ~~~~~~~~~~~~~lg~~~D~~-------~~~rT~d~~h~~~vq~~f~~l~~~G~iY~~~  137 (363)
T cd00817          86 EESGGKIREQLKRLGASVDWS-------REYFTMDPGLSKAVQEAFVRLYEKGLIYRAN  137 (363)
T ss_pred             HHHHHHHHHHHHHHCHHCCCC-------CCEECCCHHHHHHHHHHHHHHHHCCCEECCC
T ss_conf             999999999999833011657-------5034377679999999999999888976368


No 48 
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=98.28  E-value=2.6e-05  Score=56.37  Aligned_cols=199  Identities=21%  Similarity=0.273  Sum_probs=120.5

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECC----CCCCCC----CHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             843388785015999999999999718849999704----866638----867999999998865898886765588767
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIED----TDSKRS----TLESENAVMQSLKWCGLNWDEGPDIGGAYG   83 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieD----td~~R~----~~~~~~~i~~~l~wlgl~~De~~~~~g~~~   83 (492)
                      .=-|||.|||||--.|+.||......+...+.=|-|    |.....    ...+...++.+.--+|||++-.       -
T Consensus        11 G~~PSG~lHLGny~ga~~~~v~~q~~~~~~f~~IaDlha~t~~~~~~~~~l~~~~~e~~a~~LA~GiDP~k~-------~   83 (314)
T COG0180          11 GIQPSGKLHLGNYLGAIRNWVLLQEEYYECFFFIADLHAITVRQDPTEEDLRQATREVAADYLAVGLDPEKS-------T   83 (314)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCC-------E
T ss_conf             678899752157699999999985355754999962777554888769999999999999998704685602-------7


Q ss_pred             CEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             63232628999999999998898245148899977668876643100023665557883330011202577407886224
Q gi|255764513|r   84 PYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPN  163 (492)
Q Consensus        84 p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~  163 (492)
                      .|.||+..+.|. .+-       .+-|..+--||+.+          +.|.....           ..+.          
T Consensus        84 if~QS~v~e~~e-La~-------~l~~~~~~gel~r~----------~~fKdk~~-----------~~~~----------  124 (314)
T COG0180          84 IFLQSEVPEHAE-LAW-------LLSCVTNFGELERM----------TQFKDKSA-----------KKGE----------  124 (314)
T ss_pred             EEECCCCHHHHH-HHH-------HHHCCCCHHHHHHH----------CCCCHHHH-----------CCCC----------
T ss_conf             998068667999-999-------99861759999852----------37643332-----------3435----------


Q ss_pred             CCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH------HC
Q ss_conf             311430475134021364323564100045324898678876444444431122354302478899999851------00
Q gi|255764513|r  164 QGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN------FP  237 (492)
Q Consensus       164 ~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~------~~  237 (492)
                                    .+...-+.=+||+=+|=            -+.+-++|==|+|-.+-.-...-|-+.||      +.
T Consensus       125 --------------~~~~Gl~~YPvlqAADI------------Ll~~a~~VPVG~DQ~qHleLtRDiA~rfn~~y~~~f~  178 (314)
T COG0180         125 --------------SIPIGLLTYPVLQAADI------------LLYQATLVPVGEDQDQHLELTRDIARRFNHLYGEVFP  178 (314)
T ss_pred             --------------CCCCCCHHCCHHHHHHH------------HHCCCCEECCCCCCHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             --------------66410210549988876------------5026875104888539999999999998744667537


Q ss_pred             CCHHHHHH--HHHHHHC-CCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCC
Q ss_conf             00010145--5531101-3221223433024566629773779989985067
Q gi|255764513|r  238 IPEFIHLP--LIKNPDK-SKLSKRRNPTSISYYSAMGYLPEALINFLALLFV  286 (492)
Q Consensus       238 ~p~f~H~p--li~~~~g-~klSKR~~~~~i~~~~~~GylPeAilNyLalLGw  286 (492)
                      .|+-.+.-  .|++-+| +||||-++...| .+-+   .|+.+..-+...-.
T Consensus       179 ~P~~~~~~~~~i~gL~g~~KMSkS~~ns~I-~L~D---~~~~i~kKI~~~~t  226 (314)
T COG0180         179 LPEALISKVARLPGLDGPGKMSKSDPNSAI-FLLD---DPKTIRKKIKKAAT  226 (314)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCEE-ECCC---CHHHHHHHHHHHCC
T ss_conf             860014477746478999866666999824-5049---98999999998526


No 49 
>cd00806 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalytic core domain. TrpRS is a homodimer, which attaches Tyr to the appropriate tRNA. TrpRS is a class I tRNA synthetases, so it aminoacylates the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains class I characteristic HIGH and KMSKS motifs, which are involved in ATP binding
Probab=98.18  E-value=2.4e-05  Score=56.59  Aligned_cols=199  Identities=22%  Similarity=0.277  Sum_probs=109.3

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECC----CCCC---CCCHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             05634843388785015999999999999718849999704----8666---3886799999999886589888676558
Q gi|255764513|r    7 VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIED----TDSK---RSTLESENAVMQSLKWCGLNWDEGPDIG   79 (492)
Q Consensus         7 v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieD----td~~---R~~~~~~~~i~~~l~wlgl~~De~~~~~   79 (492)
                      |-|=|.|  ||.+||||.-.++.+|.+-+. |...++=|=|    |+..   ....+.....+.++--+|++++...   
T Consensus         3 v~tG~~P--TG~~HlG~~v~~~k~~~~~~~-g~~~~i~iaD~ha~t~~~~~~~~~~~~~~~~~~~~lA~G~Dp~k~~---   76 (282)
T cd00806           3 VLSGIQP--SGSLHLGHYLGAIRNWVLQQE-GYELFFFIADLHALTVKQSDPEELRQNTRENAADYLACGLDPEKST---   76 (282)
T ss_pred             EEECCCC--CCCCHHHHHHHHHHHHHHHHC-CCCEEEEEECHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCHHHEE---
T ss_conf             5757798--971478889999999999978-9919999804388867999999999999999999999198888908---


Q ss_pred             CCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEE
Q ss_conf             87676323262899999999999889824514889997766887664310002366555788333001120257740788
Q gi|255764513|r   80 GAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRL  159 (492)
Q Consensus        80 g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~  159 (492)
                          .|+||+..+.|.-+. .|       -|.+|-.++...          +.|..+-           ...+.      
T Consensus        77 ----i~~qS~~~~~~el~~-~l-------~~~~t~~~l~r~----------~~~k~~~-----------~~~~~------  117 (282)
T cd00806          77 ----IFFQSDVPEHYELAW-LL-------SCVVTFGELERM----------TGFKDKS-----------NKQKL------  117 (282)
T ss_pred             ----EEEECCCHHHHHHHH-HH-------HHHCCHHHHHHC----------CHHHHHH-----------HHCCC------
T ss_conf             ----998374278999999-99-------843219999732----------1023456-----------52257------


Q ss_pred             EECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH---
Q ss_conf             62243114304751340213643235641000453248986788764444444311223543024788999998510---
Q gi|255764513|r  160 TVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNF---  236 (492)
Q Consensus       160 k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~---  236 (492)
                                           +..+         |.-+|-.-=+.|=...+.++|.=|.|-..+--.-..|.+-||+   
T Consensus       118 ---------------------~~~~---------g~~~YP~lQaaDil~~~~d~vp~G~DQ~~h~~laRdia~k~n~~~~  167 (282)
T cd00806         118 ---------------------SIPI---------GLLTYPVLQAADILLYQADLVPVGEDQDPHLELTRDIARRFNKLYG  167 (282)
T ss_pred             ---------------------CCCC---------HHHHCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             ---------------------8762---------5340539888784662565052220479999999999999865506


Q ss_pred             ---CCCHHHHH--HHHHHH-HC-CCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHC
Q ss_conf             ---00001014--555311-01-32212234330245666297737799899850
Q gi|255764513|r  237 ---PIPEFIHL--PLIKNP-DK-SKLSKRRNPTSISYYSAMGYLPEALINFLALL  284 (492)
Q Consensus       237 ---~~p~f~H~--pli~~~-~g-~klSKR~~~~~i~~~~~~GylPeAilNyLalL  284 (492)
                         ..|.-.|.  ++|++- +| +||||.++...|.=.    =.|+.|.+-+..-
T Consensus       168 ~~~~~P~~~~~~~~~i~~l~~g~~KMSKS~~ns~I~l~----D~p~~I~kKI~ka  218 (282)
T cd00806         168 EIFPKPEALISKGARIPSLTGPSKKMSKSDPNTIIFLL----DSPKTIKKKIMKA  218 (282)
T ss_pred             CCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCEEEC----CCHHHHHHHHEEE
T ss_conf             53466411015555166788976755568999744541----7689999751262


No 50 
>PRK00927 tryptophanyl-tRNA synthetase; Reviewed
Probab=98.10  E-value=3.6e-05  Score=55.40  Aligned_cols=180  Identities=23%  Similarity=0.272  Sum_probs=95.1

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCC----CC--CCCCHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             056348433887850159999999999997188499997048----66--638867999999998865898886765588
Q gi|255764513|r    7 VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDT----DS--KRSTLESENAVMQSLKWCGLNWDEGPDIGG   80 (492)
Q Consensus         7 v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDt----d~--~R~~~~~~~~i~~~l~wlgl~~De~~~~~g   80 (492)
                      |-|-+-  |||.+||||.-.|+-||..-.+....|++ |-|-    +.  .....+....+..++--+|||++...    
T Consensus         3 i~tGi~--PtG~~HlGny~g~i~~~~~lq~~~~~~~~-iaD~halt~~~~~~~l~~~~~~~~~~~lA~GlDp~k~~----   75 (325)
T PRK00927          3 VLSGIQ--PTGKLHLGNYLGAIKNWVELQDDYECFFC-IADLHAITVPQDPKELRENTRELAADYLACGIDPEKST----   75 (325)
T ss_pred             CEECCC--CCCCCHHHHHHHHHHHHHHHHHCCCEEEE-EECHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCE----
T ss_conf             652748--89825488799999999998602764999-85687864688899999999999999997297810087----


Q ss_pred             CCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEE
Q ss_conf             76763232628999999999998898245148899977668876643100023665557883330011202577407886
Q gi|255764513|r   81 AYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLT  160 (492)
Q Consensus        81 ~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k  160 (492)
                         -|+||+--+.+.=+        ..+-|+++-.+|...-                                       
T Consensus        76 ---~f~QS~v~~~~eL~--------~~l~~~~~~~~l~r~~---------------------------------------  105 (325)
T PRK00927         76 ---IFVQSHVPEHAELA--------WILNCITPLGELERMT---------------------------------------  105 (325)
T ss_pred             ---EEECCCCHHHHHHH--------HHHHCCCCHHHHHCCC---------------------------------------
T ss_conf             ---98778970688999--------9998338578776113---------------------------------------


Q ss_pred             ECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH-----
Q ss_conf             224311430475134021364323564100045324898678876444444431122354302478899999851-----
Q gi|255764513|r  161 VPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN-----  235 (492)
Q Consensus       161 ~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~-----  235 (492)
                             .|+|.+...  .++..+         |..+|-.--+-|=.+.+-|||-=|+|-..-.-.-.-|-..||     
T Consensus       106 -------~~k~k~~~~--~~~~~~---------gl~~YP~lqaADIl~~~a~~VPvG~DQ~~h~el~rdia~~fN~~yg~  167 (325)
T PRK00927        106 -------QFKDKSAKN--AENISA---------GLFGYPVLMAADILLYKADLVPVGEDQKQHLELTRDIARRFNNLYGE  167 (325)
T ss_pred             -------CHHHHHHCC--CCCCCC---------HHHCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             -------467675036--777650---------11207298988888627871543421499999999999999987140


Q ss_pred             -HCCCH--HH-HHHHHHHH--HCCCCCCCCCC
Q ss_conf             -00000--10-14555311--01322122343
Q gi|255764513|r  236 -FPIPE--FI-HLPLIKNP--DKSKLSKRRNP  261 (492)
Q Consensus       236 -~~~p~--f~-H~pli~~~--~g~klSKR~~~  261 (492)
                       ++.|+  +. +.+.|++-  +++||||-++.
T Consensus       168 ~f~~P~~~~~~~~~~i~~L~~~~~KMSKS~~n  199 (325)
T PRK00927        168 VFPVPEPLIPKVGARVMSLQDPTKKMSKSDGN  199 (325)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             52677550077766067898955101446799


No 51 
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) . This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  IleRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
Probab=98.06  E-value=2.1e-05  Score=57.05  Aligned_cols=254  Identities=19%  Similarity=0.237  Sum_probs=114.6

Q ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEEECCCCC-----------C----------------------CC
Q ss_conf             6348433887850159999999999997--18849999704866-----------6----------------------38
Q gi|255764513|r    9 VRIAPSPTGEPHIGTAYTALFNYLIAKR--TGGKFILRIEDTDS-----------K----------------------RS   53 (492)
Q Consensus         9 ~RfaPsPtG~lH~G~~rtal~n~l~a~~--~~g~f~lRieDtd~-----------~----------------------R~   53 (492)
                      +-=.|-++|.+|||||+|.+..-.+||-  ..|.=++-+=-||.           +                      ..
T Consensus         6 ~~~pPYaNg~pHiGHa~~~i~aDv~aRy~Rl~G~~v~f~~GtDeHG~pIe~~a~k~~~~~~~~~~~~~~~~~f~~~~~~~   85 (339)
T cd00818           6 HDGPPYANGLPHYGHALNKILKDIINRYKTMQGYYVPRRPGWDCHGLPIELKVEKELGISGKKDIEKMGIAEFRAKCREF   85 (339)
T ss_pred             ECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHCCHHHHHHHHHHH
T ss_conf             58998857873455889999999999999806998877885144039999999996489873047655999999999999


Q ss_pred             CHHHHHHHHHHHHHCCC--CCCCCCCCCCCCCCEE-CCC-CHHHHHHHHHHHHHCCCEEECCCC---------HH----H
Q ss_conf             86799999999886589--8886765588767632-326-289999999999988982451488---------99----9
Q gi|255764513|r   54 TLESENAVMQSLKWCGL--NWDEGPDIGGAYGPYR-QSE-RKNIYQPYVQNLLEKKLAFRCFCS---------TE----R  116 (492)
Q Consensus        54 ~~~~~~~i~~~l~wlgl--~~De~~~~~g~~~p~~-QS~-r~~~y~~~~~~L~~~g~aY~c~~t---------~e----e  116 (492)
                      ...+.+...+.+.-+|+  +|+.         +|+ .++ ..+.-+....+|.++|++|+..|-         .+    +
T Consensus        86 ~~~~~~~~~~~~~~~g~~~d~~~---------~~~T~~~~~~~~~~~~f~~l~~~G~iy~~~~~~~~p~~~~~~~~~F~~  156 (339)
T cd00818          86 ALRYIDEQEETFQRLGVWVDWEN---------PYKTMDPEYMESVWWVFKQLYEKGLLYRGYKVVPWPLIYRATPQWFIR  156 (339)
T ss_pred             HHHHHHHHHHHHHHHCHHCCCCC---------CEECCCHHHHHHHHHHHHHHHHCCCEECCCEEECCCCCCEECCCEEEE
T ss_conf             99999999999998373514777---------712168899999999999999888862676053687600581567998


Q ss_pred             HHHHHHHHHHHHCCC-CCCCCCCCCCHHHHHHHHHCCC-------CCEEEEEECCCCEEECCCCCCCCEECC--CCCCCC
Q ss_conf             776688766431000-2366555788333001120257-------740788622431143047513402136--432356
Q gi|255764513|r  117 LEEMRRAQRKRNIPS-RYDGHCLKLSSQEIERLSQEQK-------KHVVRLTVPNQGSCVFQDKVYGEMEIP--WNAVDM  186 (492)
Q Consensus       117 l~~~r~~~~~~~~~~-~Y~~~~r~l~~~e~~~~~~~g~-------~~~iR~k~p~~~~~~~~D~i~G~~~~~--~~~~~D  186 (492)
                      +...++......... .++..-++   .....-+ +|.       .-.|=+.+|     .|.|.-.|++...  .+.++ 
T Consensus       157 l~~~~~~ll~~~~~~~~~p~~~~~---~~l~~~~-~~l~Dw~ISR~~~WGipvP-----~w~~~~~~~~~~~~~~dv~y-  226 (339)
T cd00818         157 VEKLKDRLLEANDKVNWIPEWVKE---GRFGNWL-ENRRDWCISRQRYWGTPIP-----VWYSEDCGEVLVRRVPDVLD-  226 (339)
T ss_pred             CHHHHHHHHHHHHCCCEECCHHHH---HHHHHHH-HCCCCCEEEECCCCCCCCC-----EEECCCCCCCCCCCCCCHHH-
T ss_conf             689999999877538737861066---4999997-1685650440266675346-----35648998321003650177-


Q ss_pred             CCEECCCCCHHHHHHHHH-H----HHHHHHHHHHCCCCCCCHHHHHHHHHHHHH--HCCC--HHHHHHHHHHHHCCCCCC
Q ss_conf             410004532489867887-6----444444431122354302478899999851--0000--010145553110132212
Q gi|255764513|r  187 QVLLKSDGMPTYHLANVI-D----DHLMKITHVARGEEWISSVPKHILLYQYFN--FPIP--EFIHLPLIKNPDKSKLSK  257 (492)
Q Consensus       187 ~vi~r~dg~ptY~~a~vv-D----D~~m~ithviRg~d~~~~t~~q~~l~~al~--~~~p--~f~H~pli~~~~g~klSK  257 (492)
                       |=+-| +..-+.....- +    +..--+.-++-|.|.+..- -|-.+..+..  -.+|  ....+..+++.+|+||||
T Consensus       227 -VWfDa-~~~~~~~~~~~~~~~~~~~~~p~~~~~~GkDi~~~~-f~~~~~~~~~~~~~~P~~~v~~hg~~l~~~G~KMSK  303 (339)
T cd00818         227 -VWFDS-GSMPYAQLHYPFENEDFEELFPADFILEGSDQTRGW-FYSLLLLSTALFGKAPYKNVIVHGFVLDEDGRKMSK  303 (339)
T ss_pred             -HHHHC-CCCHHHHCCCCCCCHHHHCCCCCEEEEECCCCCCHH-HHHHHHHHHHHCCCCCCCEEEECCEEECCCCCCCCC
T ss_conf             -77635-624898728986431341387660566063312337-999999878854899852148898499999866278


Q ss_pred             CCCC-CCHHHHHHCCCCHHHHHHHHHHCC
Q ss_conf             2343-302456662977377998998506
Q gi|255764513|r  258 RRNP-TSISYYSAMGYLPEALINFLALLF  285 (492)
Q Consensus       258 R~~~-~~i~~~~~~GylPeAilNyLalLG  285 (492)
                      ..|- +...++.+. |-++|+.=||++-+
T Consensus       304 S~GnvI~p~~~l~~-y~~D~lRyyl~~~~  331 (339)
T cd00818         304 SLGNVVDPQEVIDK-YGADALRLWVASSD  331 (339)
T ss_pred             CCCCCCCHHHHHHH-CCCHHHHHHHHHCC
T ss_conf             89987898999987-69479999999168


No 52 
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed
Probab=98.06  E-value=3.3e-05  Score=55.66  Aligned_cols=185  Identities=21%  Similarity=0.322  Sum_probs=105.0

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHH-HHCCCEEEEEECCCCC---CCCCHHHHHHHHH-HHHHC--CCCCCCCCCCCCCCCCE
Q ss_conf             4338878501599999999999-9718849999704866---6388679999999-98865--89888676558876763
Q gi|255764513|r   13 PSPTGEPHIGTAYTALFNYLIA-KRTGGKFILRIEDTDS---KRSTLESENAVMQ-SLKWC--GLNWDEGPDIGGAYGPY   85 (492)
Q Consensus        13 PsPtG~lH~G~~rtal~n~l~a-~~~~g~f~lRieDtd~---~R~~~~~~~~i~~-~l~wl--gl~~De~~~~~g~~~p~   85 (492)
                      =-|||.|||||--.|+-||+-+ .+.+...+.=|-|.-.   ....+.-.+++++ ...||  |||++...       -|
T Consensus         9 IqPTG~lHLGNY~GAik~~v~~~~q~~~e~f~fIAD~HALT~~~dp~~l~~~t~eiaa~~LA~GlDPekst-------~f   81 (436)
T PRK12284          9 ITTTGTPHLGNYVGAIRPAIAASRQPGVESFYFLADYHALIKCDDPARIQRSTLEIAATWLAAGLDPERVT-------FY   81 (436)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCE-------EE
T ss_conf             48899752888999999999986389986699996400056889999999999999999998586802225-------88


Q ss_pred             ECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             23262899999999999889824514889997766887664310002366555788333001120257740788622431
Q gi|255764513|r   86 RQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQG  165 (492)
Q Consensus        86 ~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~  165 (492)
                      +||+=-++.. .       ...+-|+++.-.|+..-          .|-        +.+++....|..           
T Consensus        82 ~QS~VPE~~E-L-------~wiLs~~t~~g~L~R~~----------~yK--------~~~dkn~~~g~d-----------  124 (436)
T PRK12284         82 RQSDIPEIPE-L-------TWLLTCVAGKGLLNRAH----------AYK--------AAVDKNVAAGED-----------  124 (436)
T ss_pred             ECCCCHHHHH-H-------HHHHHCCCCHHHHHHHC----------CHH--------HHHHHHHHHCCC-----------
T ss_conf             7888779999-9-------99997638488875103----------021--------176777762657-----------


Q ss_pred             EEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH----H---HCC
Q ss_conf             143047513402136432356410004532489867887644444443112235430247889999985----1---000
Q gi|255764513|r  166 SCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYF----N---FPI  238 (492)
Q Consensus       166 ~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al----~---~~~  238 (492)
                                        .++-|   +=|..+|-.--+-|=.+.+-+||==|+|-+...-.-.-|-+-|    |   +..
T Consensus       125 ------------------~d~~v---~~GLf~YPVLMAADILly~A~~VPVG~DQ~QHlEltRdIA~rFN~~YG~e~F~~  183 (436)
T PRK12284        125 ------------------PDAGV---TAGLFMYPVLMAADILMFNAHKVPVGRDQIQHIEMARDIAQRFNHLYGGEFFVL  183 (436)
T ss_pred             ------------------CCCCC---CCCCCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             ------------------54454---431224707888767740687512675569999999999999998708836378


Q ss_pred             CH--HH-HHHHHHHHHCCCCCCCCCCC
Q ss_conf             00--10-14555311013221223433
Q gi|255764513|r  239 PE--FI-HLPLIKNPDKSKLSKRRNPT  262 (492)
Q Consensus       239 p~--f~-H~pli~~~~g~klSKR~~~~  262 (492)
                      |+  .- ..+.|.+-||+||||..+.+
T Consensus       184 Pea~i~e~~a~lpGlDGrKMSKSy~Nt  210 (436)
T PRK12284        184 PEAVIEESVATLPGLDGRKMSKSYDNT  210 (436)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             844236887722499987055788980


No 53 
>PRK12556 tryptophanyl-tRNA synthetase; Provisional
Probab=97.90  E-value=4.9e-05  Score=54.49  Aligned_cols=184  Identities=25%  Similarity=0.351  Sum_probs=101.2

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHH-HHHCCCEEEEEECCCCC---CCCC---HHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             8433887850159999999999-99718849999704866---6388---679999999988658988867655887676
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLI-AKRTGGKFILRIEDTDS---KRST---LESENAVMQSLKWCGLNWDEGPDIGGAYGP   84 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~-a~~~~g~f~lRieDtd~---~R~~---~~~~~~i~~~l~wlgl~~De~~~~~g~~~p   84 (492)
                      .=-|||.|||||--.|+=||+- +.+.+...+.=|=|.-.   ....   .+....+..++--+|||++ ..       -
T Consensus         9 GiqPTG~lHLGNYlGaik~~v~l~~~~~~~~~~~IaDlHalT~~~dp~~l~~~~~~~~a~~LA~GlDP~-~~-------~   80 (328)
T PRK12556          9 GIKPTGYPHLGNYIGAIKPALQMSKNNEGKALYFIADYHALNAVHDPEQFSSYTKEVAATWLSLGLGED-VI-------F   80 (328)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCC-EE-------E
T ss_conf             779899750888999999999975479987799985142235889999999999999999997589987-49-------9


Q ss_pred             EECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             32326289999999999988982451488999776688766431000236655578833300112025774078862243
Q gi|255764513|r   85 YRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQ  164 (492)
Q Consensus        85 ~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~  164 (492)
                      |.||+--++.        +-...+-|+++--+|+.+-  |        |-.+        +......|..          
T Consensus        81 f~QS~Vpeh~--------eL~wil~~~~~~g~L~Rm~--q--------~K~k--------~~~~~~~~~~----------  124 (328)
T PRK12556         81 YRQTEVPEIL--------ELAWILACLTPKGLMNRAH--A--------YKAK--------VEQNKEAGLE----------  124 (328)
T ss_pred             EECCCCHHHH--------HHHHHHHCCCCHHHHHHCC--C--------CCHH--------HHHHHHCCCC----------
T ss_conf             9878973999--------9999997768388885153--2--------3005--------5654540357----------


Q ss_pred             CEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH------HCC
Q ss_conf             11430475134021364323564100045324898678876444444431122354302478899999851------000
Q gi|255764513|r  165 GSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN------FPI  238 (492)
Q Consensus       165 ~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~------~~~  238 (492)
                                ++-.+            +=|..||=.--+-|=.+.+-|||-=|+|-..-.-.-..|-+-||      +..
T Consensus       125 ----------~~~~i------------~~GL~~YPvLmAADILly~a~~VPVGeDQ~QHlEltRdiA~rFN~~yg~~f~~  182 (328)
T PRK12556        125 ----------VDAGV------------NMGLYTYPILMAADILLFQATHVPVGKDQIQHIEIARDIATYFNHTFGTTFTL  182 (328)
T ss_pred             ----------CCCCC------------CCCCCCCCHHHHCHHHHCCCCEECCCCCHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             ----------55565------------55456650765331130266450468106999999999999998755755678


Q ss_pred             CHHH---HHHHHHHHHCCCCCCCCCC
Q ss_conf             0010---1455531101322122343
Q gi|255764513|r  239 PEFI---HLPLIKNPDKSKLSKRRNP  261 (492)
Q Consensus       239 p~f~---H~pli~~~~g~klSKR~~~  261 (492)
                      |+..   +.+.|.+-||+||||-.+.
T Consensus       183 P~~~i~~~~~~i~gldgkKMSKS~~n  208 (328)
T PRK12556        183 PEYVIQEEGAILPGLDGRKMSKSYGN  208 (328)
T ss_pred             CCCCCCCCCCEEECCCCCCCCCCCCC
T ss_conf             64333765433108998765568788


No 54 
>PRK08560 tyrosyl-tRNA synthetase; Validated
Probab=97.90  E-value=7.9e-05  Score=53.12  Aligned_cols=182  Identities=17%  Similarity=0.177  Sum_probs=90.9

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCC--CC-----CCHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             705634843388785015999999999999718849999704866--63-----88679999999988658988867655
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDS--KR-----STLESENAVMQSLKWCGLNWDEGPDI   78 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~--~R-----~~~~~~~~i~~~l~wlgl~~De~~~~   78 (492)
                      +.|+=-.=-|||.|||||.-++ .+|..-.+.|.+.++=|-|--.  .+     ...+....+..++.-+|+++|..   
T Consensus        30 ~~rv~~G~~PTG~lHLGh~v~~-~k~~~lQd~g~~~~~~IaD~hA~i~~~~~~~~~r~~~~~~~~~~~A~GlDp~k~---  105 (333)
T PRK08560         30 EPKAYIGFEPSGFIHLGHLVTM-NKLADLQKAGFKVTVLLADWHAWLNDKGDLEEIRKVAEYNKKVFEALGLDPDKT---  105 (333)
T ss_pred             CCEEEECCCCCCCCHHHHHHHH-HHHHHHHHCCCCEEEEECCCEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCE---
T ss_conf             9889966178984538999999-999999977991899961322333899999999999999999999707896423---


Q ss_pred             CCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEE
Q ss_conf             88767632326289999999999988982451488999776688766431000236655578833300112025774078
Q gi|255764513|r   79 GGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVR  158 (492)
Q Consensus        79 ~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR  158 (492)
                          .-|+||+- ..+.++...+.       |.++.-.+..++.....                  ..+  ..+.+    
T Consensus       106 ----~i~~qS~~-~~~~e~~~~~~-------~l~~~~tl~r~~~~~~~------------------~~~--~~~~~----  149 (333)
T PRK08560        106 ----EFVLGSEF-QLDPEYWLLVL-------KLAKNTTLARARRSMTI------------------MGR--KMEEP----  149 (333)
T ss_pred             ----EEEECCCC-CCCHHHHHHHH-------HHHCCCCHHHHHHHHHH------------------HHH--CCCCC----
T ss_conf             ----99989862-46756999999-------98064739999887888------------------755--05899----


Q ss_pred             EEECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             86224311430475134021364323564100045324898678876444444431122354302478899999851000
Q gi|255764513|r  159 LTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPI  238 (492)
Q Consensus       159 ~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~  238 (492)
                            ..       -|...       =||++-+            |=..++..-|+=|+|-..+--.-.-|.+-||+..
T Consensus       150 ------~~-------~g~~~-------YPvlQaa------------Dil~~~adi~~~G~DQ~~~~~L~Rdia~rf~~~~  197 (333)
T PRK08560        150 ------ID-------VSKLV-------YPLMQVA------------DIFYLDVDIAVGGMDQRKAHMLAREVLPKLGYKK  197 (333)
T ss_pred             ------CC-------EEEEE-------CHHHHHH------------HHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             ------75-------31231-------4277650------------6875279955315430899999999999839999


Q ss_pred             CHHHHHHHHHHHHCC-------CCCCCC
Q ss_conf             001014555311013-------221223
Q gi|255764513|r  239 PEFIHLPLIKNPDKS-------KLSKRR  259 (492)
Q Consensus       239 p~f~H~pli~~~~g~-------klSKR~  259 (492)
                      |...|.|++.+-+|.       ||||-+
T Consensus       198 p~~l~~p~l~gl~g~~~~~~~~KMSkS~  225 (333)
T PRK08560        198 PVAIHTPLLTGLDGGGEVLAEIKMSKSK  225 (333)
T ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             7575257545687877779988678899


No 55 
>cd00805 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic core domain. TyrRS is a homodimer, which attaches Tyr to the appropriate tRNA.  TyrRS is a class I tRNA synthetases, so it aminoacylates the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formationof the enzyme bound aminoacyl-adenylate. It contains the class I characteristic HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=97.81  E-value=0.00016  Score=50.95  Aligned_cols=84  Identities=14%  Similarity=0.089  Sum_probs=61.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHH
Q ss_conf             48986788764444444311223543024788999998510000010145553110132212234330245666297737
Q gi|255764513|r  196 PTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPE  275 (492)
Q Consensus       196 ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~~~i~~~~~~GylPe  275 (492)
                      .+|-.-=+.|=..++.++|+=|+|-..+--.-..|.+-+|++.|.-.|.|+|.+.+|+||||-.+....-...   =.|+
T Consensus       136 f~YPvlQAaDil~~~~~~vpvG~DQ~~hiel~Rdia~r~n~~~~~~l~~pll~g~dG~KMSKS~~N~i~i~l~---dsp~  212 (268)
T cd00805         136 FLYPLLQAYDFVYLDVDIQLGGSDQRGNITLGRDLIRRLGYKKVVGLTTPLLTGLDGGKMSKSEGNAIWDGLL---DSPY  212 (268)
T ss_pred             HHHHHHHHCCHHHHCCCCEECCHHHHHHHHHHHHHHHHHCCCCCEEEEECEEECCCCCCCCCCCCCCCCCCCC---CCHH
T ss_conf             5589998601867137714606008999999999999828976145531100089987446789995013121---5558


Q ss_pred             HHHHHHH
Q ss_conf             7998998
Q gi|255764513|r  276 ALINFLA  282 (492)
Q Consensus       276 AilNyLa  282 (492)
                      .+..++.
T Consensus       213 ~i~~ki~  219 (268)
T cd00805         213 DFYQKIR  219 (268)
T ss_pred             HHHHHEE
T ss_conf             8861440


No 56 
>PRK05729 valS valyl-tRNA synthetase; Reviewed
Probab=97.76  E-value=0.00025  Score=49.66  Aligned_cols=90  Identities=23%  Similarity=0.365  Sum_probs=58.3

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEEECCCCC-----------------------CCC---------CHHH
Q ss_conf             8433887850159999999999997--18849999704866-----------------------638---------8679
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAKR--TGGKFILRIEDTDS-----------------------KRS---------TLES   57 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~~--~~g~f~lRieDtd~-----------------------~R~---------~~~~   57 (492)
                      .|..||.||+||+++-.+--.+||-  ..|.-++++=-+|.                       .|.         ++++
T Consensus        43 PP~~~G~lHiGHa~~~~i~D~i~Ry~rm~G~~V~~~pG~D~~Gl~~e~~vek~l~~~g~~~~~~~re~f~~~~~~w~~~~  122 (877)
T PRK05729         43 PPNVTGSLHMGHALNNTLQDILIRYKRMQGYNTLWLPGTDHAGIATQMVVERQLAAEGKTRHDLGREKFLEKVWEWKEES  122 (877)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCHHHCCHHHHHHHHHHHHHHH
T ss_conf             89887986121667488999999998727996688898688860568999999987499835448999999999999999


Q ss_pred             HHHHHHHHHHCCC--CCCCCCCCCCCCCCEECCCC--HHHHHHHHHHHHHCCCEEEC
Q ss_conf             9999999886589--88867655887676323262--89999999999988982451
Q gi|255764513|r   58 ENAVMQSLKWCGL--NWDEGPDIGGAYGPYRQSER--KNIYQPYVQNLLEKKLAFRC  110 (492)
Q Consensus        58 ~~~i~~~l~wlgl--~~De~~~~~g~~~p~~QS~r--~~~y~~~~~~L~~~g~aY~c  110 (492)
                      ...|.+.++.||+  |||.         +|+-.+.  ...-+....+|.++|++|+-
T Consensus       123 ~~~i~~q~~rlG~s~Dw~~---------~~~T~d~~~~~~v~~~F~~L~~kGliyr~  170 (877)
T PRK05729        123 GGTITNQLRRLGASVDWSR---------ERFTMDEGLSKAVREVFVRLYEKGLIYRG  170 (877)
T ss_pred             HHHHHHHHHHHCCCEECCC---------CCCCCCHHHHHHHHHHHHHHHHCCCEEEC
T ss_conf             9999999998286033589---------84558988999999999999988997841


No 57 
>PRK13208 valS valyl-tRNA synthetase; Reviewed
Probab=97.75  E-value=0.00032  Score=49.01  Aligned_cols=88  Identities=27%  Similarity=0.431  Sum_probs=59.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHH--HCCCEEEEEECCCC--------------------CCC---------CCHHHHHH
Q ss_conf             843388785015999999999999--71884999970486--------------------663---------88679999
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAK--RTGGKFILRIEDTD--------------------SKR---------STLESENA   60 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~--~~~g~f~lRieDtd--------------------~~R---------~~~~~~~~   60 (492)
                      .|-|||.||+||++|...--.+||  +..|.-+|+.=-+|                    ..|         .+..+.+.
T Consensus        46 pPy~nG~lHiGH~~~~t~~D~~~Ry~rm~G~~Vl~~~G~D~~GlPie~~vek~~~~~~~~~~~~~f~~~c~~~~~~~~~~  125 (809)
T PRK13208         46 PPTVSGKLHIGHVFSYTHTDFIARYQRMRGYNVFFPQGWDDNGLPTERKVEKYYGIRAHDISREEFIELCRELTDEDEEK  125 (809)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             99988972131668899999999999817996699884585668999999997199901279999999999999999999


Q ss_pred             HHHHHHHCCC--CCCCCCCCCCCCCCEECCCCHHHHHH----HHHHHHHCCCEEEC
Q ss_conf             9999886589--88867655887676323262899999----99999988982451
Q gi|255764513|r   61 VMQSLKWCGL--NWDEGPDIGGAYGPYRQSERKNIYQP----YVQNLLEKKLAFRC  110 (492)
Q Consensus        61 i~~~l~wlgl--~~De~~~~~g~~~p~~QS~r~~~y~~----~~~~L~~~g~aY~c  110 (492)
                      +.+.++-||+  |||.         +|+-..  +.|.+    ...+|-++|+.|+.
T Consensus       126 ~~~~~~~lG~s~Dw~r---------~~~T~d--~~y~~~v~~~f~~L~~~Gliy~g  170 (809)
T PRK13208        126 FRELWRRLGLSVDWSL---------EYRTIS--PEYRRISQKSFLDLYKKGLIYRA  170 (809)
T ss_pred             HHHHHHHHCCCCCCCC---------CCCCCC--HHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             9999998286140689---------707588--78999999999999977997874


No 58 
>TIGR00398 metG methionyl-tRNA synthetase; InterPro: IPR002304   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    Methionyl-tRNA synthetase (6.1.1.10 from EC) is an alpha 2 dimer that belongs to class Ia. In some species (archaea, eubacteria and eukaryota) a coding sequence, similar to the C-term end of MetRS, is present as an independent gene which is a tRNA binding domain as a dimer. In eubacteria, MetRS can also be splitted in two sub-classes corresponding to the presence of one or two CXXC domain specific to zinc binding. The crystal structures of a number of methionyl-tRNA synthases are known , , .; GO: 0000166 nucleotide binding, 0004825 methionine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006431 methionyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=97.74  E-value=0.0001  Score=52.28  Aligned_cols=282  Identities=19%  Similarity=0.279  Sum_probs=156.9

Q ss_pred             CCCCCCCCHHHHH-HHHHHHHHHHH--CCCEEEE----------------EECCCC-CCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             4338878501599-99999999997--1884999----------------970486-66388679999999988658988
Q gi|255764513|r   13 PSPTGEPHIGTAY-TALFNYLIAKR--TGGKFIL----------------RIEDTD-SKRSTLESENAVMQSLKWCGLNW   72 (492)
Q Consensus        13 PsPtG~lH~G~~r-tal~n~l~a~~--~~g~f~l----------------RieDtd-~~R~~~~~~~~i~~~l~wlgl~~   72 (492)
                      |=|+|.+|||||| |-|.+=.+||=  ..|.=++                +.+-+| ++-.+..+.+.+.++++||+|.+
T Consensus         8 ~Y~Ng~pHlGH~~st~~~AD~~~RY~~~~G~~v~f~cGTDEHG~kI~~~A~~~g~tqP~~~vd~~~~~f~~~~~~lnI~f   87 (573)
T TIGR00398         8 PYANGKPHLGHAYSTTILADVYARYKRLRGYEVLFVCGTDEHGTKIELKAEQEGLTQPKELVDKYHEEFKKLWKWLNISF   87 (573)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             66787112103667778999999998528974789851344687888869870899648999999999999998728456


Q ss_pred             CCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEE-------CCCCHHHHHHHHHHH--HHHHCCCC------CCCCC
Q ss_conf             8676558876763232628999999999998898245-------148899977668876--64310002------36655
Q gi|255764513|r   73 DEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFR-------CFCSTERLEEMRRAQ--RKRNIPSR------YDGHC  137 (492)
Q Consensus        73 De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~-------c~~t~eel~~~r~~~--~~~~~~~~------Y~~~~  137 (492)
                      |.       |+----....++=+++.++|.++|..|.       |---+.-+.. |+..  ...|.+|.      +...|
T Consensus        88 D~-------F~RTTd~~H~~~v~~~f~~L~~nGyIY~~~~~g~YC~~c~~Fl~d-r~~~~~yv~g~CP~c~~~~~~gd~c  159 (573)
T TIGR00398        88 DR-------FIRTTDEEHKEIVQKIFQKLLENGYIYEKEIKGLYCPECESFLPD-RKLVDDYVEGTCPKCGSEDARGDHC  159 (573)
T ss_pred             CC-------CCCCCCHHHHHHHHHHHHHHHHCCCCCHHCCCCCCCCCCCCCCCH-HHHHCCCCCCCCCCCCCCCCCCCCC
T ss_conf             76-------546768888999999999987537741100353234756653622-3200133467488688777778775


Q ss_pred             ----CCCCHHHHHH--HHHCCCCCEEE------EEECCCCEEECCCCCCC------------C---EECCCCCCCCCCEE
Q ss_conf             ----5788333001--12025774078------86224311430475134------------0---21364323564100
Q gi|255764513|r  138 ----LKLSSQEIER--LSQEQKKHVVR------LTVPNQGSCVFQDKVYG------------E---MEIPWNAVDMQVLL  190 (492)
Q Consensus       138 ----r~l~~~e~~~--~~~~g~~~~iR------~k~p~~~~~~~~D~i~G------------~---~~~~~~~~~D~vi~  190 (492)
                          |.+.+-|...  -.-.|..|++|      |+++.-. -...|.++-            +   +.|-.+.|.|+.|-
T Consensus       160 ~~Cg~~leP~~Li~P~c~~~~~~~~~~~~~hyFf~L~~~~-~~l~~~~~~~~~~~~~~~~~~n~~~~~~~~~GL~D~~It  238 (573)
T TIGR00398       160 EVCGRHLEPFELINPRCVICKNKPELRDSEHYFFRLSAFE-KELEEWIKKNPESKSPASNVKNVAKQNWIKGGLKDLAIT  238 (573)
T ss_pred             CCCCCCCCCCHHCCCCEEEECCEEEEECCCCCCCCCHHHH-HHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             5465536850011870255488002513545223536888-999998614884242189999998899850687430110


Q ss_pred             CCC-----CCH-----------------HHHHHHHH------------------HH-HHHHHHHHHCCCCCCCHHHHHHH
Q ss_conf             045-----324-----------------89867887------------------64-44444431122354302478899
Q gi|255764513|r  191 KSD-----GMP-----------------TYHLANVI------------------DD-HLMKITHVARGEEWISSVPKHIL  229 (492)
Q Consensus       191 r~d-----g~p-----------------tY~~a~vv------------------DD-~~m~ithviRg~d~~~~t~~q~~  229 (492)
                      |..     |.|                 +-+-.+.+                  ++ -+-++=|+| |.|   .+.-|-.
T Consensus       239 R~~~~lkWG~pvP~~~~p~~~~YVW~DAl~gYiss~~~~~~~~~~~~~~~~~W~~~~~~~~~~HfI-GKD---I~~FH~i  314 (573)
T TIGR00398       239 RDLVDLKWGIPVPNDGAPNKVVYVWFDALIGYISSLKALGIEKGLTEDWKKWWNNNSEDAELIHFI-GKD---IVRFHTI  314 (573)
T ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEEECHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCCCCEEEEEE-CCC---CCCHHHH
T ss_conf             364412115317898987967998720345699997521335687578998626888650278884-241---2020333


Q ss_pred             HH----HHHH--HCCCH--HHHHHHHHHHHCCCCCCCCCC-CCHHH-HHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHH
Q ss_conf             99----9851--00000--101455531101322122343-30245-666297737799899850676665530110146
Q gi|255764513|r  230 LY----QYFN--FPIPE--FIHLPLIKNPDKSKLSKRRNP-TSISY-YSAMGYLPEALINFLALLFVHKSEDDDELMDMQ  299 (492)
Q Consensus       230 l~----~al~--~~~p~--f~H~pli~~~~g~klSKR~~~-~~i~~-~~~~GylPeAilNyLalLGws~~~~d~Eifsl~  299 (492)
                      .+    .++|  |..|.  ++|==|  .-+|.||||-.|- +...+ |.++||-++.+.=||+.-  . +.+.+=-|+.+
T Consensus       315 yWPa~L~~~~eN~~lP~q~~~hGyl--~~eG~KMSKS~G~vv~~~~~~~~~~~g~D~lRYYl~~~--~-~~~~D~~F~~~  389 (573)
T TIGR00398       315 YWPAMLMGLGENLPLPTQVFAHGYL--TVEGQKMSKSLGNVVDPEDDLLARGYGADILRYYLLKE--V-PLGKDGDFSWE  389 (573)
T ss_pred             HHHHHHHHCCCHHHHHHHHEEEEEE--EECCEEECCCCCCEECHHHHHHHCCCCHHHHHHHHHHH--C-CCCCCCCCCHH
T ss_conf             4458885112100212132430168--84784432324753232178764478805788899864--2-43447656889


Q ss_pred             HHHHHHHHHHCCC
Q ss_conf             7776520211375
Q gi|255764513|r  300 QLIHHFDLHHLSK  312 (492)
Q Consensus       300 eli~~FdL~~I~K  312 (492)
                      .+++.-+-+=+++
T Consensus       390 ~f~~r~N~~L~n~  402 (573)
T TIGR00398       390 DFVERVNADLAND  402 (573)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999976887765


No 59 
>cd02156 nt_trans nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain.
Probab=97.70  E-value=4.1e-05  Score=55.04  Aligned_cols=43  Identities=28%  Similarity=0.386  Sum_probs=36.5

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCC
Q ss_conf             48433887850159999999999997188499997048666388
Q gi|255764513|r   11 IAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRST   54 (492)
Q Consensus        11 faPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDtd~~R~~   54 (492)
                      .+|.|+|.+|+||++.+.....+++ +++.+++.+.++|.....
T Consensus         2 ~~~g~fd~~H~GH~~l~~~~~~~~~-~~~~~~~~~~~~~~~~~~   44 (147)
T cd02156           2 LAPGPFDPLHLGHLRLIERADELAR-YGGDELIVIDDTDPPIKK   44 (147)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHH-HCCCCEEEEECCCCCHHH
T ss_conf             8986048767899999999999999-769928999789991453


No 60 
>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). Other tRNA synthetase sub-families are too dissimilar to be included.
Probab=97.56  E-value=0.0014  Score=44.70  Aligned_cols=163  Identities=19%  Similarity=0.228  Sum_probs=88.5

Q ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHH--HCCCEEEEEECCCCC---------------------C------------CC
Q ss_conf             634843388785015999999999999--718849999704866---------------------6------------38
Q gi|255764513|r    9 VRIAPSPTGEPHIGTAYTALFNYLIAK--RTGGKFILRIEDTDS---------------------K------------RS   53 (492)
Q Consensus         9 ~RfaPsPtG~lH~G~~rtal~n~l~a~--~~~g~f~lRieDtd~---------------------~------------R~   53 (492)
                      +=.-|-|||.||+||+|+....-.+||  +..|.-+|..=-.|.                     .            ..
T Consensus        28 ~~~pPY~nG~lH~GH~~~~t~~D~~aRy~rm~G~~Vl~p~GwD~~GlPiE~~vek~~~~~~~~~~~~~~~~~~~~~~~~~  107 (606)
T pfam00133        28 HDGPPNATGLLHIGHALNKTLKDIVIRYKRMQGFDVLWVPGWDHHGLPTEQKVEKKLGIKGKKDRHKLGREKFREKCREW  107 (606)
T ss_pred             EECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHCCHHHHHHHHHHH
T ss_conf             70898978850242668789999999999828997799884561439999999997421159983657999999999999


Q ss_pred             CHHHHHHHHHHHHHCCC--CCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             86799999999886589--8886765588767632326289999999999988982451488999776688766431000
Q gi|255764513|r   54 TLESENAVMQSLKWCGL--NWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPS  131 (492)
Q Consensus        54 ~~~~~~~i~~~l~wlgl--~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~  131 (492)
                      +..+.+.+.+.|+-+|+  ||+.....   ..|.|.    ..=+....+|.++|++|+..                 .+-
T Consensus       108 ~~~~~~~~~~~~~~lG~~~DW~r~~~T---~dp~y~----~~~~w~F~~L~~~Gliyr~~-----------------~~V  163 (606)
T pfam00133       108 KMEYADEIRSQFKRLGVSGDWDREYFT---LDPGLE----AAVWRVFVRLHDKGLIYRGK-----------------KPV  163 (606)
T ss_pred             HHHHHHHHHHHHHHHCCEEECCCCCCC---CCHHHH----HHHHHHHHHHHHCCCCEEEE-----------------EEE
T ss_conf             999999999999982912645887252---781254----99999999999779817751-----------------550


Q ss_pred             CCCCCCC-CCCHHHHHHHHHCCCCCEEEEEECCCCE---EECC---CCCCCCEECCCCCCCCCCEECCCCC
Q ss_conf             2366555-7883330011202577407886224311---4304---7513402136432356410004532
Q gi|255764513|r  132 RYDGHCL-KLSSQEIERLSQEQKKHVVRLTVPNQGS---CVFQ---DKVYGEMEIPWNAVDMQVLLKSDGM  195 (492)
Q Consensus       132 ~Y~~~~r-~l~~~e~~~~~~~g~~~~iR~k~p~~~~---~~~~---D~i~G~~~~~~~~~~D~vi~r~dg~  195 (492)
                      .|+-.|. -|+.+|+......+....++|++.....   +.|+   +.+.|...+--+--.+.++...++-
T Consensus       164 ~wcp~~~T~La~~Ev~~~d~~~~~~~v~f~l~~~~~~~l~i~TTrPeTl~g~~~l~v~p~~~y~~~~~~~~  234 (606)
T pfam00133       164 NWSPALNTALSEAEVEYKDVKGPSIHVAFPLADGKGASLVIWTTTPWTLPGNTAVAVNPEFNYVKIRVTGE  234 (606)
T ss_pred             CCCCCCCEECCCCCEEECCCCCCEEEEECCCCCCCCCEEEEEECCCCCCCCCEEEEECCCCCEEEEECCCC
T ss_conf             12442541224440210003330356504457898766999943542003653689888876510443860


No 61 
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed
Probab=97.47  E-value=0.002  Score=43.54  Aligned_cols=88  Identities=23%  Similarity=0.389  Sum_probs=59.5

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHH--HCCCEEEEEECCCCCC-----------------C----------------CCHH
Q ss_conf             843388785015999999999999--7188499997048666-----------------3----------------8867
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAK--RTGGKFILRIEDTDSK-----------------R----------------STLE   56 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~--~~~g~f~lRieDtd~~-----------------R----------------~~~~   56 (492)
                      .|.|||.||+||+++-.+--.+||  ...|.-+++.=-.|..                 +                .+..
T Consensus        43 PPy~nG~lHiGH~~~~tikDii~Ry~rm~G~~V~~~~GwD~hGLPiE~~vek~lgi~~k~~i~~~gi~~F~~~cr~~~~~  122 (1042)
T PRK06039         43 PPFANGLPHYGHLLTRTIKDVVPRYKTMKGYKVERRAGWDTHGLPVELEVEKELGISGKKDIEKYGIEKFNEECRESVLR  122 (1042)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCHHHCCHHHHHHHHHHHHHH
T ss_conf             99878872143668789999999998738996689897486778999999998476676426552899999999999999


Q ss_pred             HHHHHHHHHHHCCC--CCCCCCCCCCCCCCEECCCCHHHHHH----HHHHHHHCCCEEEC
Q ss_conf             99999999886589--88867655887676323262899999----99999988982451
Q gi|255764513|r   57 SENAVMQSLKWCGL--NWDEGPDIGGAYGPYRQSERKNIYQP----YVQNLLEKKLAFRC  110 (492)
Q Consensus        57 ~~~~i~~~l~wlgl--~~De~~~~~g~~~p~~QS~r~~~y~~----~~~~L~~~g~aY~c  110 (492)
                      +.+...+.++-+|+  |||.         +|+-..  +.|.+    ...+|.++|++|+-
T Consensus       123 ~~~~~~~~~~rlG~~~Dw~~---------~y~T~d--~~y~e~v~~~F~~L~ekGliYrg  171 (1042)
T PRK06039        123 YTDEWEEYTERLGRWVDFDN---------PYKTMD--NSYMESVWWALKQLYDKGLLYEG  171 (1042)
T ss_pred             HHHHHHHHHHHHCCCCCCCC---------CEECCC--HHHHHHHHHHHHHHHHCCCEEEC
T ss_conf             99999999998182052689---------827689--88999999999999987998962


No 62 
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .   Valyl-tRNA synthetase (6.1.1.9 from EC) is an alpha monomer that belongs to class Ia.; GO: 0000166 nucleotide binding, 0004832 valine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006438 valyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=97.42  E-value=0.00066  Score=46.84  Aligned_cols=16  Identities=25%  Similarity=0.395  Sum_probs=9.4

Q ss_pred             HHHHHHHCCCCCCCCC
Q ss_conf             5553110132212234
Q gi|255764513|r  245 PLIKNPDKSKLSKRRN  260 (492)
Q Consensus       245 pli~~~~g~klSKR~~  260 (492)
                      +||.+++|+||||-.|
T Consensus       578 GLVRDeqG~KMSKSlG  593 (970)
T TIGR00422       578 GLVRDEQGRKMSKSLG  593 (970)
T ss_pred             CEEECCCCCCCCCCCC
T ss_conf             4455588851222056


No 63 
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional
Probab=97.29  E-value=0.0032  Score=42.15  Aligned_cols=90  Identities=19%  Similarity=0.317  Sum_probs=60.6

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHH--HCCCEEEEEECCCCC------------------CC--------------CCHHH
Q ss_conf             843388785015999999999999--718849999704866------------------63--------------88679
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAK--RTGGKFILRIEDTDS------------------KR--------------STLES   57 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~--~~~g~f~lRieDtd~------------------~R--------------~~~~~   57 (492)
                      .|-|||.||+||+++-.+--.+||  ...|.-++++=-.|.                  .+              ...++
T Consensus        62 PPyanG~lH~GHaln~tikDii~Rykrm~G~~V~~~~GwD~hGLPiE~~vek~l~~~~~~~~~~~~~~f~~~cr~~a~~~  141 (966)
T PRK13804         62 PPYANGNIHIGHALNKILKDVIVRSKQMLGFDANYVPGWDCHGLPIEWKIEEKYRAKGKNKDEVPLNEFRKECREYALSW  141 (966)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHCCHHHHHHHHHHHHHHH
T ss_conf             99999986122556668999999998748996689997688878999999997765289823389999999999999999


Q ss_pred             HHHHHHHHHHCCC--CCCCCCCCCCCCCCEECCC--CHHHHHHHHHHHHHCCCEEEC
Q ss_conf             9999999886589--8886765588767632326--289999999999988982451
Q gi|255764513|r   58 ENAVMQSLKWCGL--NWDEGPDIGGAYGPYRQSE--RKNIYQPYVQNLLEKKLAFRC  110 (492)
Q Consensus        58 ~~~i~~~l~wlgl--~~De~~~~~g~~~p~~QS~--r~~~y~~~~~~L~~~g~aY~c  110 (492)
                      ++.+.+.++-+|+  |||.         +|.-..  ....=+....+|.++|++|+-
T Consensus       142 i~~~~~q~~rlG~~~DW~~---------~y~T~dp~y~~~~~~~F~~l~ekGliYr~  189 (966)
T PRK13804        142 IDVQREEFKRLGVIGDWEN---------PYTTMDFHAEARIAREFMKFAAKGQLYRG  189 (966)
T ss_pred             HHHHHHHHHHHCEEECCCC---------CCCCCCHHHHHHHHHHHHHHHHCCCEEEC
T ss_conf             9999999998292022589---------84228989999999999999987998843


No 64 
>TIGR00467 lysS_arch lysyl-tRNA synthetase; InterPro: IPR002904   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .   Lysyl-tRNA synthetase (6.1.1.6 from EC) is an alpha 2 homodimer that belong to both class I and class II. In eubacteria and eukaryota lysyl-tRNA synthetases belong to class II in the same family as aspartyl tRNA synthetase. The class Ic lysyl-tRNA synthetase family is present in archaea and some eubacteria . Moreover in some eubacteria there is a gene X, which is similar to a part of lysyl-tRNA synthetase from class II. Lysyl-tRNA synthetase is duplicated in some species with, for example in E. coli, as a constitutive gene (lysS) and an induced one (lysU). A refined crystal structures shows that the active site of lysU is shaped to position the substrates for the nucleophilic attack of the lysine carboxylate on the ATP alpha-phosphate. No residues are directly involved in catalysis, but a number of highly conserved amino acids and three metal ions coordinate the substrates and stabilise the pentavalent transition state. A loop close to the catalytic pocket, disordered in the lysine-bound structure, becomes ordered upon adenine binding .; GO: 0000166 nucleotide binding, 0004824 lysine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006430 lysyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=97.25  E-value=0.0061  Score=40.31  Aligned_cols=449  Identities=15%  Similarity=0.148  Sum_probs=216.5

Q ss_pred             CCEEEECCCCCCCCCCHHHHHHHHHHHHHH-----HHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             770563484338878501599999999999-----971884999970486663886799999999886589888676558
Q gi|255764513|r    5 SKVRVRIAPSPTGEPHIGTAYTALFNYLIA-----KRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIG   79 (492)
Q Consensus         5 ~~v~~RfaPsPtG~lH~G~~rtal~n~l~a-----~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~   79 (492)
                      ..-++--.-+|+|.+|+||+|..+-.-+.+     .....+++.--++.|.-|....+...--.--.++|..--+-|...
T Consensus        19 ~~~~~~~g~~p~g~~~~g~~~~~~~~d~~~~~l~~~g~~~~~~~~~d~~d~~~~~~~~~p~~~~~~~~~~~~~~~~p~~~   98 (539)
T TIGR00467        19 NLYTVASGITPSGHIHLGNLREVLTADAIARALLDSGGEAKLIYIADDYDPLRKLYPFLPEQEELETYLGLPLTKIPDPE   98 (539)
T ss_pred             CCEEEECCCCCCCCEEECCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCC
T ss_conf             21033204676660330421456768888888750676147888524510344304567506788887410122067854


Q ss_pred             CCCCCEECCCCHHHHHHHHHHHHHCCCEEEC------CC-------------CHHHHHHHHHHHHHHHCCCC---CCCCC
Q ss_conf             8767632326289999999999988982451------48-------------89997766887664310002---36655
Q gi|255764513|r   80 GAYGPYRQSERKNIYQPYVQNLLEKKLAFRC------FC-------------STERLEEMRRAQRKRNIPSR---YDGHC  137 (492)
Q Consensus        80 g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c------~~-------------t~eel~~~r~~~~~~~~~~~---Y~~~~  137 (492)
                      |-...|-+ ....-   +.+.|-..|.--..      |.             .++++...-........+-.   ..-.|
T Consensus        99 ~~~~~~~~-~~~~~---~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~w~p~~~~c  174 (539)
T TIGR00467        99 GCCDSYAE-HFLRP---FLESLPVLGIPPEFYRADENYTEGLYDSKIKIALDNREELAEILNEYRGSPLEEDWYPISPLC  174 (539)
T ss_pred             CHHHHHHH-HHHHH---HHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHH
T ss_conf             20245666-66656---676422116760211013444201012112333310678999987640465643233202433


Q ss_pred             CCCCHHHHHHHHHCCCCCEEEEEECCCC-EEECCCCCCCCEEC-CCCCC-CCCCEECCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             5788333001120257740788622431-14304751340213-64323-564100045324898678876444444431
Q gi|255764513|r  138 LKLSSQEIERLSQEQKKHVVRLTVPNQG-SCVFQDKVYGEMEI-PWNAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHV  214 (492)
Q Consensus       138 r~l~~~e~~~~~~~g~~~~iR~k~p~~~-~~~~~D~i~G~~~~-~~~~~-~D~vi~r~dg~ptY~~a~vvDD~~m~ithv  214 (492)
                      .+.           |..-.-+.+...+. .+.+.-.+.|.... ..... .-.+-+|-| +|.---..-|+---+|-.|.
T Consensus       175 ~~c-----------~~~~~~~~~~~~~~~~~~~~c~~cg~~~~~~~~~~~~~~l~w~~d-w~~~w~~~~~~~~p~g~d~~  242 (539)
T TIGR00467       175 ENC-----------GRLTTTVVNYDDEYEWIEYECEICGNEGSVGPRYTGGGKLPWRVD-WPARWKILKVTFEPAGKDHA  242 (539)
T ss_pred             HCC-----------CCCCCEEECCCCCCCEEEEEEEECCCCCCCCCCEECCCCCCEEEC-CCCCCEEEEEECCCCCCCCC
T ss_conf             203-----------531000210244322267764331665544420102311212203-10001133321043675200


Q ss_pred             HCCCCCCCHHHHHHHHHHHHHHCCCH---HHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             12235430247889999985100000---101455531101322122343-30245666297737799899850676665
Q gi|255764513|r  215 ARGEEWISSVPKHILLYQYFNFPIPE---FIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKSE  290 (492)
Q Consensus       215 iRg~d~~~~t~~q~~l~~al~~~~p~---f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~~  290 (492)
                      .-|-.+-++.-.-   -+.+.+.||.   |--+.+-.+..|.++|...|. .++.+..+ -+.|+ ++.|+..- ..|..
T Consensus       243 ~~gg~~d~~~~~~---~~~~~~~pp~~~~~~~~~~~~gd~~~~~~~~~g~~~~~~~~~~-~~~p~-~~~~~~~~-~~p~~  316 (539)
T TIGR00467       243 AAGGSYDTGVLIA---KEIFDYEPPYPVPYEWISLKGGDKGGPLSSSKGDVLPVKDWLE-VYPPE-ILRFLLLR-TKPNT  316 (539)
T ss_pred             CCCCCCHHHHHHH---HHHHCCCCCCCEEEEEEEEECCCCCCCCCCCCCCEEEHHHHHH-HCCHH-HHHHHHHH-CCCCC
T ss_conf             1576410246788---8875057884202324565025423323234563232334544-21435-75554531-16775


Q ss_pred             CCHHHCCHHHHHHHH-HHHHCCCCCCC------CHHHHHHHHHHHHHHCC-CCHH--------HHHHHHHHHHC---CCC
Q ss_conf             530110146777652-02113755442------01565566435555126-9989--------99986444200---001
Q gi|255764513|r  291 DDDELMDMQQLIHHF-DLHHLSKAGAV------FDKQKLDWLNGRWIREK-LSTT--------EFLSRVSQWMK---EKD  351 (492)
Q Consensus       291 ~d~Eifsl~eli~~F-dL~~I~Ks~A~------FD~eKL~wlN~qyIr~~-l~~~--------el~~~l~~~l~---~~~  351 (492)
                      ...--|+++.+-+.. +++.+..---.      ...++-......-+.+- +..+        ..+..+.....   ..+
T Consensus       317 ~~~~~~d~~~~~d~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d  396 (539)
T TIGR00467       317 EKHIDFDLGKIPDLGDDYDKLEDFYYGFKDKDELSEKKRAFKRIYELSTPYLPGETVPYDVPFRHLSVIGQLFEDEEKED  396 (539)
T ss_pred             CEEEECCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHCCHHHHHHHHHHHCCCCHHH
T ss_conf             21220240232356777777777762232034544566666655420255434442100024046666665540100000


Q ss_pred             C-CCCHHHHHHHCCCHHHHHHH---------------HHHHHHCCCCCCCHH-HHHHHHCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             2-32206888725320356677---------------556752246788854-554331486679999999999840588
Q gi|255764513|r  352 R-LTQALTLAQSRITTLSALPQ---------------MTDFLFKSDLHLTAE-SFKSTALCPEEIIDILKTTQEEFEVIQ  414 (492)
Q Consensus       352 ~-l~~il~likeRi~tL~Di~~---------------~~~ffF~~~~~~d~e-~~~k~~~~~e~~~~iL~~~~~~L~~~~  414 (492)
                      + +.+++..++..-.++.|+.+               |..-+-.+...+... .........+..+..+..+.+.+....
T Consensus       397 ~~~~~~~~~~~~~~~~~dd~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~  476 (539)
T TIGR00467       397 WDLEKVLEILKRTGYTVDDVDDFSLKLLEKRLLCARNWLLKYAPEDVKFSLPEKEDVYEELEEEEKKWLKELAEKLKKDF  476 (539)
T ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             00899999986315531003466788888888888888875041000320202456788764457899999999864210


Q ss_pred             CC-CHHHHHHHHHHHHHHHCCCHHHHCCEEEEEEECCCCCCCHHHHHHHHCHHHHHHHHHHH
Q ss_conf             89-98889999999999957982331012678896488888899999884959999999999
Q gi|255764513|r  415 IW-KRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA  475 (492)
Q Consensus       415 ~w-~~e~Ie~~ik~i~e~~giK~k~l~~PLRiALTG~~~GP~L~eil~lLGkeetl~RL~~a  475 (492)
                      .- ...++...+..+..+.|++....++.+-.++.|+..||.+.-.+..+|.+.+.+|...+
T Consensus       477 ~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gp~~~~~~~~~g~~~~~~~~~~~  538 (539)
T TIGR00467       477 EPALEQDLHNLIYDVSKELGLEPALAFQAIYKILLGKEYGPKLGGFLKTLGVDWVEKRTSLY  538 (539)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             02333467889988776506635688999999883343452256788875367788887641


No 65 
>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .   Arginyl-tRNA synthetase (6.1.1.19 from EC) has been crystallized and preliminary X-ray crystallographic analysis of yeast arginyl-tRNA synthetase-yeast tRNAArg complexes is available . ; GO: 0000166 nucleotide binding, 0004814 arginine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006420 arginyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=97.24  E-value=0.00073  Score=46.56  Aligned_cols=301  Identities=15%  Similarity=0.146  Sum_probs=150.1

Q ss_pred             CCEEEEC-CCCCCCCCCHHHHHHHHHHHHHHHHCC--CEEEEEECCCCCCCCCHHHHHHHHH---HHHHCCCCCCCCCCC
Q ss_conf             7705634-843388785015999999999999718--8499997048666388679999999---988658988867655
Q gi|255764513|r    5 SKVRVRI-APSPTGEPHIGTAYTALFNYLIAKRTG--GKFILRIEDTDSKRSTLESENAVMQ---SLKWCGLNWDEGPDI   78 (492)
Q Consensus         5 ~~v~~Rf-aPsPtG~lH~G~~rtal~n~l~a~~~~--g~f~lRieDtd~~R~~~~~~~~i~~---~l~wlgl~~De~~~~   78 (492)
                      .+|.+=| .|.|||+|||||+|.|++=--+||=..  |-=++|.=      .+-++=.+|--   .+.-+|-+-- -.  
T Consensus       118 ~ki~~EfsSaNp~gplH~GHlR~aiIGD~L~r~l~~~G~~V~r~y------yVND~G~Q~~~l~~~~~~~~~e~~-~~--  188 (600)
T TIGR00456       118 KKIIIEFSSANPAGPLHIGHLRNAIIGDSLARILEFLGYDVIREY------YVNDWGRQIGLLVLGVEKFGNEKE-TA--  188 (600)
T ss_pred             EEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE------EECCHHHHHHHHHHHHHHHCCHHH-CC--
T ss_conf             079998765888976110000257778899999987597079852------005428999999999998512132-02--


Q ss_pred             CCCCCCEECCCCHHH-HHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHC--C--CCCCCCCCCCCHHHHHHHHH---
Q ss_conf             887676323262899-999999999889824514889997766887664310--0--02366555788333001120---
Q gi|255764513|r   79 GGAYGPYRQSERKNI-YQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNI--P--SRYDGHCLKLSSQEIERLSQ---  150 (492)
Q Consensus        79 ~g~~~p~~QS~r~~~-y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~--~--~~Y~~~~r~l~~~e~~~~~~---  150 (492)
                          .+.--..=.+. |.++.+.+.+..-.-+ -||-++.....=.....|.  .  ..-=.+|++.+-++++.-++   
T Consensus       189 ----~~~~~~~~~~~~y~~~~k~~~e~~~~~~-~~s~~~~~~~~~~~~e~gdnNe~~~~~w~~~~~~~l~~~k~tl~~ln  263 (600)
T TIGR00456       189 ----VKKPDHGLEGFDYVEINKRLEENEEPIN-KQSLEEEARELFVKLESGDNNEKTIKLWKRLVEYALEGIKETLKRLN  263 (600)
T ss_pred             ----CCCCCCCHHHHHHHHHHHHHHHCCCCCC-CCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             ----6687420123588898878861777653-33545789999997432444289999999999999999999998629


Q ss_pred             --------CCCCCEEEEEECC----------CCEEECCCCCCCCEECCCCCC---------CCCCEECCCCCHHHHHHHH
Q ss_conf             --------2577407886224----------311430475134021364323---------5641000453248986788
Q gi|255764513|r  151 --------EQKKHVVRLTVPN----------QGSCVFQDKVYGEMEIPWNAV---------DMQVLLKSDGMPTYHLANV  203 (492)
Q Consensus       151 --------~g~~~~iR~k~p~----------~~~~~~~D~i~G~~~~~~~~~---------~D~vi~r~dg~ptY~~a~v  203 (492)
                              .|+  +  ||.|.          ......+|  -|-+.++....         -|.||.|+||+++|--.-|
T Consensus       264 i~~D~~~~E~E--~--~~~~~~~~v~e~L~k~~gl~~ed--~gA~~~~L~~f~d~kadG~~k~~Vl~k~DGt~~Y~T~Di  337 (600)
T TIGR00456       264 IHFDEFVWEGE--S--VKNGKVPKVLEDLKKEKGLVVED--DGALWLDLTEFGDKKADGDEKDRVLIKSDGTYLYLTRDI  337 (600)
T ss_pred             CCEEEEEECCE--E--EECCCHHHHHHHHHHHCCCEEEC--CCEEEEECCCCCCCCCCCCCCCEEEEEECCCCCCHHHHH
T ss_conf             65005885404--5--77486078999863103780674--734899757766621267645647885089501059899


Q ss_pred             ---HHHHHH-HHH--HHHCCCCCCCHHHHHHHHHHHHH--HCCCHHHHHHH--HHHHHCCCCCCCCCC-CCHHHHHHCCC
Q ss_conf             ---764444-444--31122354302478899999851--00000101455--531101322122343-30245666297
Q gi|255764513|r  204 ---IDDHLM-KIT--HVARGEEWISSVPKHILLYQYFN--FPIPEFIHLPL--IKNPDKSKLSKRRNP-TSISYYSAMGY  272 (492)
Q Consensus       204 ---vDD~~m-~it--hviRg~d~~~~t~~q~~l~~al~--~~~p~f~H~pl--i~~~~g~klSKR~~~-~~i~~~~~~Gy  272 (492)
                         .|=... +-.  --|=|-||---.++=-.+++.||  .+.|+--|++.  +...+|||||-|.|. +++..+.++= 
T Consensus       338 Ayh~~k~~~~~~d~~i~V~gsdh~~h~~q~~~~~e~LG~~~~~~~L~~~~f~~v~~~~GKkmkTR~G~~i~ld~ll~e~-  416 (600)
T TIGR00456       338 AYHLDKLERLGFDKLIYVWGSDHKLHIAQVFAILEKLGYLSKKKELEHLEFGMVPLGSGKKMKTRRGNVISLDNLLDEA-  416 (600)
T ss_pred             HHHHHHHHHCCCEEEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCEEHHHHHHHH-
T ss_conf             9999987343972899874051888999999999971653788616899876432578885434556602234468999-


Q ss_pred             CHHHHHHHHHHCCCCCCCCCH--HHCCH--HHHHHHHHHHHCCCCCCCCHHH-HHHHHHH
Q ss_conf             737799899850676665530--11014--6777652021137554420156-5566435
Q gi|255764513|r  273 LPEALINFLALLFVHKSEDDD--ELMDM--QQLIHHFDLHHLSKAGAVFDKQ-KLDWLNG  327 (492)
Q Consensus       273 lPeAilNyLalLGws~~~~d~--Eifsl--~eli~~FdL~~I~Ks~A~FD~e-KL~wlN~  327 (492)
                       .+=..+.+..=-..-+.++.  ++.+.  ..+|..|+++.=..+.-+||++ +-.-+++
T Consensus       417 -~~RA~~~~~~~~~~~~~~e~~e~~a~~vG~gAvry~~l~~~~~~~~~Fd~d~~~L~f~~  475 (600)
T TIGR00456       417 -SKRAGNVITKRNTDLEQDEAEEKVADAVGIGAVRYADLSKNRETHYVFDWDTAMLSFEG  475 (600)
T ss_pred             -HHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEECCCHHHCCCC
T ss_conf             -99999999611013522203789999973679999999727898815501201111578


No 66 
>PRK00390 leuS leucyl-tRNA synthetase; Validated
Probab=97.24  E-value=0.00095  Score=45.75  Aligned_cols=87  Identities=29%  Similarity=0.409  Sum_probs=57.3

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHH--HCCCEEEEEE----------C------CCCCCCCCHHHHHHHHHHHHHCCC--C
Q ss_conf             843388785015999999999999--7188499997----------0------486663886799999999886589--8
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAK--RTGGKFILRI----------E------DTDSKRSTLESENAVMQSLKWCGL--N   71 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~--~~~g~f~lRi----------e------Dtd~~R~~~~~~~~i~~~l~wlgl--~   71 (492)
                      -|=|||.||+||+|+-.+--.+||  +..|.-+|+.          |      .+++...+.+.++..-+.|+-||+  |
T Consensus        40 ~PYpsG~lH~GH~~~~ti~Dii~Rykrm~G~~Vl~p~GwD~~GLPaE~~aik~~~~p~~~t~~nI~~~k~q~k~lG~~~D  119 (822)
T PRK00390         40 FPYPSGGLHMGHVRNYTIGDVIARYKRMQGYNVLHPMGWDAFGLPAENAAIKTGTHPAEWTYENIANMKKQLKSLGFSYD  119 (822)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99989861132556478999999998718996389897366886898999994998899999999999999998395430


Q ss_pred             CCCCCCCCCCCCCEECCCCHHHHH----HHHHHHHHCCCEEE
Q ss_conf             886765588767632326289999----99999998898245
Q gi|255764513|r   72 WDEGPDIGGAYGPYRQSERKNIYQ----PYVQNLLEKKLAFR  109 (492)
Q Consensus        72 ~De~~~~~g~~~p~~QS~r~~~y~----~~~~~L~~~g~aY~  109 (492)
                      ||.         +|.-++  +.|.    -...+|.++|++|+
T Consensus       120 W~r---------~~~T~d--p~y~~~~qw~F~~l~ekGliyr  150 (822)
T PRK00390        120 WSR---------EIATCD--PEYYKWTQWLFLKLYEKGLAYR  150 (822)
T ss_pred             CCC---------CCCCCC--HHHHHHHHHHHHHHHHCCCEEE
T ss_conf             689---------877578--7799999999999998899795


No 67 
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed
Probab=97.23  E-value=0.0029  Score=42.44  Aligned_cols=89  Identities=22%  Similarity=0.396  Sum_probs=59.8

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHH--CCCEEEEEECCCCC--------------------CC---------CCHHHHHH
Q ss_conf             8433887850159999999999997--18849999704866--------------------63---------88679999
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAKR--TGGKFILRIEDTDS--------------------KR---------STLESENA   60 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~~--~~g~f~lRieDtd~--------------------~R---------~~~~~~~~   60 (492)
                      .|-|||.||+||+++-.+--.+||-  ..|.-++++=-.|.                    .+         ...++++.
T Consensus        57 PPyanG~lH~GHaln~tlkDii~Rykrm~G~~v~~~pGwD~hGLPiE~~v~k~~g~~~~~~~~~~f~~~cr~~a~~~i~~  136 (910)
T PRK05743         57 PPYANGDIHIGHALNKILKDIIVKSKTMSGFDAPYVPGWDCHGLPIELKVEKKLGKKRKKLSAAEFRKKCREYALEQVDI  136 (910)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             99989864244778789999999998758996799996586869999999996199813199999999999999999999


Q ss_pred             HHHHHHHCCC--CCCCCCCCCCCCCCEECCCCHHHH----HHHHHHHHHCCCEEECC
Q ss_conf             9999886589--888676558876763232628999----99999999889824514
Q gi|255764513|r   61 VMQSLKWCGL--NWDEGPDIGGAYGPYRQSERKNIY----QPYVQNLLEKKLAFRCF  111 (492)
Q Consensus        61 i~~~l~wlgl--~~De~~~~~g~~~p~~QS~r~~~y----~~~~~~L~~~g~aY~c~  111 (492)
                      +.+.++-||+  +||.         ||+-.+  +.|    +....+|.++|++|+-.
T Consensus       137 ~~~q~~rlG~~~DW~~---------~y~T~d--~~y~~~~~~~F~~l~ekGliYr~~  182 (910)
T PRK05743        137 QREDFKRLGVLGDWDN---------PYLTMD--FEYEANIIRVLGKMAKKGYLYKGL  182 (910)
T ss_pred             HHHHHHHHCEEEECCC---------CEECCC--HHHHHHHHHHHHHHHHCCCEEECC
T ss_conf             9999997190264589---------726689--889999999999999869968578


No 68 
>PRK12285 tryptophanyl-tRNA synthetase; Reviewed
Probab=97.05  E-value=0.0066  Score=40.04  Aligned_cols=186  Identities=18%  Similarity=0.189  Sum_probs=98.6

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCC--------CCCCCCHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             056348433887850159999999999997188499997048--------666388679999999988658988867655
Q gi|255764513|r    7 VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDT--------DSKRSTLESENAVMQSLKWCGLNWDEGPDI   78 (492)
Q Consensus         7 v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieDt--------d~~R~~~~~~~~i~~~l~wlgl~~De~~~~   78 (492)
                      |-|-+.||  |.+|+||+-+..+.--+-+ .|...++-|-|-        +-+...+-+.+.-+.++--+|+++|-.   
T Consensus        69 lyTGrgPS--g~mHlGH~ipf~~~k~lQ~-fg~~l~I~iaDdEkfl~r~~t~ee~~~~a~eenikdiiAlGfdp~kT---  142 (369)
T PRK12285         69 VYTGRMPS--GKMHIGHKMVFDQLKWFQE-FGADVYIQIADLEAYSARGMSLEETREIAIEEYILNYIALGFDPDKT---  142 (369)
T ss_pred             EEECCCCC--CCCCCCHHHHHHHHHHHHH-CCCCEEEEECCHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCE---
T ss_conf             99366888--8755201509999999998-79968999355799872799899999999998888898708780002---


Q ss_pred             CCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEE
Q ss_conf             88767632326289999999999988982451488999776688766431000236655578833300112025774078
Q gi|255764513|r   79 GGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVR  158 (492)
Q Consensus        79 ~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR  158 (492)
                          -.|+||+....|.-++ ++ ++..      |-          .+....++.++.. |+..              +=
T Consensus       143 ----~i~~~s~~~~~y~~~~-~~-~k~~------t~----------~~~~~ifGf~~s~-nig~--------------i~  185 (369)
T PRK12285        143 ----HIYFQSENIKVYDLAF-EL-AKKV------NF----------SEVKAIYGFTGST-NIGH--------------IF  185 (369)
T ss_pred             ----EEEECCCCHHHHHHHH-HH-HHHH------HH----------HHHHHHHCCCCCC-CCEE--------------EE
T ss_conf             ----8997576378999999-99-9986------09----------9999870999999-6313--------------43


Q ss_pred             EEECCCCEEECCCCCC-CCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             8622431143047513-402136432356410004532489867887644444443112235430247889999985100
Q gi|255764513|r  159 LTVPNQGSCVFQDKVY-GEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFP  237 (492)
Q Consensus       159 ~k~p~~~~~~~~D~i~-G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~  237 (492)
                      +-.-.-..+.+..... |+       ..-.|-.--|.-|-+.|+.-|=+-       +|               .-||+.
T Consensus       186 ~p~~Qaa~~~~p~~~~~~~-------~~cLiP~giDQDP~fRltRDiA~r-------~~---------------~~lg~~  236 (369)
T PRK12285        186 APATQAADILHPQLDEYGP-------KPVVVPVGIDQDPHIRLTRDIAER-------MR---------------ISLGFI  236 (369)
T ss_pred             CCHHHHHHHHCCCCCCCCC-------CCEEEECCCCCCHHHHHHHHHHHH-------HH---------------HCCCCC
T ss_conf             0187631242435434588-------632654034544688999988887-------40---------------114888


Q ss_pred             CCHHHHHHHHHHHHCCCCCCCCCCCCH
Q ss_conf             000101455531101322122343302
Q gi|255764513|r  238 IPEFIHLPLIKNPDKSKLSKRRNPTSI  264 (492)
Q Consensus       238 ~p~f~H~pli~~~~g~klSKR~~~~~i  264 (492)
                      .|.-.|.+++.+-+|.|+|.-+...+|
T Consensus       237 kPa~ih~~flpgL~G~KMSsS~p~saI  263 (369)
T PRK12285        237 KPASTYHKFMTGLTGGKMSSSKPESAI  263 (369)
T ss_pred             CCHHHHCCCCCCCCCCCCCCCCCCCEE
T ss_conf             727775114567788987689998536


No 69 
>TIGR00435 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .   Cysteinyl-tRNA synthetase (6.1.1.16 from EC) is an alpha monomer and belongs to class Ia.; GO: 0000166 nucleotide binding, 0004817 cysteine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006423 cysteinyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=97.04  E-value=0.0038  Score=41.65  Aligned_cols=198  Identities=18%  Similarity=0.212  Sum_probs=112.0

Q ss_pred             CCHHHHHHHHH-----HHHHCCCCC-CCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHH
Q ss_conf             88679999999-----988658988-867655887676323262899999999999889824514889997766887664
Q gi|255764513|r   53 STLESENAVMQ-----SLKWCGLNW-DEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK  126 (492)
Q Consensus        53 ~~~~~~~~i~~-----~l~wlgl~~-De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~  126 (492)
                      ..+-++++.++     ||.-||+.+ |--         -+-|+.++.=.+++++|+++|.||..---  .+=  =....=
T Consensus       207 e~~~~i~aY~~qkfndD~~aLNv~~p~~~---------pr~te~id~iie~i~~L~~KgyAY~~~~G--dVY--F~v~~f  273 (660)
T TIGR00435       207 ESERFIEAYFEQKFNDDLEALNVLPPDLE---------PRVTEHIDEIIEFIEQLIEKGYAYVSDNG--DVY--FDVSKF  273 (660)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCE---------EEECCCCCHHHHHHHHHHHCCCEEEECCC--CEE--EECCCC
T ss_conf             16889999986557888874287388401---------66311243147899999868920530688--646--531677


Q ss_pred             HHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECCC-------------
Q ss_conf             3100023665557883330011202577407886224311430475134021364323564100045-------------
Q gi|255764513|r  127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSD-------------  193 (492)
Q Consensus       127 ~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~d-------------  193 (492)
                      .+.|-.-.|.|--.....++. +..|..--++.+-|+           |...   .+--||||+|+.             
T Consensus       274 ~ksPnh~YG~Ls~Wn~~~~~~-l~~g~~~~v~~~~P~-----------Ga~K---r~~~DFvLWK~~k~g~~~E~~W~SP  338 (660)
T TIGR00435       274 KKSPNHDYGKLSGWNKQSLDE-LEAGARVRVDEAKPD-----------GAKK---RNKLDFVLWKSAKEGKDQEPKWDSP  338 (660)
T ss_pred             CCCCCCCCCCCCCCCCCCHHH-HHCCCCCCCCCCCCC-----------CCCC---CCCCCHHHHHCCCCCCCCCCCCCCC
T ss_conf             888888764326755554466-625786455235887-----------5335---6776502220067887777431777


Q ss_pred             ---CCHHHHHHHHH-HHHHHHHHHHHCCCCCCCHHHHHHHH-------------------HHHHH-HCCC-HHHHHHHHH
Q ss_conf             ---32489867887-64444444311223543024788999-------------------99851-0000-010145553
Q gi|255764513|r  194 ---GMPTYHLANVI-DDHLMKITHVARGEEWISSVPKHILL-------------------YQYFN-FPIP-EFIHLPLIK  248 (492)
Q Consensus       194 ---g~ptY~~a~vv-DD~~m~ithviRg~d~~~~t~~q~~l-------------------~~al~-~~~p-~f~H~pli~  248 (492)
                         |-|--|.-|.+ =+-..|          |+|||-|+-|                   ..++| -+.- -|-|...| 
T Consensus       339 WG~GRPGWHiECS~M~~~~Lg----------ltntP~~~DIH~GG~DL~FPHHENE~Aqs~a~~gn~~~~~yW~H~G~~-  407 (660)
T TIGR00435       339 WGKGRPGWHIECSAMVDKYLG----------LTNTPDQIDIHGGGVDLIFPHHENEIAQSEALFGNKQLAKYWLHNGFL-  407 (660)
T ss_pred             CCCCCCCHHHHHHHHHHHHCC----------CCCCCCCCEECCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCEE-
T ss_conf             888888158999999997513----------567865430134887788878778999999872898568999851778-


Q ss_pred             HHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHCCCCCC
Q ss_conf             1101322122343-3024566629773779989985067666
Q gi|255764513|r  249 NPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALLFVHKS  289 (492)
Q Consensus       249 ~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalLGws~~  289 (492)
                      ..++.||||--|- +.|.++-++-|-|++|.+|+..-=|..+
T Consensus       408 ~id~eKMSKSLgNF~~v~D~L~q~~d~~~lR~~~l~~HYr~p  449 (660)
T TIGR00435       408 MIDNEKMSKSLGNFITVRDVLKQNYDPEVLRYLLLSVHYRSP  449 (660)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC
T ss_conf             976721651555688888687427689999999876553145


No 70 
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=96.87  E-value=0.014  Score=37.76  Aligned_cols=93  Identities=26%  Similarity=0.297  Sum_probs=59.1

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHH--HCCCEEEEEECCCCC-----------------------CCC---------CHH
Q ss_conf             4843388785015999999999999--718849999704866-----------------------638---------867
Q gi|255764513|r   11 IAPSPTGEPHIGTAYTALFNYLIAK--RTGGKFILRIEDTDS-----------------------KRS---------TLE   56 (492)
Q Consensus        11 faPsPtG~lH~G~~rtal~n~l~a~--~~~g~f~lRieDtd~-----------------------~R~---------~~~   56 (492)
                      =.|.+||-||+|||.+--+--.++|  +..|.=+|=+=-||.                       .|.         +++
T Consensus        40 PPPNVTG~LHmGHAl~~tl~D~l~RykRM~G~~vl~~pG~DhAGIaTq~~VEk~l~~~g~~r~d~gRe~Fl~~~weWk~e  119 (877)
T COG0525          40 PPPNVTGSLHMGHALNYTLQDILARYKRMRGYNVLWPPGTDHAGIATQVVVEKQLAAEGITRHDLGREEFLKKCWEWKEE  119 (877)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             97998886511654537899999999870797333579877788308999999998709880105899999999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCEECCC--CHHHHHHHHHHHHHCCCEEEC
Q ss_conf             999999998865898886765588767632326--289999999999988982451
Q gi|255764513|r   57 SENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSE--RKNIYQPYVQNLLEKKLAFRC  110 (492)
Q Consensus        57 ~~~~i~~~l~wlgl~~De~~~~~g~~~p~~QS~--r~~~y~~~~~~L~~~g~aY~c  110 (492)
                      +...|.+.++-||...|=.-       -|+-..  ....-+++.-+|-++|+.|+.
T Consensus       120 ~~~~I~~Q~~rLG~S~DWsr-------E~fTmD~~~s~av~~~Fv~Ly~~GlIYr~  168 (877)
T COG0525         120 SGGTIREQLRRLGVSVDWSR-------ERFTMDPGLSRAVQEAFVRLYEKGLIYRG  168 (877)
T ss_pred             HHHHHHHHHHHHCCCCCCCC-------CCCCCCHHHHHHHHHHHHHHHHCCCEEEC
T ss_conf             98999999998478735553-------11267988999999999999978946514


No 71 
>cd00672 CysRS_core This is the catalytic core domain of cysteinyl tRNA synthetase (CysRS).  This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.
Probab=96.82  E-value=0.006  Score=40.32  Aligned_cols=169  Identities=20%  Similarity=0.199  Sum_probs=94.7

Q ss_pred             CCCCCCCCCHHHHHHHHH-----HHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEE
Q ss_conf             843388785015999999-----999999718849999704866638867999999998865898886765588767632
Q gi|255764513|r   12 APSPTGEPHIGTAYTALF-----NYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYR   86 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~-----n~l~a~~~~g~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~~   86 (492)
                      .|.+-++.||||+||+++     -||-+.-+.-+|+.-|-|.|         +.|++.-.-.|+.|.|-           
T Consensus        27 GPTVYd~~HiGhaR~~v~~D~l~R~L~~~gy~V~~V~NITDID---------DKII~~A~~~~~~~~el-----------   86 (213)
T cd00672          27 GPTVYDYAHIGHARTYVVFDVLRRYLEDLGYKVRYVQNITDID---------DKIIKRAREEGLSIKEV-----------   86 (213)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECCCC---------HHHHHHHHHCCCCHHHH-----------
T ss_conf             9968899876534257689999999996399358999726751---------89999999839999999-----------


Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCE
Q ss_conf             32628999999999998898245148899977668876643100023665557883330011202577407886224311
Q gi|255764513|r   87 QSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGS  166 (492)
Q Consensus        87 QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~~~~  166 (492)
                      -.+-.+.|.+-.+.|   |..                     .|..|++                    |          
T Consensus        87 a~~y~~~f~~d~~~L---ni~---------------------~p~~~Pr--------------------a----------  112 (213)
T cd00672          87 AEYYTAEFFEDMKAL---NVL---------------------PPDVYPR--------------------V----------  112 (213)
T ss_pred             HHHHHHHHHHHHHHH---CCC---------------------CCCCCCC--------------------E----------
T ss_conf             999999999999982---899---------------------9981354--------------------5----------


Q ss_pred             EECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH-HHC-CCHHHHH
Q ss_conf             43047513402136432356410004532489867887644444443112235430247889999985-100-0001014
Q gi|255764513|r  167 CVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYF-NFP-IPEFIHL  244 (492)
Q Consensus       167 ~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al-~~~-~p~f~H~  244 (492)
                        |+      |  ....+.           +-.|-..+|=|-=|+.++.-   |-.|.-.|-   +|+ |-+ .--|.|.
T Consensus       113 --WH------i--ECsaM~-----------~~~lg~~~DIH~GG~DL~FP---HHeNE~AQs---~a~~~~~~a~~W~H~  165 (213)
T cd00672         113 --WH------I--ECSAMS-----------MKYLGETFDIHGGGVDLIFP---HHENEIAQS---EAAFGKPFARYWLHT  165 (213)
T ss_pred             --EE------E--ECHHHH-----------HHHHCCCEEEECCCCCCCCC---CCCCHHHHH---HHHHCCCCCCEEEEH
T ss_conf             --20------1--459998-----------98828962563476356589---970499998---886589960100034


Q ss_pred             HHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHH
Q ss_conf             55531101322122343-3024566629773779989985
Q gi|255764513|r  245 PLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLAL  283 (492)
Q Consensus       245 pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLal  283 (492)
                      .++ ..+|+||||.-|. +.|.++. +||-|+++.-++..
T Consensus       166 g~l-~~~g~KMSKSlgN~~~i~dll-~~~~~~~~R~~lls  203 (213)
T cd00672         166 GHL-TIDGEKMSKSLGNFITVRDAL-KKYDPEVLRLALLS  203 (213)
T ss_pred             HHH-HHCCCEECCCCCCEEEHHHHH-HCCCHHHHHHHHHH
T ss_conf             578-727564034578752699998-43999999999982


No 72 
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=96.64  E-value=0.0041  Score=41.42  Aligned_cols=95  Identities=27%  Similarity=0.345  Sum_probs=63.5

Q ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHH--HCCCEEEE----------EEC------CCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             634843388785015999999999999--71884999----------970------486663886799999999886589
Q gi|255764513|r    9 VRIAPSPTGEPHIGTAYTALFNYLIAK--RTGGKFIL----------RIE------DTDSKRSTLESENAVMQSLKWCGL   70 (492)
Q Consensus         9 ~RfaPsPtG~lH~G~~rtal~n~l~a~--~~~g~f~l----------Rie------Dtd~~R~~~~~~~~i~~~l~wlgl   70 (492)
                      +=-=|=|+|.||+||+||-...-.+||  +..|.=+|          =+|      -+|+.--+..+.+...+.|+-+|+
T Consensus        39 l~mfPYpSG~LHvGH~r~Yti~Dv~aRykRm~GyNVL~PMGwdafGlPae~~A~~~~~~P~~wt~~ni~~~k~qlk~lG~  118 (814)
T COG0495          39 LVMFPYPSGALHVGHVRNYTIGDVIARYKRMQGYNVLHPMGWDAFGLPAENAAIKIGTDPAKWTYYNIAYMKKQLKSLGF  118 (814)
T ss_pred             EECCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEECCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             86787888873468541210899999999856972145675566686399999985789699999999999999998087


Q ss_pred             --CCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEEC
Q ss_conf             --8886765588767632326289999999999988982451
Q gi|255764513|r   71 --NWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC  110 (492)
Q Consensus        71 --~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c  110 (492)
                        ||+-....-.|.  |+.     -=|-...+|.++|+||.-
T Consensus       119 siDW~Ref~T~Dp~--Yyk-----~~QW~F~kL~ekGL~y~~  153 (814)
T COG0495         119 SIDWRREFATCDPE--YYK-----WIQWQFLKLYEKGLAYRK  153 (814)
T ss_pred             CCCCCCCEECCCCC--HHH-----HHHHHHHHHHHCCCEEEC
T ss_conf             61235545647964--779-----999999999977988852


No 73 
>TIGR00456 argS arginyl-tRNA synthetase; InterPro: IPR001278   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .   Arginyl-tRNA synthetase (6.1.1.19 from EC) has been crystallized and preliminary X-ray crystallographic analysis of yeast arginyl-tRNA synthetase-yeast tRNAArg complexes is available . ; GO: 0000166 nucleotide binding, 0004814 arginine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006420 arginyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=96.51  E-value=0.0015  Score=44.37  Aligned_cols=63  Identities=21%  Similarity=0.211  Sum_probs=48.1

Q ss_pred             EEEEECCCC--------CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHH-HCCCEEEC
Q ss_conf             999970486--------66388679999999988658988867655887676323262899999999999-88982451
Q gi|255764513|r   41 FILRIEDTD--------SKRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLL-EKKLAFRC  110 (492)
Q Consensus        41 f~lRieDtd--------~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~-~~g~aY~c  110 (492)
                      +++..|+-|        -.|.++-+.+.|.++|+-|++.+|+-...       -||.|-..+...+++|. +.|+++..
T Consensus       227 ~~~~~e~gdnNe~~~~~w~~~~~~~l~~~k~tl~~lni~~D~~~~E-------~E~~~~~~~~~v~e~L~k~~gl~~ed  298 (600)
T TIGR00456       227 LFVKLESGDNNEKTIKLWKRLVEYALEGIKETLKRLNIHFDEFVWE-------GESVKNGKVPKVLEDLKKEKGLVVED  298 (600)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEC-------CEEEECCCHHHHHHHHHHHCCCEEEC
T ss_conf             9997432444289999999999999999999998629650058854-------04577486078999863103780674


No 74 
>TIGR00396 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    Leucyl tRNA synthetase (6.1.1.4 from EC) is an alpha monomer that belongs to class Ia. There are two different families of leucyl-tRNA synthetases. This family includes the eubacterial and mitochondrial synthetases. The crystal structure of leucyl-tRNA synthetase from the hyperthermophile Thermus thermophilus has an overall architecture that is similar to that of isoleucyl-tRNA synthetase, except that the putative editing domain is inserted at a different position in the primary structure. This feature is unique to prokaryote-like leucyl-tRNA synthetases, as is the presence of a novel additional flexibly inserted domain . ; GO: 0000166 nucleotide binding, 0004823 leucine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006429 leucyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=96.47  E-value=0.0075  Score=39.68  Aligned_cols=93  Identities=23%  Similarity=0.312  Sum_probs=67.8

Q ss_pred             CCCCCC-CCHHHHHHHHHHHHHHHHC--CCEEEEE---------------EC-CCCCCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             433887-8501599999999999971--8849999---------------70-486663886799999999886589888
Q gi|255764513|r   13 PSPTGE-PHIGTAYTALFNYLIAKRT--GGKFILR---------------IE-DTDSKRSTLESENAVMQSLKWCGLNWD   73 (492)
Q Consensus        13 PsPtG~-lH~G~~rtal~n~l~a~~~--~g~f~lR---------------ie-Dtd~~R~~~~~~~~i~~~l~wlgl~~D   73 (492)
                      |=|+|. ||+||+|.--+.=.+||-+  .|.=+|.               |+ -|++...+.+-.+....-|+-||+.+|
T Consensus        40 PYPSG~GLH~GHvR~YTItDvl~Ry~r~~GynVLHP~GwDAFGLPAEnaAI~~~~~P~~WT~~NI~~m~~Ql~~LGf~yD  119 (916)
T TIGR00396        40 PYPSGAGLHMGHVRNYTITDVLSRYKRMKGYNVLHPMGWDAFGLPAENAAIKRGIHPAKWTYENIANMKKQLQALGFSYD  119 (916)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             79560775016514235764999999862883247667574564258999864898700378999999999998455644


Q ss_pred             CCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEEC
Q ss_conf             6765588767632326289999999999988982451
Q gi|255764513|r   74 EGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC  110 (492)
Q Consensus        74 e~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c  110 (492)
                      =-=+...----||+     -=|-..-+|-++|+||.-
T Consensus       120 w~RE~~T~~P~YYk-----wtQWiF~~Lf~kGLaY~k  151 (916)
T TIGR00396       120 WDREIATCDPEYYK-----WTQWIFLELFEKGLAYVK  151 (916)
T ss_pred             HHCCCCCCCCCCCH-----HHHHHHHHHHHCCCEEEE
T ss_conf             11053238887433-----666888999762852763


No 75 
>TIGR00233 trpS tryptophanyl-tRNA synthetase; InterPro: IPR002306   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    Tryptophanyl-tRNA synthetase (6.1.1.2 from EC) is an alpha2 dimer that belongs to class Ib. The crystal structure of tryptophanyl-tRNA synthetase is known .; GO: 0000166 nucleotide binding, 0004830 tryptophan-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006436 tryptophanyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=96.41  E-value=0.01  Score=38.68  Aligned_cols=217  Identities=18%  Similarity=0.274  Sum_probs=119.1

Q ss_pred             CCCC-CCCHHHHHHHHHHHHHHH-HCCCEEEEEECCCC---------CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             3388-785015999999999999-71884999970486---------663886799999999886589888676558876
Q gi|255764513|r   14 SPTG-EPHIGTAYTALFNYLIAK-RTGGKFILRIEDTD---------SKRSTLESENAVMQSLKWCGLNWDEGPDIGGAY   82 (492)
Q Consensus        14 sPtG-~lH~G~~rtal~n~l~a~-~~~g~f~lRieDtd---------~~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~   82 (492)
                      -||| .+||||.=+|+.+|...- |.+=..+.-|=|--         .+-...-+...++.++==+|||++-.       
T Consensus        10 ~PSGd~~HlGnylg~~~~~~~~~~q~~~~~~~~~aD~ha~~~~~~l~~~~~~~~~~~e~~~~~lA~GlDP~K~-------   82 (366)
T TIGR00233        10 QPSGDKMHLGNYLGAIRLKVLQEEQEGYELFFCIADLHAITVKQDLTDPDTLRKAREELVADYLAVGLDPEKT-------   82 (366)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHE-------
T ss_conf             5768764433006678888777431689768997372565146788817789999999999998726473146-------


Q ss_pred             CCEECCCCH---HHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEE
Q ss_conf             763232628---99999999999889824514889997766887664310002366555788333001120257740788
Q gi|255764513|r   83 GPYRQSERK---NIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRL  159 (492)
Q Consensus        83 ~p~~QS~r~---~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~  159 (492)
                      ..|.||+..   ++|+ .+-.|       -|.-|--|++++          +.|-+..        ....++|..+.+- 
T Consensus        83 ~~f~QS~~~G~~~~~~-l~~~l-------~~~~~~g~l~r~----------~qFK~~~--------~~~~~~n~d~~~~-  135 (366)
T TIGR00233        83 TIFLQSEVPGGTEHYE-LAWLL-------SCVVTFGELKRM----------TQFKDKS--------DLKQAENEDPTVN-  135 (366)
T ss_pred             EEEEECCCCCCHHHHH-HHHHH-------HHHHHHHHHHHH----------CCCCCHH--------HHHHHCCCCCCEE-
T ss_conf             7875057665145789-99999-------876516764010----------0477412--------2122148986112-


Q ss_pred             EECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHH----HH
Q ss_conf             62243114304751340213643235641000453248986788764444444311223543024788999998----51
Q gi|255764513|r  160 TVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQY----FN  235 (492)
Q Consensus       160 k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~a----l~  235 (492)
                               ....--|.+.+       |||+=+|=. .|.+-.+.-+. -.=-+|==|+|=-+--=...-|-+=    +|
T Consensus       136 ---------~~~v~~Gl~~y-------P~lmAADIL-~~~~d~~~~~~-~~~c~VPVG~DQ~qHleLTRD~A~Rf~~~f~  197 (366)
T TIGR00233       136 ---------LKEVSIGLLSY-------PVLMAADIL-LYQADEILGPE-KKPCLVPVGIDQDQHLELTRDLAERFNKKFK  197 (366)
T ss_pred             ---------ECCCCEEEECC-------CHHHHHHHH-CCCCHHHCCCC-CCEEEEECCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             ---------00111120126-------477763431-35660125799-9705850058885268898899999988713


Q ss_pred             --HCCCHHHHH---HHHHHHHC--CCCCCCCCC--CCHHHHHHCCCCHHHHHHHHHHCCC
Q ss_conf             --000001014---55531101--322122343--3024566629773779989985067
Q gi|255764513|r  236 --FPIPEFIHL---PLIKNPDK--SKLSKRRNP--TSISYYSAMGYLPEALINFLALLFV  286 (492)
Q Consensus       236 --~~~p~f~H~---pli~~~~g--~klSKR~~~--~~i~~~~~~GylPeAilNyLalLGw  286 (492)
                        +..|+..|.   |-|++.++  +||||-+..  ..| .+-+   .|+.|-+=+-+.-.
T Consensus       198 ~~f~~P~~~~~~~~~~l~gl~~P~kKMSkS~p~~~~~I-fL~D---~p~~~~kKI~~~~t  253 (366)
T TIGR00233       198 NFFKLPESLISKFGARLMGLQGPKKKMSKSDPNQNSAI-FLTD---TPKQIKKKIKKAAT  253 (366)
T ss_pred             CCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCEE-CCCC---CHHHHHHHHHHHCC
T ss_conf             32358602331013446687878535555678888202-0798---98999999775204


No 76 
>KOG2007 consensus
Probab=94.47  E-value=0.21  Score=29.80  Aligned_cols=236  Identities=18%  Similarity=0.162  Sum_probs=132.5

Q ss_pred             EEECCCCCCCC--CCHHHHHHHH---HHHHHHH---HCCCEEEEEECCCCC---CCCCH---------------HHHHHH
Q ss_conf             56348433887--8501599999---9999999---718849999704866---63886---------------799999
Q gi|255764513|r    8 RVRIAPSPTGE--PHIGTAYTAL---FNYLIAK---RTGGKFILRIEDTDS---KRSTL---------------ESENAV   61 (492)
Q Consensus         8 ~~RfaPsPtG~--lH~G~~rtal---~n~l~a~---~~~g~f~lRieDtd~---~R~~~---------------~~~~~i   61 (492)
                      +|=+.=-||-|  -|+|+||+++   +.+-+-+   .++-.|+.-|-|.|-   .|-..               -+++..
T Consensus        56 v~wY~CGpTvYD~SHmGHArsYVsfDIlrRiL~dyfgy~V~~vmNiTDVDDKII~RAr~~~m~e~~~~l~~~F~~~e~eF  135 (586)
T KOG2007          56 VTWYICGPTVYDSSHMGHARSYVSFDILRRILRDYFGYDVTFVMNITDVDDKIIKRARKEEMGEKPLSLSERFCYYEEEF  135 (586)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             78997068013412210146662299999999997286369994355204899987655230234121899888889999


Q ss_pred             HHHHHHCCCCC-CCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             99988658988-86765588767632326289999999999988982451488999776688766431000236655578
Q gi|255764513|r   62 MQSLKWCGLNW-DEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKL  140 (492)
Q Consensus        62 ~~~l~wlgl~~-De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l  140 (492)
                      ..|+.-|..-+ |-         .-+-|+..+--..+++++|+.|.||..--|- -.+       -.+.+.. .|++   
T Consensus       136 ~~DM~~LnvLpPtv---------~tRVSeyvp~II~fIqkIIdnG~aY~~dGsV-YFd-------v~kf~~~-YgKL---  194 (586)
T KOG2007         136 LQDMAALNVLPPTV---------QTRVSEYVPQIIKFIQKIIDNGYAYAVDGSV-YFD-------VDKFPHS-YGKL---  194 (586)
T ss_pred             HHHHHHHCCCCCCC---------CCHHHHCHHHHHHHHHHHHHCCCEEEECCCE-EEE-------CCCCCCH-HHHH---
T ss_conf             98999808899853---------0145424478999999998478536527808-986-------4446541-3543---


Q ss_pred             CHHHHHHHHHCCCCCEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECC-------------CCCHHHHHHH-HHHH
Q ss_conf             8333001120257740788622431143047513402136432356410004-------------5324898678-8764
Q gi|255764513|r  141 SSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKS-------------DGMPTYHLAN-VIDD  206 (492)
Q Consensus       141 ~~~e~~~~~~~g~~~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~-------------dg~ptY~~a~-vvDD  206 (492)
                      ..+.  +...+|+           +...  |.       .-..-.||.|+|+             .|-|-.|.-| |+--
T Consensus       195 ~G~~--~~~~~gE-----------g~l~--ds-------~KR~p~DFALWKAsK~gEP~WeSPWG~GRPGWHIECSaMas  252 (586)
T KOG2007         195 VGQR--KNLQEGE-----------GVLS--DS-------RKRSPADFALWKASKPGEPSWESPWGKGRPGWHIECSAMAS  252 (586)
T ss_pred             CCCH--HHCCCCC-----------CCCC--CC-------CCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEHHHHH
T ss_conf             1715--3234676-----------7544--34-------67880245666404899988879888999974564077777


Q ss_pred             HHHHHHHHHCC--C----CCCCHHHHHHHHHHHHH-HCCCHHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHH
Q ss_conf             44444431122--3----54302478899999851-00000101455531101322122343-30245666297737799
Q gi|255764513|r  207 HLMKITHVARG--E----EWISSVPKHILLYQYFN-FPIPEFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALI  278 (492)
Q Consensus       207 ~~m~ithviRg--~----d~~~~t~~q~~l~~al~-~~~p~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAil  278 (492)
                      +..|-+.=|-|  -    -|-.|--.|-.-+---. | +-=|.|..-+ ..+|.||||--+. ++|.+.-+ -|.|.++.
T Consensus       253 ~~lG~~lDIH~GG~DL~FPHHeNEiAQ~eA~~~~~~w-VnYflHtGhL-~i~g~KMSKSLkNFiTIke~Lk-~~sp~qLR  329 (586)
T KOG2007         253 AILGSQLDIHGGGIDLAFPHHENEIAQSEAAFDDSQW-VNYFLHTGHL-TINGEKMSKSLKNFITIKEALK-KYSPRQLR  329 (586)
T ss_pred             HHHCCCCCEECCCCCCCCCCCCCHHHHHHHHHCCCCC-CEEEEECCEE-EECCCHHHHHHCCCEEHHHHHH-HCCHHHHH
T ss_conf             7626554201685043378752088888887638755-1257875736-6511104333204143999997-63989999


Q ss_pred             HHHHHCCCCCC
Q ss_conf             89985067666
Q gi|255764513|r  279 NFLALLFVHKS  289 (492)
Q Consensus       279 NyLalLGws~~  289 (492)
                      -++.+--|...
T Consensus       330 l~fl~~~wr~~  340 (586)
T KOG2007         330 LAFLLHQWRSP  340 (586)
T ss_pred             HHHHHHHHCCC
T ss_conf             99998775676


No 77 
>KOG0435 consensus
Probab=94.30  E-value=0.036  Score=35.07  Aligned_cols=95  Identities=27%  Similarity=0.404  Sum_probs=59.4

Q ss_pred             CEEEECCCCCCCCCCHHHHHHHHHHHHHHH---HCCCE---------EEEEECCCCCCCCC------HHHHHHHHHHHHH
Q ss_conf             705634843388785015999999999999---71884---------99997048666388------6799999999886
Q gi|255764513|r    6 KVRVRIAPSPTGEPHIGTAYTALFNYLIAK---RTGGK---------FILRIEDTDSKRST------LESENAVMQSLKW   67 (492)
Q Consensus         6 ~v~~RfaPsPtG~lH~G~~rtal~n~l~a~---~~~g~---------f~lRieDtd~~R~~------~~~~~~i~~~l~w   67 (492)
                      |-..--=|=|+|.||||++|..-+.-.+||   +.|=.         |=|--|.--.+|.+      ..-.+..-+-|.-
T Consensus        59 KYiLsMFPYPSG~LHiGHvRVYTIsD~laRf~rm~GynVihPMGWDaFGLPAENAAiergv~P~sWT~~NI~~Mk~Ql~~  138 (876)
T KOG0435          59 KYILSMFPYPSGALHIGHVRVYTISDILARFYRMKGYNVIHPMGWDAFGLPAENAAIERGVHPASWTINNIAKMKQQLKS  138 (876)
T ss_pred             CEEEEECCCCCCCCCCCCEEEEEEHHHHHHHHHHCCCEEECCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             36997367888761126427997258899999854864215776303488356678754889205469899999999997


Q ss_pred             CCC--CCCCCCCCCCCCCCEECCCCHHHHHH----HHHHHHHCCCEEECC
Q ss_conf             589--88867655887676323262899999----999999889824514
Q gi|255764513|r   68 CGL--NWDEGPDIGGAYGPYRQSERKNIYQP----YVQNLLEKKLAFRCF  111 (492)
Q Consensus        68 lgl--~~De~~~~~g~~~p~~QS~r~~~y~~----~~~~L~~~g~aY~c~  111 (492)
                      +|+  +||...           |-..+.|.+    ..-+|-+.|+||..-
T Consensus       139 lg~~FDWdrEi-----------STC~PdYYKWTQwiFlkLfe~GLAYq~E  177 (876)
T KOG0435         139 LGISFDWDREI-----------STCEPDYYKWTQWIFLKLFEKGLAYQAE  177 (876)
T ss_pred             CCCCCCCCCCC-----------CCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             37601245532-----------3478315678999999999711221113


No 78 
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed
Probab=94.25  E-value=0.3  Score=28.77  Aligned_cols=72  Identities=14%  Similarity=0.222  Sum_probs=39.1

Q ss_pred             HHHHHCCCCCCCHHHHHHHHHHHHHH-CC---C-HHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHHC
Q ss_conf             44311223543024788999998510-00---0-0101455531101322122343-30245666297737799899850
Q gi|255764513|r  211 ITHVARGEEWISSVPKHILLYQYFNF-PI---P-EFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLALL  284 (492)
Q Consensus       211 ithviRg~d~~~~t~~q~~l~~al~~-~~---p-~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLalL  284 (492)
                      +.-.+-|.||+.|-- --.+|...+. ..   | ......+++ .+|+||||..|- ++..+..+ -|=++|+.=|++..
T Consensus       525 ~D~~~~G~D~i~~hl-~f~~~~~~aif~~~~~pk~v~~~G~Vl-~eG~KMSKSkGNvV~P~eiI~-~YGADalRl~l~~~  601 (888)
T PRK12300        525 LDWRHSGKDLIPNHL-TFFIFNHVAIFPEEKWPRGIVVNGFVL-LEGKKMSKSKGNVLPLREAIE-EYGADVVRLYLAST  601 (888)
T ss_pred             CCCCCCCEEHHHHHH-HHHHHHHHHHHCCCCCCCEEEEEEEEE-CCCEECCCCCCCCCCHHHHHH-HCCCCHHHHHHHHC
T ss_conf             601435310335679-999988688717777887579832894-598770303489899899997-61962999999971


Q ss_pred             C
Q ss_conf             6
Q gi|255764513|r  285 F  285 (492)
Q Consensus       285 G  285 (492)
                      |
T Consensus       602 a  602 (888)
T PRK12300        602 A  602 (888)
T ss_pred             C
T ss_conf             8


No 79 
>KOG2713 consensus
Probab=93.15  E-value=0.4  Score=27.95  Aligned_cols=153  Identities=24%  Similarity=0.271  Sum_probs=86.6

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHC---CCEEEEEECCCCC---CCCCHHHHHHHHH---HHHHCCCCCCCCCCCCCCCC
Q ss_conf             4338878501599999999999971---8849999704866---6388679999999---98865898886765588767
Q gi|255764513|r   13 PSPTGEPHIGTAYTALFNYLIAKRT---GGKFILRIEDTDS---KRSTLESENAVMQ---SLKWCGLNWDEGPDIGGAYG   83 (492)
Q Consensus        13 PsPtG~lH~G~~rtal~n~l~a~~~---~g~f~lRieDtd~---~R~~~~~~~~i~~---~l~wlgl~~De~~~~~g~~~   83 (492)
                      =-|||-+|+||--.|+=+|.--...   |-..++-|-|.-.   +-.....-+.+.+   .|--+||++.-.       -
T Consensus        20 IQPTG~~HLGNYLGai~~Wv~LQ~~~d~~~~~~f~vvDlHaITvp~dp~~lrq~~~dm~A~lLAcGIdp~Ks-------~   92 (347)
T KOG2713          20 IQPTGIPHLGNYLGAIKPWVQLQNEYDKNILVLFSVVDLHAITVPQDPAELRQATHDMAASLLACGIDPEKS-------S   92 (347)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEECEEECCCCCHHHHHHHHHHHHHHHHHHCCCCCCC-------E
T ss_conf             677887214435425368999988753786279998611001279984899888999999999835682222-------1


Q ss_pred             CEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             63232628999999999998898245148899977668876643100023665557883330011202577407886224
Q gi|255764513|r   84 PYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPN  163 (492)
Q Consensus        84 p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~k~p~  163 (492)
                      .++||+--+.- + ...|+      -|-.|--.|..+                                  +-|+-|.. 
T Consensus        93 lF~QS~Vpqh~-e-l~WlL------sslt~mg~L~rm----------------------------------~Q~KeKs~-  129 (347)
T KOG2713          93 LFVQSDVPQHA-E-LSWLL------SSLTTMGRLARM----------------------------------PQWKEKSE-  129 (347)
T ss_pred             EEEECCCHHHH-H-HHHHH------HHCCCHHHHHHH----------------------------------HHHHHHHH-
T ss_conf             66402435888-9-99999------835441888750----------------------------------78876422-


Q ss_pred             CCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             3114304751340213643235641000453248986788764444444311223543024788999998510
Q gi|255764513|r  164 QGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNF  236 (492)
Q Consensus       164 ~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~  236 (492)
                             +          ...+|+-+    |..||-.--+-|=.+.+-|||=-|||-..-.-.-..|-++||-
T Consensus       130 -------~----------~~~~~~~v----GLftYPvLqAADILLYksThVPVGeDQsQHleL~r~lA~~fN~  181 (347)
T KOG2713         130 -------R----------FKVGDVPV----GLFTYPVLQAADILLYKSTHVPVGEDQSQHLELARHLAQAFNK  181 (347)
T ss_pred             -------H----------HCCCCCCE----EEECCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             -------4----------02676420----1131246766557650365346773189999999999999865


No 80 
>KOG0432 consensus
Probab=91.61  E-value=0.86  Score=25.71  Aligned_cols=92  Identities=27%  Similarity=0.371  Sum_probs=62.9

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHC--CCEEEEEECCCCCC-------------------C---C-----------CHH
Q ss_conf             84338878501599999999999971--88499997048666-------------------3---8-----------867
Q gi|255764513|r   12 APSPTGEPHIGTAYTALFNYLIAKRT--GGKFILRIEDTDSK-------------------R---S-----------TLE   56 (492)
Q Consensus        12 aPsPtG~lH~G~~rtal~n~l~a~~~--~g~f~lRieDtd~~-------------------R---~-----------~~~   56 (492)
                      .|.=||.||||+|-|.-.--.+||.+  .|.=+|=+--||..                   |   .           +++
T Consensus        83 PPNVTG~LHiGHALt~aiqD~i~R~~rm~G~~vlw~PG~DHAGIATQ~VVEK~l~~~~~~~Rh~lgRe~F~~~vw~Wk~e  162 (995)
T KOG0432          83 PPNVTGSLHIGHALTVAIQDALARYNRMHGYQVLWVPGTDHAGIATQVVVEKQLAREGGKTRHDLGREEFLKEVWEWKEE  162 (995)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCHHHCCHHHHHHHHHHHHHH
T ss_conf             99765631065788878899999999825975332488663352479999999987158632114899999999999988


Q ss_pred             HHHHHHHHHHHCC--CCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEEC
Q ss_conf             9999999988658--98886765588767632326289999999999988982451
Q gi|255764513|r   57 SENAVMQSLKWCG--LNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC  110 (492)
Q Consensus        57 ~~~~i~~~l~wlg--l~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c  110 (492)
                      +-..|++.|+-||  ++||-..-..       -.++-.--.++.-+|-++|+.|+.
T Consensus       163 ~g~~I~~Qlk~lGas~DW~re~fTm-------D~~~s~AV~eAFvrL~eeglIyR~  211 (995)
T KOG0432         163 YGGRIYNQLKRLGASLDWDREAFTM-------DPKLSRAVTEAFVRLHEEGLIYRA  211 (995)
T ss_pred             HCCCHHHHHHHHCCCCCCCHHHCCC-------CHHHHHHHHHHHHHHHHCCCEEEC
T ss_conf             5851999999835732014756034-------778889999999998764846733


No 81 
>COG0162 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=77.86  E-value=1.7  Score=23.64  Aligned_cols=66  Identities=15%  Similarity=0.086  Sum_probs=53.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             489867887644444443112235430247889999985100000101455531101322122343
Q gi|255764513|r  196 PTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNP  261 (492)
Q Consensus       196 ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~  261 (492)
                      ..|.+--+-|=..++..-=+=|.|-.-|--.-+.+.+.+|...|.-.|+|||.+.+|+|+||-.+.
T Consensus       166 f~YpLmQayD~~~L~~dlq~GG~DQ~~ni~~grdl~rr~g~~~~~~lt~PLL~~ldG~KmgKs~~~  231 (401)
T COG0162         166 FNYPLLQAYDFVYLNKDLQLGGSDQWGNILAGRDLIRRLGQKKVVGLTTPLLTGLDGKKMGKSEGG  231 (401)
T ss_pred             HHHHHHHHHHHHHHCCCHHCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             446889888799974523118767899999999999980899728998355038988815666778


No 82 
>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    Leucyl tRNA synthetase (6.1.1.4 from EC) is an alpha monomer that belongs to class Ia. There are two different families of leucyl-tRNA synthetases. This family includes both archaeal and cytosolic eukaryotic leucyl-tRNA synthetases.; GO: 0000166 nucleotide binding, 0004823 leucine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006429 leucyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=69.55  E-value=0.4  Score=27.91  Aligned_cols=113  Identities=13%  Similarity=0.150  Sum_probs=62.1

Q ss_pred             HHCCCCCCCH-----HHHHHHHHHHHHHC--CCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCC
Q ss_conf             1122354302-----47889999985100--0001014555311013221223433024566629773779989985067
Q gi|255764513|r  214 VARGEEWISS-----VPKHILLYQYFNFP--IPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFV  286 (492)
Q Consensus       214 viRg~d~~~~-----t~~q~~l~~al~~~--~p~f~H~pli~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLalLGw  286 (492)
                      =+=|.|+++|     -.-|+.||=-=+|+  +-.|+|+-|    +|+||||-.|.+-.-.=--+-|=.++..=|++.-|=
T Consensus       695 r~SgKDLi~NHLtFyiF~HvAiFP~~~WPrGi~vnG~~~L----eg~KmSkSkGn~l~l~~~vekfGADv~Rl~~~~aAe  770 (1109)
T TIGR00395       695 RISGKDLIPNHLTFYIFHHVAIFPEKFWPRGIVVNGYVLL----EGKKMSKSKGNVLTLKEAVEKFGADVARLYILDAAE  770 (1109)
T ss_pred             CCCCCCCCHHHHHHHHHHEEEECCCCCCCCEEEEEEEEEE----ECCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHCCC
T ss_conf             0243101034677664400242487989761799757887----173405454762238899987276189999973178


Q ss_pred             CCCCC---CH-------HHCCHHHHHHHHHHH--------HCC--CCCCCCHHHHHHHHHHHHHH
Q ss_conf             66655---30-------110146777652021--------137--55442015655664355551
Q gi|255764513|r  287 HKSED---DD-------ELMDMQQLIHHFDLH--------HLS--KAGAVFDKQKLDWLNGRWIR  331 (492)
Q Consensus       287 s~~~~---d~-------Eifsl~eli~~FdL~--------~I~--Ks~A~FD~eKL~wlN~qyIr  331 (492)
                      -+..-   ++       .++.+.++.+.-...        +++  =--..||.-=+.-||+. ||
T Consensus       771 ~~~Dad~~~~e~~~~~~~L~~l~~~a~e~~~~~~GrPvl~e~GPaE~~~f~D~wl~~~l~~~-i~  834 (1109)
T TIGR00395       771 LVQDADWKESEVEGTKKRLERLYEFAEEITKKSDGRPVLLEVGPAEELSFIDRWLLSRLNKA-IK  834 (1109)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHH-HH
T ss_conf             72135610677899999999999999998543068401103577763105218999999999-99


No 83 
>PRK13354 tyrosyl-tRNA synthetase; Provisional
Probab=69.04  E-value=5.3  Score=20.34  Aligned_cols=80  Identities=15%  Similarity=0.108  Sum_probs=58.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHH-HHHHHHHHHCC-CCCCCCC-CCCHHHHHHCCCC
Q ss_conf             8986788764444444311223543024788999998510000010-14555311013-2212234-3302456662977
Q gi|255764513|r  197 TYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI-HLPLIKNPDKS-KLSKRRN-PTSISYYSAMGYL  273 (492)
Q Consensus       197 tY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~-H~pli~~~~g~-klSKR~~-~~~i~~~~~~Gyl  273 (492)
                      +|.+--.-|=..++++-=|=|-|-.-|--.=+.|.+-++-+ |.|+ .+|||.+.||+ |+||--| ++.+..      .
T Consensus       172 ~Y~llQayD~~~L~~~iqiGGsDQ~gNi~~G~dL~r~~~~~-~~~~lT~PLL~~~dG~~KmgKS~gnaIwLd~------s  244 (405)
T PRK13354        172 FYPLLQAYDSVHLDADIELGGTDQWFNILMGRDLQRKLGEE-KQVGITMPLLEGLDGTEKMSKSLGNYIGLDE------S  244 (405)
T ss_pred             HHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHHHHCCC-CCEEEEECCEECCCCCCCCCCCCCCCEECCC------C
T ss_conf             67888886499868837995086888999799999985789-8359960615788775532501278631479------8


Q ss_pred             HHHHHHHHHH
Q ss_conf             3779989985
Q gi|255764513|r  274 PEALINFLAL  283 (492)
Q Consensus       274 PeAilNyLal  283 (492)
                      |..+..|...
T Consensus       245 p~~~yq~~~n  254 (405)
T PRK13354        245 PNEFYQKWMS  254 (405)
T ss_pred             HHHHHHHHHH
T ss_conf             8999999972


No 84 
>KOG0156 consensus
Probab=68.11  E-value=4.3  Score=20.96  Aligned_cols=56  Identities=25%  Similarity=0.312  Sum_probs=36.8

Q ss_pred             EEECCCCCCCCCCHHHHHHHHHH------HHHHHHCCCEEEEEECCCCC-CCCCHHHHHHHHH
Q ss_conf             56348433887850159999999------99999718849999704866-6388679999999
Q gi|255764513|r    8 RVRIAPSPTGEPHIGTAYTALFN------YLIAKRTGGKFILRIEDTDS-KRSTLESENAVMQ   63 (492)
Q Consensus         8 ~~RfaPsPtG~lH~G~~rtal~n------~l~a~~~~g~f~lRieDtd~-~R~~~~~~~~i~~   63 (492)
                      +.++.|+|+|..=|||+-.-...      .-+++++|..|.||+-.+.. -=+..+.+..++.
T Consensus        24 ~~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~p~Vviss~e~akE~l~   86 (489)
T KOG0156          24 RRNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLV   86 (489)
T ss_pred             CCCCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHCCEEEEEECCCCEEEECCHHHHHHHHH
T ss_conf             899994999985303588707763769999999986997699978974799899999999998


No 85 
>COG5477 Predicted small integral membrane protein [Function unknown]
Probab=66.38  E-value=6.7  Score=19.65  Aligned_cols=45  Identities=27%  Similarity=0.305  Sum_probs=38.3

Q ss_pred             HHHHHHHHHCCC--EEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             999999997188--499997048666388679999999988658988
Q gi|255764513|r   28 LFNYLIAKRTGG--KFILRIEDTDSKRSTLESENAVMQSLKWCGLNW   72 (492)
Q Consensus        28 l~n~l~a~~~~g--~f~lRieDtd~~R~~~~~~~~i~~~l~wlgl~~   72 (492)
                      .--|.|||-.|-  +=+||||-|--.|---.-..+-+-.|.|+|+.-
T Consensus        30 M~vWE~arPggnpR~G~LrfeTTRGDRLFisLLgsAyIhLAWlGLvg   76 (97)
T COG5477          30 MAVWEYARPGGNPRVGILRFETTRGDRLFISLLGSAYIHLAWLGLVG   76 (97)
T ss_pred             HHHHHHHCCCCCCCEEEEEEEECCCCEEHHHHHHHHHHHHHHHHHCC
T ss_conf             89998707899974006875404564105998889999999997315


No 86 
>KOG0436 consensus
Probab=64.98  E-value=11  Score=18.13  Aligned_cols=265  Identities=18%  Similarity=0.240  Sum_probs=132.9

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHC--CCEEEEEECCCCC------------CCCCHHHHHHHHHHHHH----CCCCCCCCC
Q ss_conf             38878501599999999999971--8849999704866------------63886799999999886----589888676
Q gi|255764513|r   15 PTGEPHIGTAYTALFNYLIAKRT--GGKFILRIEDTDS------------KRSTLESENAVMQSLKW----CGLNWDEGP   76 (492)
Q Consensus        15 PtG~lH~G~~rtal~n~l~a~~~--~g~f~lRieDtd~------------~R~~~~~~~~i~~~l~w----lgl~~De~~   76 (492)
                      |+...|+|+++++|..-.+||..  .|+-..=+--||.            .|+-++..+.|...+.-    +||.++.=.
T Consensus        50 vNAaPHlGhlYS~llaDai~R~q~lkg~~v~fsTGTDEHGlKIqtaaatnG~~P~e~cDr~s~~f~qL~k~~gi~yt~FI  129 (578)
T KOG0436          50 VNAAPHLGHLYSTLLADAIARFQRLKGKKVIFSTGTDEHGLKIQTAAATNGRNPPELCDRISQSFRQLWKDAGIAYTKFI  129 (578)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCHHHEE
T ss_conf             47885145799999999999998635880686037775442243368655999078886651999999998296334212


Q ss_pred             CCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEEC-----CCC-HHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             5588767632326289999999999988982451-----488-9997766887664310002366555788333001120
Q gi|255764513|r   77 DIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC-----FCS-TERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQ  150 (492)
Q Consensus        77 ~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c-----~~t-~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~  150 (492)
                      ..       ---+...+-++.-..+.+.|..|.-     ||- .|+.-.-.+.++..+ |   +|+--         .+.
T Consensus       130 RT-------TdpkH~a~Vqefw~~~~knG~iy~g~~eGwYcvsdEtf~pEskv~k~p~-~---~gk~v---------smE  189 (578)
T KOG0436         130 RT-------TDPKHEAIVQEFWARVFKNGDIYRGDYEGWYCVSDETFYPESKVLKNPC-P---PGKVV---------SME  189 (578)
T ss_pred             EC-------CCCHHHHHHHHHHHHHHHCCCEEEECCCCEEECCCCCCCCHHHHHCCCC-C---CCCEE---------EEC
T ss_conf             24-------8910899999999999867836520235168605300287888713889-9---98545---------404


Q ss_pred             CCCCCEEE------EEECCCCEEECCCCCCCCEECCC-------------CCCCCCCEECCC-----CCHHHHH----HH
Q ss_conf             25774078------86224311430475134021364-------------323564100045-----3248986----78
Q gi|255764513|r  151 EQKKHVVR------LTVPNQGSCVFQDKVYGEMEIPW-------------NAVDMQVLLKSD-----GMPTYHL----AN  202 (492)
Q Consensus       151 ~g~~~~iR------~k~p~~~~~~~~D~i~G~~~~~~-------------~~~~D~vi~r~d-----g~ptY~~----a~  202 (492)
                      .|.+-|||      |++..-. -...|.+++.-.|-.             ..+.|+-|-|..     |.|+=.=    --
T Consensus       190 sg~~vv~~kE~NY~FrLSkfq-k~l~d~lrkNP~fvqPs~~~~qVl~~lktglpDlSISRpsarl~WGIPvP~ddsQtIY  268 (578)
T KOG0436         190 SGNPVVWRKEDNYFFRLSKFQ-KPLEDHLRKNPRFVQPSYFHNQVLSWLKTGLPDLSISRPSARLDWGIPVPGDDSQTIY  268 (578)
T ss_pred             CCCCEEEECCCCEEEEHHHHH-HHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHCCCCCCCCCCCCCEEE
T ss_conf             689426761565010087551-2899998449974676077889999997379865325703301348888999862698


Q ss_pred             HHHHHHHHHHHHHCCCC-----------CCCH----HHHHHHHHHHH---------HHCCCH--HHHHHHHHHHHCCCCC
Q ss_conf             87644444443112235-----------4302----47889999985---------100000--1014555311013221
Q gi|255764513|r  203 VIDDHLMKITHVARGEE-----------WISS----VPKHILLYQYF---------NFPIPE--FIHLPLIKNPDKSKLS  256 (492)
Q Consensus       203 vvDD~~m~ithviRg~d-----------~~~~----t~~q~~l~~al---------~~~~p~--f~H~pli~~~~g~klS  256 (492)
                      |==|++.+---||-+.-           +.++    ..|-|+=|.|.         |.++|+  |.|--.  ..+|.|||
T Consensus       269 VWfDAL~nYiSvig~~~~~~N~k~~ls~~wPat~HvIGKDIlrFHavYWPafLmaAGlplP~~I~vHghw--t~ngmKMs  346 (578)
T KOG0436         269 VWFDALLNYISVIGYPNKQQNLKTALSFGWPATLHVIGKDILRFHAVYWPAFLMAAGLPLPKMIFVHGHW--TKNGMKMS  346 (578)
T ss_pred             EEHHHHHHHHHHHCCCCHHCCCCCEEECCCCCEEEEHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEE--EECCEECC
T ss_conf             7599886578860688210240001523787512320144566455451899986699986179884126--54222102


Q ss_pred             CCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHH
Q ss_conf             2234330245666297737799899850676665530110146777652
Q gi|255764513|r  257 KRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF  305 (492)
Q Consensus       257 KR~~~~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~F  305 (492)
                      |.-|.+-=-.---+-|-++++.=||.+-|-  ...|- =|+-+++++.-
T Consensus       347 KSLGNvvdP~~l~~kygvD~vRyflLr~~~--l~~Dg-dy~eekl~k~~  392 (578)
T KOG0436         347 KSLGNVVDPFELVQKYGVDAVRYFLLREGE--LGNDG-DYSEEKLIKIV  392 (578)
T ss_pred             HHHCCCCCHHHHHHHHCCCCEEEEEEECCC--CCCCC-CCCHHHHHHHH
T ss_conf             120464688999988384415667555352--07888-81299999999


No 87 
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=64.10  E-value=12  Score=18.02  Aligned_cols=42  Identities=14%  Similarity=0.054  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHH
Q ss_conf             014555311013221223433024566629773779989985
Q gi|255764513|r  242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLAL  283 (492)
Q Consensus       242 ~H~pli~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLal  283 (492)
                      .-+..+++++|+||||+-|-+---.-.-.-|=+++|.=|++.
T Consensus       590 ltHGfvlDe~GrKMSKSlGN~v~P~~V~~~yGADiLRLwv~s  631 (933)
T COG0060         590 LTHGFVLDEKGRKMSKSLGNVVDPQDVIDKYGADILRLWVAS  631 (933)
T ss_pred             HHCCCEECCCCCCCCCCCCCCCCHHHHHHHHCCHHEEEEEEE
T ss_conf             632617888888765557881898999876276340466561


No 88 
>cd06115 AthCS_per_like Arabidopsis thaliana (Ath) peroxisomal (Per) CS_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. This group contains three Arabidopsis peroxisomal CS proteins, CYS1, -2, and -3 which are involved in the glyoxylate cycle. AthCYS1, in addition to a peroxisomal targeting sequence, has a predicted secretory signal peptide; it may be targeted to both the secretory pathway and the peroxisomes and is thought to be located in the extracellular matrix. AthCSY1 is expr
Probab=61.90  E-value=13  Score=17.76  Aligned_cols=12  Identities=17%  Similarity=0.260  Sum_probs=7.5

Q ss_pred             CCHHHHHHHHCH
Q ss_conf             889999988495
Q gi|255764513|r  454 LPLFDSIEILGR  465 (492)
Q Consensus       454 P~L~eil~lLGk  465 (492)
                      +++|+.+..+||
T Consensus       363 ~~~fT~iFa~sR  374 (410)
T cd06115         363 TDFFPVLFAIPR  374 (410)
T ss_pred             HHHHHHHHHHHH
T ss_conf             366689999999


No 89 
>KOG2361 consensus
Probab=59.62  E-value=13  Score=17.76  Aligned_cols=161  Identities=17%  Similarity=0.258  Sum_probs=80.0

Q ss_pred             HHCCCEEEEEECCCCCCCCCHHHH-----------HHHHHHHHHCCCCCCCCCCCCCCCCCEECCCCHHH-HH-------
Q ss_conf             971884999970486663886799-----------99999988658988867655887676323262899-99-------
Q gi|255764513|r   35 KRTGGKFILRIEDTDSKRSTLESE-----------NAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNI-YQ-------   95 (492)
Q Consensus        35 ~~~~g~f~lRieDtd~~R~~~~~~-----------~~i~~~l~wlgl~~De~~~~~g~~~p~~QS~r~~~-y~-------   95 (492)
                      ++..+....|..+.|+.+...++.           ...+.+=+||--+|.|-..         +.+..+- +.       
T Consensus        13 ~~~k~~~~~~~~~~~~~~y~~~~~k~wD~fy~~~~~rFfkdR~wL~~Efpel~~---------~~~~~~~~ilEvGCGvG   83 (264)
T KOG2361          13 KKVKEQSASRVLEEEVVKYEREASKYWDTFYKIHENRFFKDRNWLLREFPELLP---------VDEKSAETILEVGCGVG   83 (264)
T ss_pred             HHHHHCCCCCCCHHHHHHHHCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHC---------CCCCCHHHHEEECCCCC
T ss_conf             987642431352566666633646664566653245453116778775677507---------55557345112224777


Q ss_pred             HHHHHHHHC-----CCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEE--EEE----C--
Q ss_conf             999999988-----982451488999776688766431000236655578833300112025774078--862----2--
Q gi|255764513|r   96 PYVQNLLEK-----KLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVR--LTV----P--  162 (492)
Q Consensus        96 ~~~~~L~~~-----g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR--~k~----p--  162 (492)
                      +-+=-|++.     =..|.|-||+..++..++.....-  ..---.+-+++.++.......|.-..+-  |.+    |  
T Consensus        84 NtvfPll~~~~n~~l~v~acDfsp~Ai~~vk~~~~~~e--~~~~afv~Dlt~~~~~~~~~~~svD~it~IFvLSAi~pek  161 (264)
T KOG2361          84 NTVFPLLKTSPNNRLKVYACDFSPRAIELVKKSSGYDE--SRVEAFVWDLTSPSLKEPPEEGSVDIITLIFVLSAIHPEK  161 (264)
T ss_pred             CCCCHHHHCCCCCCEEEEECCCCHHHHHHHHHCCCCCH--HHHCCCCEECCCHHCCCCCCCCCCCEEEEEEEEECCCHHH
T ss_conf             51224442489987389974898689999873633264--5501200016560103788867633478999875148477


Q ss_pred             -------------CCCEEECCCCCCCCEE---CC-CCCCCCCCEECCCCCHHHHHHHHHHH
Q ss_conf             -------------4311430475134021---36-43235641000453248986788764
Q gi|255764513|r  163 -------------NQGSCVFQDKVYGEME---IP-WNAVDMQVLLKSDGMPTYHLANVIDD  206 (492)
Q Consensus       163 -------------~~~~~~~~D~i~G~~~---~~-~~~~~D~vi~r~dg~ptY~~a~vvDD  206 (492)
                                   +.|.+.|.|-=+|..+   |. ..-+++---+|.||++.|-|..-.=|
T Consensus       162 ~~~a~~nl~~llKPGG~llfrDYg~~DlaqlRF~~~~~i~~nfYVRgDGT~~YfF~~eeL~  222 (264)
T KOG2361         162 MQSVIKNLRTLLKPGGSLLFRDYGRYDLAQLRFKKGQCISENFYVRGDGTRAYFFTEEELD  222 (264)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHCCCCCEEECCEEECCCCCEEEECCHHHHH
T ss_conf             8999999999748886799841454347887515774320145881699665223688999


No 90 
>cd06107 EcCS_AthCS-per_like Escherichia coli (Ec) citrate synthase (CS) gltA and Arabidopsis thaliana (Ath) peroxisomal (Per) CS_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA.   There are two types of CSs: type I CS and type II CSs.  Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site.  Type II CSs are unique to gram-negative bacteria and are homohexamers of ide
Probab=58.34  E-value=15  Score=17.36  Aligned_cols=15  Identities=20%  Similarity=0.448  Sum_probs=8.1

Q ss_pred             CHHHHHHHHHHHHHH
Q ss_conf             899977668876643
Q gi|255764513|r  113 STERLEEMRRAQRKR  127 (492)
Q Consensus       113 t~eel~~~r~~~~~~  127 (492)
                      |++|++..+....+.
T Consensus        59 t~~el~~f~~~l~~~   73 (382)
T cd06107          59 TQEQYDEFQRRLSEH   73 (382)
T ss_pred             CHHHHHHHHHHHHHH
T ss_conf             999999999999982


No 91 
>PRK05912 tyrosyl-tRNA synthetase; Validated
Probab=57.66  E-value=11  Score=18.27  Aligned_cols=95  Identities=17%  Similarity=0.135  Sum_probs=60.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHH-HHHHHHHHHCCCC-CCC-CCCCCHHHHHHCCCC
Q ss_conf             8986788764444444311223543024788999998510000010-1455531101322-122-343302456662977
Q gi|255764513|r  197 TYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI-HLPLIKNPDKSKL-SKR-RNPTSISYYSAMGYL  273 (492)
Q Consensus       197 tY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~-H~pli~~~~g~kl-SKR-~~~~~i~~~~~~Gyl  273 (492)
                      +|.+--.-|=..+.++-=|=|.|-.-|--.=+.|.+-++-+ |.|+ .+|||++.||+|+ ||- .+++.+..      .
T Consensus       168 ~Y~llQayDf~~L~~~lqiGGsDQwgNi~~G~dLir~~~~~-~~~glT~PLLt~~dG~K~gsKS~gnaIwLd~------s  240 (402)
T PRK05912        168 LYPLLQGYDSVALNADLELGGTDQWFNILVGRDLQRRYGQE-PQFGLTMPLLTGLDGVKKMSKSLGNYIWLDE------S  240 (402)
T ss_pred             HHHHHHHHHHHHHCCCEEEECHHHHHHHHHHHHHHHHHCCC-CCEEEEECCEECCCCCCCCCCCCCCCEECCC------C
T ss_conf             37788766577540334773054899999899999985689-8379984505778768435667998701789------9


Q ss_pred             HHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHH
Q ss_conf             3779989985067666553011014677765202
Q gi|255764513|r  274 PEALINFLALLFVHKSEDDDELMDMQQLIHHFDL  307 (492)
Q Consensus       274 PeAilNyLalLGws~~~~d~Eifsl~eli~~FdL  307 (492)
                      |-.+..|...    .+  |..   +....+.|.+
T Consensus       241 p~~~yq~~~n----~~--D~d---v~~ylklfT~  265 (402)
T PRK05912        241 PYEMYQKWMN----IP--DAL---VWRYLELLTF  265 (402)
T ss_pred             HHHHHHHHHC----CC--HHH---HHHHHHHHCC
T ss_conf             8999999963----87--889---9999999645


No 92 
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional
Probab=54.53  E-value=11  Score=18.22  Aligned_cols=78  Identities=18%  Similarity=0.234  Sum_probs=57.9

Q ss_pred             CCHHHHHHHHHHCCCCCCCCCHHHCC-HHHHHHHHHHHHCCCCCCCCHH-HHHHHHHHHHHHCCCCHHHHHHHHHHHHCC
Q ss_conf             77377998998506766655301101-4677765202113755442015-655664355551269989999864442000
Q gi|255764513|r  272 YLPEALINFLALLFVHKSEDDDELMD-MQQLIHHFDLHHLSKAGAVFDK-QKLDWLNGRWIREKLSTTEFLSRVSQWMKE  349 (492)
Q Consensus       272 ylPeAilNyLalLGws~~~~d~Eifs-l~eli~~FdL~~I~Ks~A~FD~-eKL~wlN~qyIr~~l~~~el~~~l~~~l~~  349 (492)
                      +++..+.+||..+.-|++ ||-|+-+ ++.|++.-.+..+.-.|-+||. .|+-|+.++-- -.|...++-+.+..|+++
T Consensus       219 if~p~IF~~L~~~~p~~~-GEiqLTDAi~~l~~~~~v~~~~~~G~r~D~G~~~gyl~A~i~-~al~~~~~~~~~~~~l~~  296 (302)
T PRK13389        219 VLSADIWPLLAKTPPGAG-DEIQLTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVE-YGIRHNTLGTEFKAWLEE  296 (302)
T ss_pred             EECHHHHHHHHCCCCCCC-CCEEHHHHHHHHHHHCCEEEEEEEEEEECCCCCCHHHHHHHH-HHHCCHHHHHHHHHHHHH
T ss_conf             878899999960799999-808499999999842976999965579787680137999999-982798788999999999


Q ss_pred             CC
Q ss_conf             01
Q gi|255764513|r  350 KD  351 (492)
Q Consensus       350 ~~  351 (492)
                      .-
T Consensus       297 ~~  298 (302)
T PRK13389        297 EM  298 (302)
T ss_pred             HH
T ss_conf             73


No 93 
>cd03473 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophosphate-N-acetylneuraminic acid (CMP Neu5Ac) hydroxylase family, N-terminal Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. CMP Neu5Ac hydroxylase is the key enzyme for the synthesis of N-glycolylneuraminic acid (NeuGc) from N-acetylneuraminic acid (Neu5Ac), NeuGc and Neu5Ac are members of a family of cell surface sugars called sialic acids. All mammals except humans have both NeuGc variants on their cell surfaces. In humans, the gene encoding CMP Neu5Ac hydroxylase has a mutation within its coding region that abolishes NeuGc production.
Probab=51.86  E-value=6.7  Score=19.64  Aligned_cols=28  Identities=46%  Similarity=0.532  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHCCCEEEEEECCCC--CCCCCHH
Q ss_conf             99999999971884999970486--6638867
Q gi|255764513|r   27 ALFNYLIAKRTGGKFILRIEDTD--SKRSTLE   56 (492)
Q Consensus        27 al~n~l~a~~~~g~f~lRieDtd--~~R~~~~   56 (492)
                      |--|  .+++.||+|+.-|||.|  .-|++..
T Consensus        44 aC~N--~CKHQGG~Fi~died~~~~~vkCtkH   73 (107)
T cd03473          44 ACKN--QCKHQGGLFIKDIEDLDGRTVRCTKH   73 (107)
T ss_pred             HHHH--HHHHCCCEEECHHHHCCCCEEEECCC
T ss_conf             8998--76424881501012068878986675


No 94 
>KOG3349 consensus
Probab=45.20  E-value=23  Score=15.98  Aligned_cols=22  Identities=23%  Similarity=0.241  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHCCCEEECCCCH
Q ss_conf             9999999999889824514889
Q gi|255764513|r   93 IYQPYVQNLLEKKLAFRCFCST  114 (492)
Q Consensus        93 ~y~~~~~~L~~~g~aY~c~~t~  114 (492)
                      .-.+.|++|.++|..|+|-||.
T Consensus       115 HQ~ELA~qL~~egyL~~C~ps~  136 (170)
T KOG3349         115 HQLELAKQLAEEGYLYYCTPST  136 (170)
T ss_pred             HHHHHHHHHHHCCCEEEEECCC
T ss_conf             8999999998659689960565


No 95 
>PRK07561 DNA topoisomerase I; Validated
Probab=44.26  E-value=20  Score=16.42  Aligned_cols=110  Identities=15%  Similarity=0.167  Sum_probs=59.3

Q ss_pred             CCCHHHHHHHHHHHHHHH--------------------HCCCEEEEEECCCCCC---------------------C-CCH
Q ss_conf             785015999999999999--------------------7188499997048666---------------------3-886
Q gi|255764513|r   18 EPHIGTAYTALFNYLIAK--------------------RTGGKFILRIEDTDSK---------------------R-STL   55 (492)
Q Consensus        18 ~lH~G~~rtal~n~l~a~--------------------~~~g~f~lRieDtd~~---------------------R-~~~   55 (492)
                      .|-.|-+-|.-..++.-|                    +.+..|-.++-..+..                     + ..+
T Consensus       173 ~LSAGRVQSpaLrLIveRE~EI~~F~p~~Yw~i~a~~~~~~~~f~a~l~~~~~~ki~~~~dfd~~t~~~~~~~~~~~~~e  252 (878)
T PRK07561        173 GLSAGRVQSVAVRLLVQRERERRAFKSGSYWDLKAQLEKDGSPFEAKLTTLGGQRIATGSDFDESTGQLKAGRDVVLLDE  252 (878)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCEEEEEEEEECCEEECCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             99764018999999999899998358755289999982488617999973188564035555421112234543433899


Q ss_pred             HHHHHHHHHHHHCCC---CCCCCCCCCCCCCCEECCC-------C----HHHHHHHHHHHHHCCCEEECC-----CCHHH
Q ss_conf             799999999886589---8886765588767632326-------2----899999999999889824514-----88999
Q gi|255764513|r   56 ESENAVMQSLKWCGL---NWDEGPDIGGAYGPYRQSE-------R----KNIYQPYVQNLLEKKLAFRCF-----CSTER  116 (492)
Q Consensus        56 ~~~~~i~~~l~wlgl---~~De~~~~~g~~~p~~QS~-------r----~~~y~~~~~~L~~~g~aY~c~-----~t~ee  116 (492)
                      +..+.+.+.++=-..   ...+.+..--|..||--|.       +    -..=..+|++|-+.|+.=|--     .|++-
T Consensus       253 ~~A~~~~~~l~~~~~~V~~ve~K~~~r~PppPFtTSTLQQeAs~kLGfSa~~TM~iAQ~LYE~GlITYmRTDS~~lS~ea  332 (878)
T PRK07561        253 EEAKALKERLTGKPWTVSSVEEKPTTRKPVPPFTTSTLQQEANRKLRLSARETMRCAQGLYERGFITYMRTDSVHLSEQA  332 (878)
T ss_pred             HHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCHHH
T ss_conf             99999999842797699998752200379998567999999986159589999999999985883788647876569999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             77668876643
Q gi|255764513|r  117 LEEMRRAQRKR  127 (492)
Q Consensus       117 l~~~r~~~~~~  127 (492)
                      +...|+.....
T Consensus       333 i~~~r~~I~~~  343 (878)
T PRK07561        333 IRAARSCVESM  343 (878)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999874


No 96 
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    Isoleucyl-tRNA synthetase (6.1.1.5 from EC) is an alpha monomer that belongs to class Ia. The enzyme, isoleucyl-transfer RNA synthetase, activates not only the cognate substrate L-isoleucine but also the minimally distinct L-valine in the first, aminoacylation step. Then, in a second, "editing" step, the synthetase itself rapidly hydrolyzes only the valylated products ,  as shown from the crystal structures. ; GO: 0000166 nucleotide binding, 0004822 isoleucine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006428 isoleucyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=44.15  E-value=5.8  Score=20.04  Aligned_cols=44  Identities=18%  Similarity=0.136  Sum_probs=29.2

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCC-C----HH---HHHHCCCCHHHHHHHHHHC
Q ss_conf             1014555311013221223433-0----24---5666297737799899850
Q gi|255764513|r  241 FIHLPLIKNPDKSKLSKRRNPT-S----IS---YYSAMGYLPEALINFLALL  284 (492)
Q Consensus       241 f~H~pli~~~~g~klSKR~~~~-~----i~---~~~~~GylPeAilNyLalL  284 (492)
                      -.-+.++|+++|.||||+-|-+ +    |.   ..++=-|=.++|.=||+.-
T Consensus       656 Vi~hGF~LDe~G~KMSKSlGNvV~P~~v~~G~~N~~~P~yGAD~LRlyv~~~  707 (938)
T TIGR00392       656 VITHGFTLDEKGRKMSKSLGNVVDPEKVINGDENLKLPKYGADILRLYVASS  707 (938)
T ss_pred             EEECCEEECCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCHHHHHHHHHC
T ss_conf             4531548857785445325870385997088433588753304877778846


No 97 
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair]
Probab=43.21  E-value=19  Score=16.49  Aligned_cols=34  Identities=24%  Similarity=0.444  Sum_probs=25.8

Q ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHH-HCCCEEE
Q ss_conf             634843388785015999999999999-7188499
Q gi|255764513|r    9 VRIAPSPTGEPHIGTAYTALFNYLIAK-RTGGKFI   42 (492)
Q Consensus         9 ~RfaPsPtG~lH~G~~rtal~n~l~a~-~~~g~f~   42 (492)
                      .++.|+|+=-...+-+|-|||||+-.. -.|+.|+
T Consensus        14 L~~p~~~~~RPT~drVREalFNil~~~~i~g~~~L   48 (187)
T COG0742          14 LKTPDGPGTRPTTDRVREALFNILAPDEIEGARVL   48 (187)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEE
T ss_conf             25799998688716888999987343445798899


No 98 
>cd06116 CaCS_like Chloroflexus aurantiacus (Ca) citrate synthase (CS)_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). This group is similar to gram-negative Escherichia coli (Ec) CS (type II, gltA) and Arabidopsis thaliana (Ath) peroxisomal (Per) CS. However EcCS and AthPerCS are not found in this group. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA.   There are two types of CSs: type I CS and type II CSs.  Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers w
Probab=43.02  E-value=25  Score=15.76  Aligned_cols=12  Identities=17%  Similarity=0.196  Sum_probs=7.3

Q ss_pred             CCHHHHHHHHCH
Q ss_conf             889999988495
Q gi|255764513|r  454 LPLFDSIEILGR  465 (492)
Q Consensus       454 P~L~eil~lLGk  465 (492)
                      +++|+.+..++|
T Consensus       336 ~~~fT~iFa~sR  347 (384)
T cd06116         336 TEAFTVLFAIPR  347 (384)
T ss_pred             HHHHHHHHHHHH
T ss_conf             366679999999


No 99 
>TIGR02042 sir sulfite reductase, ferredoxin dependent; InterPro: IPR011787    Distantly related to the iron-sulphur hemoprotein of sulphite reductase (NADPH) found in Proteobacteria and Eubacteria, sulphite reductase (ferredoxin) is a cyanobacterial and plant monomeric enzyme that also catalyzes the reduction of sulphite to sulphide.; GO: 0020037 heme binding, 0050311 sulfite reductase (ferredoxin) activity, 0051539 4 iron 4 sulfur cluster binding.
Probab=42.78  E-value=23  Score=16.04  Aligned_cols=32  Identities=13%  Similarity=0.158  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHCCCHHHHCCEEEEEEECCCCCC
Q ss_conf             89999999999957982331012678896488888
Q gi|255764513|r  420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSL  454 (492)
Q Consensus       420 ~Ie~~ik~i~e~~giK~k~l~~PLRiALTG~~~GP  454 (492)
                      .|-+-+..+.++.|++.-+   .+=|=+||+.+|=
T Consensus       468 ~iL~R~R~lle~~GL~y~E---~~VvR~TGCPNGC  499 (583)
T TIGR02042       468 GILKRIRALLEKVGLKYDE---HFVVRMTGCPNGC  499 (583)
T ss_pred             HHHHHHHHHHHHHCCCCCC---EEEEEEECCCCCC
T ss_conf             7999999999860886066---3889820688886


No 100
>TIGR01480 copper_res_A copper-resistance protein, CopA family; InterPro: IPR006376   These sequences represent the CopA copper resistance protein family. CopA is related to laccase (benzenediol:oxygen oxidoreductase) and L-ascorbate oxidase, both copper-containing enzymes. Most members have a typical TAT (twin-arginine translocation) signal sequence with an Arg-Arg pair. Twin-arginine translocation is observed for a large number of periplasmic proteins that cross the inner membrane with metal-containing cofactors already bound. The combination of copper-binding sites and TAT translocation motif suggests a mechanism of resistance by packaging and export. ; GO: 0005507 copper ion binding, 0042597 periplasmic space.
Probab=42.06  E-value=19  Score=16.52  Aligned_cols=45  Identities=24%  Similarity=0.332  Sum_probs=31.9

Q ss_pred             HHCCCCCEEEEEECCCCEEECCC--------CCCCCEECCCCCC-C------CCCEECCC
Q ss_conf             20257740788622431143047--------5134021364323-5------64100045
Q gi|255764513|r  149 SQEQKKHVVRLTVPNQGSCVFQD--------KVYGEMEIPWNAV-D------MQVLLKSD  193 (492)
Q Consensus       149 ~~~g~~~~iR~k~p~~~~~~~~D--------~i~G~~~~~~~~~-~------D~vi~r~d  193 (492)
                      ++.|+.|..||++...|++-|+=        -+||.+.+|+-+- +      |.||+=||
T Consensus       135 I~pGetf~Y~F~v~Q~GtYWyHSHs~fQEq~G~YG~lvIDP~~~v~p~~~DR~y~vlLSD  194 (644)
T TIGR01480       135 IAPGETFTYRFKVEQSGTYWYHSHSGFQEQAGLYGPLVIDPAEPVDPVRADRDYVVLLSD  194 (644)
T ss_pred             CCCCCCEEEEEEEEECCCHHHHHHHHHHHHHCCCCCEEECCCCCCCCEEECCCEEEEEEC
T ss_conf             888884358888874254056666777752157687888588897880006646999632


No 101
>COG1754 Uncharacterized C-terminal domain of topoisomerase IA [General function prediction only]
Probab=41.89  E-value=14  Score=17.43  Aligned_cols=10  Identities=50%  Similarity=0.966  Sum_probs=6.6

Q ss_pred             CCCCCCCEEC
Q ss_conf             5887676323
Q gi|255764513|r   78 IGGAYGPYRQ   87 (492)
Q Consensus        78 ~~g~~~p~~Q   87 (492)
                      .-|.||||.+
T Consensus        37 k~GKyGpyl~   46 (298)
T COG1754          37 KLGKYGPYLE   46 (298)
T ss_pred             EECCCCCCCE
T ss_conf             8425433101


No 102
>KOG0437 consensus
Probab=41.56  E-value=26  Score=15.62  Aligned_cols=45  Identities=22%  Similarity=0.282  Sum_probs=20.0

Q ss_pred             HCCCCCCCHH-----HHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             1223543024-----7889999985100000101455531101322122343
Q gi|255764513|r  215 ARGEEWISSV-----PKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNP  261 (492)
Q Consensus       215 iRg~d~~~~t-----~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~  261 (492)
                      +-|.|.++|-     .-|..||.-=.|+--.+|.=-|++|  +.||||..|.
T Consensus       668 vsGKDLi~NHLtfflynHvAl~~~k~WPkgiraNGHLmLN--sEKMSKSTGN  717 (1080)
T KOG0437         668 VSGKDLIPNHLTFFLYNHVALFPEKKWPKGIRANGHLMLN--SEKMSKSTGN  717 (1080)
T ss_pred             ECCCCCCCCCEEEEEEEHHHHCCCCCCCCCCCCCCEEEEC--CHHCCCCCCC
T ss_conf             2342135231367554002315400286531117667733--1220545677


No 103
>COG4720 Predicted membrane protein [Function unknown]
Probab=40.54  E-value=13  Score=17.60  Aligned_cols=26  Identities=38%  Similarity=0.654  Sum_probs=16.2

Q ss_pred             CCCC--CCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             4338--8785015999999999999718
Q gi|255764513|r   13 PSPT--GEPHIGTAYTALFNYLIAKRTG   38 (492)
Q Consensus        13 PsPt--G~lH~G~~rtal~n~l~a~~~~   38 (492)
                      |.|+  |++|+|.+--++...+|-...|
T Consensus        29 Ptp~~~~~i~L~da~i~las~lfGs~~G   56 (177)
T COG4720          29 PTPIPNGFLTLGDAGIALASFLFGSRAG   56 (177)
T ss_pred             CCCCCCCEEEHHHHHHHHHHHHHCCHHH
T ss_conf             4798877264788799999999722688


No 104
>COG3733 TynA Cu2+-containing amine oxidase [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=40.51  E-value=6.5  Score=19.72  Aligned_cols=32  Identities=16%  Similarity=0.082  Sum_probs=22.0

Q ss_pred             CCCCCCCEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             32356410004532489867887644444443
Q gi|255764513|r  182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITH  213 (492)
Q Consensus       182 ~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ith  213 (492)
                      .++.++|+==.|-.|+-.|-++.|--+.|+-.
T Consensus       297 aSl~eMvVPYGdPd~~h~~K~~fD~GeYglG~  328 (654)
T COG3733         297 ASLVEMVVPYGDPDPGHYFKNAFDSGEYGLGT  328 (654)
T ss_pred             EEECCEEEECCCCCCCHHHHHCCCCCCCCCCC
T ss_conf             22111653168989542343102433457420


No 105
>COG1938 Archaeal enzymes of ATP-grasp superfamily [General function prediction only]
Probab=39.97  E-value=28  Score=15.45  Aligned_cols=82  Identities=17%  Similarity=0.180  Sum_probs=45.3

Q ss_pred             ECCCCCCCCEECCCCCCCCCCEECCCC-C-H--HHHHHHHHHHHHHH--HHH---------HHCCCC----CCCHHHHHH
Q ss_conf             304751340213643235641000453-2-4--89867887644444--443---------112235----430247889
Q gi|255764513|r  168 VFQDKVYGEMEIPWNAVDMQVLLKSDG-M-P--TYHLANVIDDHLMK--ITH---------VARGEE----WISSVPKHI  228 (492)
Q Consensus       168 ~~~D~i~G~~~~~~~~~~D~vi~r~dg-~-p--tY~~a~vvDD~~m~--ith---------viRg~d----~~~~t~~q~  228 (492)
                      ..++.++-++.+-.+ -++++++.+|= . |  -|+|++.|=+..-.  ++.         ..|.++    |+.|+++-.
T Consensus        60 v~~G~~~~P~RIY~~-~~~~~~~~~dv~I~p~~i~e~s~~v~~w~~~~~v~~ii~~~g~~~~~~~e~~~v~~va~~~~~~  138 (244)
T COG1938          60 VVEGRALPPFRIYAS-SDGVLALVSDVPIPPAVIYEISNAVVEWAEENGVEEVISLGGMPARLREEKPSVYGVATSEEKL  138 (244)
T ss_pred             EECCCCCCCEEEEEC-CCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCEEEEECCHHHH
T ss_conf             957833686568963-8978999824789878899999999999997197499996688766666777447983555556


Q ss_pred             HHHHHHHHCCCHHHHHHHHHHHHCC
Q ss_conf             9999851000001014555311013
Q gi|255764513|r  229 LLYQYFNFPIPEFIHLPLIKNPDKS  253 (492)
Q Consensus       229 ~l~~al~~~~p~f~H~pli~~~~g~  253 (492)
                      .-.+.+|.++++++   .|.++.|.
T Consensus       139 ~~l~~~~~~~~~~G---~I~G~~g~  160 (244)
T COG1938         139 EKLKDLGAEPLEEG---TIVGPSGA  160 (244)
T ss_pred             HHHHHCCCCCCCCC---EEECCCHH
T ss_conf             67763598755564---56465089


No 106
>TIGR02884 spore_pdaA delta-lactam-biosynthetic de-N-acetylase; InterPro: IPR014235    Muramic delta-lactam is an unusual constituent of peptidoglycan, found only in bacterial spores, in the peptidoglycan wall or spore cortex. This entry represents a subset of the larger polysaccharide deacetylase family that is specifically involved in delta-lactam biosynthesis. PdaA from Bacillus subtilis acts immediately after CwlD, an N-acetylmuramoyl-L-alanine amidase and performs a de-N-acetylation. PdaA may also perform the subsequent transpeptidation that leads to lactam ring formation, as heterologous expression in Escherichia coli of CwlD and PdaA together is sufficient for delta-lactam production..
Probab=37.61  E-value=25  Score=15.75  Aligned_cols=11  Identities=9%  Similarity=0.305  Sum_probs=4.9

Q ss_pred             HHHHHHHHCCC
Q ss_conf             99999998898
Q gi|255764513|r   96 PYVQNLLEKKL  106 (492)
Q Consensus        96 ~~~~~L~~~g~  106 (492)
                      +.+.+..++||
T Consensus        80 dLvKRM~~EGH   90 (225)
T TIGR02884        80 DLVKRMVDEGH   90 (225)
T ss_pred             HHHHHHHHCCC
T ss_conf             76665554583


No 107
>TIGR00871 zwf glucose-6-phosphate 1-dehydrogenase; InterPro: IPR001282   Glucose-6-phosphate dehydrogenase (1.1.1.49 from EC) (G6PDH) is a ubiquitous protein, present in bacteria and all eukaryotic cell types . The enzyme catalyses the the first step in the pentose pathway, i.e. the conversion of glucose-6-phosphate to gluconolactone 6-phosphate in the presence of NADP, producing NADPH. The ubiquitous expression of the enzyme gives it a major role in the production of NADPH for the many NADPH-mediated reductive processes in all cells . Deficiency of G6PDH is a common genetic abnormality affecting millions of people worldwide. Many sequence variants, most caused by single point mutations, are known, exhibiting a wide variety of phenotypes .; GO: 0004345 glucose-6-phosphate dehydrogenase activity, 0006006 glucose metabolic process.
Probab=37.00  E-value=8.2  Score=19.04  Aligned_cols=180  Identities=13%  Similarity=0.176  Sum_probs=102.8

Q ss_pred             HHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHHCCCCCCCCHHHHHHHH
Q ss_conf             55311013221223433024566629773779989985067666553011014677765202113755442015655664
Q gi|255764513|r  246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWL  325 (492)
Q Consensus       246 li~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~I~Ks~A~FD~eKL~wl  325 (492)
                      .|.|..| =|+||.==.||=.+.+.|.||+-    ..-+|-+..     -+|.+++-+.-.-.-+..+....+.++++-+
T Consensus         6 VIFGAsG-DLA~rKl~PaLy~L~~~g~L~~~----~~ivG~AR~-----~~s~~~fr~~~~~a~~~~~~~~~~~~~~d~F   75 (498)
T TIGR00871         6 VIFGASG-DLARRKLIPALYRLFREGLLPPD----FRIVGVARR-----DLSDEEFRKVVREALIKFETEEIDEQLLDEF   75 (498)
T ss_pred             EEECCCC-CHHHHHHHHHHHHHHHCCCCCCC----CEEEEEECC-----CCCHHHHHHHHHHHHHCCCCCCCCHHHHHHH
T ss_conf             9816750-20343344688999870659898----479987457-----6887899999974331057866442259998


Q ss_pred             HHH--HHHCCCCHHHHHHHHHHHHCCC------------------CCCCCHHHHHHHCCCHH---HHHHHHHHHHHCCCC
Q ss_conf             355--5512699899998644420000------------------12322068887253203---566775567522467
Q gi|255764513|r  326 NGR--WIREKLSTTEFLSRVSQWMKEK------------------DRLTQALTLAQSRITTL---SALPQMTDFLFKSDL  382 (492)
Q Consensus       326 N~q--yIr~~l~~~el~~~l~~~l~~~------------------~~l~~il~likeRi~tL---~Di~~~~~ffF~~~~  382 (492)
                      -+.  |+.-..++.+-+..+...+.+.                  .....+++-++...-+-   ..-..+...+.+.|+
T Consensus        76 ~~~~~Y~~g~~dd~~~y~~L~~~L~~l~~~~~~~gNr~fYLa~PP~~F~~i~~~L~~~~l~~~nq~~~~~w~Rvv~EKPF  155 (498)
T TIGR00871        76 AQRLSYVSGDVDDDESYKKLAELLEKLDKTYQTEGNRLFYLATPPSLFGTIIKQLKKHGLNERNQEQGKTWSRVVIEKPF  155 (498)
T ss_pred             HCCCEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEEEEECCC
T ss_conf             60735774467876889999999989998518889745650478441026788776531000135578844799987889


Q ss_pred             CCCHHHHHH------------------HHCCCHHHHHHH--HHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCHH
Q ss_conf             888545543------------------314866799999--9999984058889988899999999999579823
Q gi|255764513|r  383 HLTAESFKS------------------TALCPEEIIDIL--KTTQEEFEVIQIWKRENIETALRNVAQHREKSLK  437 (492)
Q Consensus       383 ~~d~e~~~k------------------~~~~~e~~~~iL--~~~~~~L~~~~~w~~e~Ie~~ik~i~e~~giK~k  437 (492)
                      -.|.++..+                  .-+.+|..+++|  ...-..+++  .||...|..+-=.++|..|+..+
T Consensus       156 G~DL~SA~~Ln~~~~~~F~E~qiYRIDHYLGKEtVqNllvlRFAN~~Fep--~WNr~~Id~VqIT~aE~~GvEgR  228 (498)
T TIGR00871       156 GHDLASAQELNKQLRAVFKEDQIYRIDHYLGKETVQNLLVLRFANQIFEP--LWNRRYIDHVQITVAESFGVEGR  228 (498)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHH--HCCCCCCCEEEEEEEEECCCCCC
T ss_conf             99878999999998865484644674101264578899999647887532--11577644489976650465863


No 108
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional
Probab=36.69  E-value=31  Score=15.12  Aligned_cols=31  Identities=16%  Similarity=0.382  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHH
Q ss_conf             9999999999988982451488999776688766
Q gi|255764513|r   92 NIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR  125 (492)
Q Consensus        92 ~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~  125 (492)
                      .+|.+..+.|.+.| ||  ||++||.+.+++..-
T Consensus       265 ~iyd~~~~~l~~~G-ay--~l~~eE~~kl~~~~~  295 (862)
T PRK13805        265 EIYDEVKEEFKSHG-AY--FLNKKELKKLEKVIF  295 (862)
T ss_pred             HHHHHHHHHHHHCC-CE--EECHHHHHHHHHHHC
T ss_conf             88999999999889-79--808999999998742


No 109
>PRK11913 phhA phenylalanine 4-monooxygenase; Reviewed
Probab=34.32  E-value=6.5  Score=19.70  Aligned_cols=76  Identities=16%  Similarity=0.200  Sum_probs=49.8

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHH
Q ss_conf             86788764444444311223543024788999998510000010145553110132212234330245666297737799
Q gi|255764513|r  199 HLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALI  278 (492)
Q Consensus       199 ~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~~~i~~~~~~GylPeAil  278 (492)
                      .|-...-+-..-+|.-||-.+++.=||--=.+.+       .|+|+|++.|+.=...+..-|-.++..-      .+.-+
T Consensus        93 ~Ff~~LA~r~Fp~t~~iR~~~~~~YtpEPDifHe-------~fGHvP~L~~p~fA~f~~~~G~~~l~a~------~~~~~  159 (272)
T PRK11913         93 VFFELLANRRFPVATFIRTPEELDYLQEPDIFHD-------VFGHVPLLTNPVFADFMQAYGQLGLKAS------KEERA  159 (272)
T ss_pred             HHHHHHHCCCCCEEEEECCCCCCCCCCCCHHHHH-------HHCCCCCCCCHHHHHHHHHHHHHHHCCC------CHHHH
T ss_conf             9999986581322534357765566888437887-------6256742079889999999999986359------99999


Q ss_pred             HHHHHCCCC
Q ss_conf             899850676
Q gi|255764513|r  279 NFLALLFVH  287 (492)
Q Consensus       279 NyLalLGws  287 (492)
                      .+|++|=|-
T Consensus       160 ~~L~rlyWf  168 (272)
T PRK11913        160 FALARLYWF  168 (272)
T ss_pred             HHHHHHHHH
T ss_conf             999877742


No 110
>pfam10245 MRP-S22 Mitochondrial 28S ribosomal protein S22. This is the conserved N-terminus and central portion of the mitochondrial small subunit 28S ribosomal protein S22. Mammalian mitochondria carry out the synthesis of 13 polypeptides that are essential for oxidative phosphorylation and, hence, for the synthesis of the majority of the ATP used by eukaryotic organisms. The number of proteins produced by prokaryotes is smaller, reflected in the lower number of ribosomal proteins present in them.
Probab=33.68  E-value=35  Score=14.80  Aligned_cols=55  Identities=15%  Similarity=0.109  Sum_probs=32.8

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             638867999999998865898886765588767632326289999999999988982451488999776688766431
Q gi|255764513|r   51 KRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRN  128 (492)
Q Consensus        51 ~R~~~~~~~~i~~~l~wlgl~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~  128 (492)
                      +....+.++.|+..+.-+.+  +-         .+++.         ..   ..+..-+-|+|.++|++.++.+.+..
T Consensus         2 p~F~~~eVQ~lL~~~T~ldl--~k---------VFr~r---------~~---~~~~~~yKlMTd~qLe~~~~~ai~~a   56 (243)
T pfam10245         2 PLFVDEEVQKLLTSMTRLDL--DK---------VFRKR---------SV---RDNRSEYKLMTDEQLEREKLQSIEFA   56 (243)
T ss_pred             CCCCCHHHHHHHHHHHCCCH--HH---------HHCCC---------CC---CCCCCEEEECCHHHHHHHHHHHHHHH
T ss_conf             87512889999999756278--98---------72234---------56---78997156358999999999999999


No 111
>pfam06253 MTTB Trimethylamine methyltransferase (MTTB). This family consists of several trimethylamine methyltransferase (MTTB) (EC:2.1.1.-) proteins from numerous Rhizobium and Methanosarcina species.
Probab=33.10  E-value=16  Score=17.03  Aligned_cols=141  Identities=14%  Similarity=0.125  Sum_probs=71.8

Q ss_pred             CCCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH-CCCCCE
Q ss_conf             5887676323262899999999999889824514889997766887664310002366555788333001120-257740
Q gi|255764513|r   78 IGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQ-EQKKHV  156 (492)
Q Consensus        78 ~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~-~g~~~~  156 (492)
                      .+++|.|.-+.+--.||....+-|-+-|....   .+|-++.+++.    |-.-.-+|.--.++.+-+++.++ .-..++
T Consensus        29 ~~~~~~~Ls~~~i~~Ih~aal~ILeeiGi~~~---~~ea~e~~~~a----Ga~V~~~g~rV~fp~~lV~~~i~~AP~~ft  101 (505)
T pfam06253        29 PIPPYQLLSDEQLERIHRASLRILEEVGIEVR---DDEALELWKAA----GADVDDRGLRVRFDRGLVLELLKTAPSSFT  101 (505)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC---CHHHHHHHHHC----CCEECCCCCEEEECHHHHHHHHHHCCCCEE
T ss_conf             88887888999999999999999998097659---99999999980----998748998799789999999984887279


Q ss_pred             EEEEECC---------------CCEEECCCCCCCCEECCCCCCCCC--CEECCCCCHHHHHHH--HH--HHHHHHHHHHH
Q ss_conf             7886224---------------311430475134021364323564--100045324898678--87--64444444311
Q gi|255764513|r  157 VRLTVPN---------------QGSCVFQDKVYGEMEIPWNAVDMQ--VLLKSDGMPTYHLAN--VI--DDHLMKITHVA  215 (492)
Q Consensus       157 iR~k~p~---------------~~~~~~~D~i~G~~~~~~~~~~D~--vi~r~dg~ptY~~a~--vv--DD~~m~ithvi  215 (492)
                      +.=+.|+               .+.+.+.|+-+|+   ...++.||  .+.=.|-+|.-||..  +|  .|+.-..-|+-
T Consensus       102 l~aRnp~~~l~igg~~v~f~~~~~ap~v~D~~~gr---R~~tl~D~~d~~rL~d~l~~Ih~~~~~~v~P~Dip~~~~~l~  178 (505)
T pfam06253       102 LHARNPERDVRIGGKNVIFGPVAGAPNVRDLDRGR---RYGTLADFRNFTRLAQMFPALHSSGGTICEPMDIPVNKRHLD  178 (505)
T ss_pred             EECCCCCCCEEECCCEEEEEECCCCCEEEECCCCC---CCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHH
T ss_conf             80678987656889848998358885688578886---666599999999999998765423897134663791051399


Q ss_pred             CCCCCCCHHHHHH
Q ss_conf             2235430247889
Q gi|255764513|r  216 RGEEWISSVPKHI  228 (492)
Q Consensus       216 Rg~d~~~~t~~q~  228 (492)
                      .--.++.+|-|++
T Consensus       179 ~~ya~l~~TdK~~  191 (505)
T pfam06253       179 TIYAHLTLSDKPF  191 (505)
T ss_pred             HHHHHHHCCCCCE
T ss_conf             9999986799844


No 112
>KOG4144 consensus
Probab=32.93  E-value=35  Score=14.72  Aligned_cols=67  Identities=15%  Similarity=0.223  Sum_probs=44.4

Q ss_pred             HHHHHCCCCHHHHHHHHHHCCCCCCCCCHH-HCCHH---HHHHHHHHHHCCC----CCCC-CHHHHHHHHHHHHHHC
Q ss_conf             456662977377998998506766655301-10146---7776520211375----5442-0156556643555512
Q gi|255764513|r  265 SYYSAMGYLPEALINFLALLFVHKSEDDDE-LMDMQ---QLIHHFDLHHLSK----AGAV-FDKQKLDWLNGRWIRE  332 (492)
Q Consensus       265 ~~~~~~GylPeAilNyLalLGws~~~~d~E-ifsl~---eli~~FdL~~I~K----s~A~-FD~eKL~wlN~qyIr~  332 (492)
                      ..||++|+-|--+..||-.||..+- +.+- ++.-+   -..+.|.++.|+.    ++.+ |-..+--.+-...||.
T Consensus       111 pa~rk~g~a~~Ll~~ylq~l~~q~i-~~r~~Li~h~pLvPFYEr~gFk~vgp~~~~~~~k~F~e~~w~dm~h~~lr~  186 (190)
T KOG4144         111 PAFRKQGRAPILLWRYLQHLGSQPI-VRRAALICHDPLVPFYERFGFKAVGPCAITVGSKTFMELHWSDMGHPFLRR  186 (190)
T ss_pred             HHHHHCCCCHHHHHHHHHHHHCCCC-CCCEEEEECCCCCCHHHHCCCEEECCCCCCCCCCHHHHHHHHHHCCHHHHH
T ss_conf             9898668631689999998626753-121013345775316675074032464222033135878888702888775


No 113
>COG1281 Disulfide bond chaperones of the HSP33 family [Posttranslational modification, protein turnover, chaperones]
Probab=32.91  E-value=35  Score=14.72  Aligned_cols=10  Identities=30%  Similarity=0.418  Sum_probs=5.0

Q ss_pred             CCCCCCEECC
Q ss_conf             7513402136
Q gi|255764513|r  171 DKVYGEMEIP  180 (492)
Q Consensus       171 D~i~G~~~~~  180 (492)
                      ..|||-+..+
T Consensus        86 ~~vRgy~~~~   95 (286)
T COG1281          86 GTVRGYVRNP   95 (286)
T ss_pred             CCEEEEECCC
T ss_conf             7478886287


No 114
>pfam06971 Put_DNA-bind_N Putative DNA-binding protein N-terminus. This family represents the N-terminus (approximately 50 residues) of a number of putative bacterial DNA-binding proteins.
Probab=32.65  E-value=36  Score=14.69  Aligned_cols=30  Identities=30%  Similarity=0.468  Sum_probs=24.4

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHH
Q ss_conf             262899999999999889824514889997766
Q gi|255764513|r   88 SERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM  120 (492)
Q Consensus        88 S~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~  120 (492)
                      -.|+.+|..++++|.+.|.-+.   |.+||...
T Consensus         7 i~RLp~Y~R~L~~L~~~g~~~v---SS~eLa~~   36 (49)
T pfam06971         7 IKRLPLYYRYLEELLEEGVERV---SSKELSEA   36 (49)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEE---CHHHHHHH
T ss_conf             9999999999999998599049---79999999


No 115
>PRK09138 DNA topoisomerase I; Validated
Probab=32.49  E-value=22  Score=16.09  Aligned_cols=111  Identities=20%  Similarity=0.268  Sum_probs=57.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHH---------------------CCCEEEEEECCCCCCCC------CHHHHHHHHHHHHHCC
Q ss_conf             87850159999999999997---------------------18849999704866638------8679999999988658
Q gi|255764513|r   17 GEPHIGTAYTALFNYLIAKR---------------------TGGKFILRIEDTDSKRS------TLESENAVMQSLKWCG   69 (492)
Q Consensus        17 G~lH~G~~rtal~n~l~a~~---------------------~~g~f~lRieDtd~~R~------~~~~~~~i~~~l~wlg   69 (492)
                      |.+-.|-+-|.-.-++.-|.                     .|..|--|+..-|..+.      .++..+.+.+.++--.
T Consensus       162 ~~~SAGRVQSpaLrLIveRE~EI~~F~p~~Yw~i~a~~~~~~g~~f~a~l~~~~gkk~~k~~i~~~~eA~~~~~~l~~~~  241 (887)
T PRK09138        162 GARSAGRVQSVALRLVCDREAEIERFVPREYWSVAALLATPRGDEFEARLTGLDGKKLDKLDIGNGEEAEAAKAALEAAT  241 (887)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCEEEEEEEEECCEECCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             89876510778899999849999851654369999999658897357999862670115466778899999999860697


Q ss_pred             C---CCCCCCCCCCCCCCEE----CCC---CH----HHHHHHHHHHHHC--------CC-EEEC----CCCHHHHHHHHH
Q ss_conf             9---8886765588767632----326---28----9999999999988--------98-2451----488999776688
Q gi|255764513|r   70 L---NWDEGPDIGGAYGPYR----QSE---RK----NIYQPYVQNLLEK--------KL-AFRC----FCSTERLEEMRR  122 (492)
Q Consensus        70 l---~~De~~~~~g~~~p~~----QS~---r~----~~y~~~~~~L~~~--------g~-aY~c----~~t~eel~~~r~  122 (492)
                      +   ...+.+..--|..||-    |.+   ++    ..=..+|++|-+.        |+ -|+=    ..|++-+...|+
T Consensus       242 ~~V~~ve~K~~kr~Pp~PFtTSTLQQeAs~kLGfSa~~TM~iAQ~LYEg~~~~~~~~GlITYmRTDS~~lS~eai~~ar~  321 (887)
T PRK09138        242 FKVASVEAKPAKRNPPPPFTTSTLQQEASRKLGFSASRTMQIAQRLYEGVDIGGETVGLITYMRTDGVQMAPEAITAARD  321 (887)
T ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             59999833422458999964679999999871998999999999997512357775058986147622018999999999


Q ss_pred             HHHHH
Q ss_conf             76643
Q gi|255764513|r  123 AQRKR  127 (492)
Q Consensus       123 ~~~~~  127 (492)
                      .....
T Consensus       322 ~I~~~  326 (887)
T PRK09138        322 AIGER  326 (887)
T ss_pred             HHHHH
T ss_conf             99986


No 116
>pfam08275 Toprim_N DNA primase catalytic core, N-terminal domain.
Probab=32.30  E-value=29  Score=15.34  Aligned_cols=28  Identities=21%  Similarity=0.293  Sum_probs=21.4

Q ss_pred             CCCCHHHHHHCCCCHHHHHHHHHHCCCCCC
Q ss_conf             433024566629773779989985067666
Q gi|255764513|r  260 NPTSISYYSAMGYLPEALINFLALLFVHKS  289 (492)
Q Consensus       260 ~~~~i~~~~~~GylPeAilNyLalLGws~~  289 (492)
                      +....+++.+.|+-++.+-.|  .||++|.
T Consensus        11 ~~~a~~YL~~Rgi~~~~i~~F--~iGyap~   38 (128)
T pfam08275        11 GAAARDYLKSRGLSPETIKRF--GLGYAPD   38 (128)
T ss_pred             CHHHHHHHHHCCCCHHHHHHH--CCCCCCC
T ss_conf             589999999859999999984--8787876


No 117
>PRK05614 gltA type II citrate synthase; Reviewed
Probab=32.14  E-value=37  Score=14.63  Aligned_cols=13  Identities=31%  Similarity=0.432  Sum_probs=8.3

Q ss_pred             CCCHHHHHHHHCH
Q ss_conf             8889999988495
Q gi|255764513|r  453 SLPLFDSIEILGR  465 (492)
Q Consensus       453 GP~L~eil~lLGk  465 (492)
                      -+++|+.+..+||
T Consensus       373 P~~~fT~lFAi~R  385 (414)
T PRK05614        373 PTSMFTVIFALAR  385 (414)
T ss_pred             CHHHHHHHHHHHH
T ss_conf             8677789999999


No 118
>KOG0434 consensus
Probab=32.01  E-value=7.7  Score=19.21  Aligned_cols=33  Identities=30%  Similarity=0.414  Sum_probs=21.6

Q ss_pred             HHHHHHHHHCCCHHHHH---HHHHHHHCCCCCCCCC
Q ss_conf             99999851000001014---5553110132212234
Q gi|255764513|r  228 ILLYQYFNFPIPEFIHL---PLIKNPDKSKLSKRRN  260 (492)
Q Consensus       228 ~~l~~al~~~~p~f~H~---pli~~~~g~klSKR~~  260 (492)
                      ++..-.+=+..|-|..+   .|++.+||+|||||..
T Consensus       572 L~VlsT~LF~kppfkNvIvnGlVLAeDG~KMSKrlk  607 (1070)
T KOG0434         572 LLVLSTALFGKPPFKNVIVNGLVLAEDGKKMSKRLK  607 (1070)
T ss_pred             HHHHHHHHCCCCCCHHEEEEEEEEECCCHHHHHHHH
T ss_conf             999999871798522216701688121077766531


No 119
>PRK10602 murein peptide amidase A; Provisional
Probab=31.89  E-value=22  Score=16.10  Aligned_cols=75  Identities=19%  Similarity=0.212  Sum_probs=46.6

Q ss_pred             CCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHH--HHHHHHHCCCCCCCC
Q ss_conf             323564100045324898678876444444431122354302478899999851000001014--555311013221223
Q gi|255764513|r  182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHL--PLIKNPDKSKLSKRR  259 (492)
Q Consensus       182 ~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~--pli~~~~g~klSKR~  259 (492)
                      +.++.+++.=.     +--++.+.-..|+-+|   |+|    +.--..+..+|-|-+|...++  =+.+|+||.+++-|-
T Consensus        23 SvlGaPL~yfp-----a~~~~~~~~LiiaGiH---GDE----~a~~~~ls~~lr~l~~~~~~~~vi~~~NpDg~~~~~r~   90 (237)
T PRK10602         23 SLLGAPLIWFP-----APAASRESGLILAGTH---GDE----TSSVVTLSCALRTLTPSLRRHHVVLAVNPDGCQLGLRA   90 (237)
T ss_pred             ECCCCCEEEEE-----CCCCCCCEEEEEEECC---CCC----HHHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCCCCCC
T ss_conf             14898247753-----5788882689985315---774----36899999999707955531889976677612101133


Q ss_pred             CCCCHHHHH
Q ss_conf             433024566
Q gi|255764513|r  260 NPTSISYYS  268 (492)
Q Consensus       260 ~~~~i~~~~  268 (492)
                      ++-.|+--|
T Consensus        91 na~~vdlnr   99 (237)
T PRK10602         91 NANGVDLNR   99 (237)
T ss_pred             CCCCCCCCC
T ss_conf             565642236


No 120
>pfam07155 DUF1393 Protein of unknown function (DUF1393). This family consists of several bacterial proteins of around 180 residues in length. The function of this family is unknown.
Probab=31.34  E-value=17  Score=16.85  Aligned_cols=24  Identities=29%  Similarity=0.393  Sum_probs=15.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             887850159999999999997188
Q gi|255764513|r   16 TGEPHIGTAYTALFNYLIAKRTGG   39 (492)
Q Consensus        16 tG~lH~G~~rtal~n~l~a~~~~g   39 (492)
                      +|+.|+|.+-.++...++-+..|.
T Consensus        32 ~g~i~lg~~~i~l~a~l~Gp~~G~   55 (169)
T pfam07155        32 GGFINLGDAFIALAAVLFGPKVGF   55 (169)
T ss_pred             CCEEEECHHHHHHHHHHHCCHHHH
T ss_conf             866862349999999996836899


No 121
>cd06114 EcCS_like Escherichia coli (Ec) citrate synthase (CS) GltA_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA.  There are two types of CSs: type I CS and type II CSs.  Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site.  Type II CSs are unique to gram-negative bacteria and are homohexamers of identical subunits (approximated as a trimer of dimers).  Some typ
Probab=31.01  E-value=38  Score=14.51  Aligned_cols=12  Identities=33%  Similarity=0.567  Sum_probs=6.1

Q ss_pred             CCHHHHHHHHCH
Q ss_conf             889999988495
Q gi|255764513|r  454 LPLFDSIEILGR  465 (492)
Q Consensus       454 P~L~eil~lLGk  465 (492)
                      +++|+.+..++|
T Consensus       361 ~dlfT~iFaisR  372 (400)
T cd06114         361 TEMFTVLFALGR  372 (400)
T ss_pred             HHHHHHHHHHHH
T ss_conf             676369999999


No 122
>KOG3180 consensus
Probab=30.81  E-value=2  Score=23.27  Aligned_cols=85  Identities=21%  Similarity=0.245  Sum_probs=50.6

Q ss_pred             CCCCEECCCCC-CCCCCEECCCCCHHHHHHHHHHHHH---HHHHHHHCC-CCCCCHHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             13402136432-3564100045324898678876444---444431122-354302478899999851000001014555
Q gi|255764513|r  173 VYGEMEIPWNA-VDMQVLLKSDGMPTYHLANVIDDHL---MKITHVARG-EEWISSVPKHILLYQYFNFPIPEFIHLPLI  247 (492)
Q Consensus       173 i~G~~~~~~~~-~~D~vi~r~dg~ptY~~a~vvDD~~---m~ithviRg-~d~~~~t~~q~~l~~al~~~~p~f~H~pli  247 (492)
                      +-|++.++-+. ---..+.--=|||-..||+-|.+..   +.||.=|-| +|-+.. -.-..|-.-|-.+.|.||.+|-|
T Consensus       119 llGKQAIDDD~nqTgqmlA~lL~WPQ~t~askV~~~~~~~~~VtREIDgGletl~~-~lPaVittDLRLN~PRya~Lpni  197 (254)
T KOG3180         119 LLGKQAIDDDCNQTGQMLAALLGWPQATFASKVELEGDKRVKVTREIDGGLETLKV-KLPAVITTDLRLNTPRYATLPNI  197 (254)
T ss_pred             EECCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEEEEECCCHHHEEE-CCCEEEEEECCCCCCCCCCCHHH
T ss_conf             97220025620246789999857841033003798489717999870587532120-47528974020178521352778


Q ss_pred             HHHHCCCCCCC
Q ss_conf             31101322122
Q gi|255764513|r  248 KNPDKSKLSKR  258 (492)
Q Consensus       248 ~~~~g~klSKR  258 (492)
                      +....+.|-|-
T Consensus       198 MKAkkkpl~k~  208 (254)
T KOG3180         198 MKAKKKPLKKM  208 (254)
T ss_pred             HHHCCCCCCCC
T ss_conf             77510874557


No 123
>PRK01402 hslO Hsp33-like chaperonin; Reviewed
Probab=30.66  E-value=39  Score=14.47  Aligned_cols=14  Identities=7%  Similarity=0.027  Sum_probs=8.0

Q ss_pred             CCCCCCCEECCCCC
Q ss_conf             47513402136432
Q gi|255764513|r  170 QDKVYGEMEIPWNA  183 (492)
Q Consensus       170 ~D~i~G~~~~~~~~  183 (492)
                      .-.|||-+.++...
T Consensus        95 ~g~vRGya~~d~~~  108 (327)
T PRK01402         95 PDRLRAYARFDEER  108 (327)
T ss_pred             CCCEEEEEECCHHH
T ss_conf             98579999668342


No 124
>COG5279 CYK3 Uncharacterized protein involved in cytokinesis, contains TGc (transglutaminase/protease-like) domain [Cell division and chromosome partitioning]
Probab=30.35  E-value=39  Score=14.44  Aligned_cols=157  Identities=14%  Similarity=0.158  Sum_probs=88.2

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEE-EEEECCC-
Q ss_conf             32628999999999998898245148899977668876643100023665557883330011202577407-8862243-
Q gi|255764513|r   87 QSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVV-RLTVPNQ-  164 (492)
Q Consensus        87 QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~i-R~k~p~~-  164 (492)
                      ++.+ .+|..+.+++...---+..-||.=+. +.++.+.+.|.|-.+-.-...   ..+--.......++| +.|+..+ 
T Consensus       188 ~i~d-~~ytt~l~~~r~~~I~heavCtgYa~-lfK~lcn~lgIp~~iIegf~k---~~~~~~~~~~iNHaWN~VkiD~~y  262 (521)
T COG5279         188 NIQD-PRYTTVLAQMRSVLINHEAVCTGYAE-LFKELCNALGIPCEIIEGFLK---SPIYYTRDININHAWNIVKIDNEY  262 (521)
T ss_pred             CCCC-CHHHHHHHHHHHHHHHCCCCCCHHHH-HHHHHHHHCCCCEEEEEECCC---CCCCCCCCCCCCCEEEEEEECCEE
T ss_conf             5786-00455644434554201111525999-999998853996677751235---663026776632201379977858


Q ss_pred             --CEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCC-HHHHHHHHHHHHHHCCCHH
Q ss_conf             --1143047513402136432356410004532489867887644444443112235430-2478899999851000001
Q gi|255764513|r  165 --GSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWIS-SVPKHILLYQYFNFPIPEF  241 (492)
Q Consensus       165 --~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ithviRg~d~~~-~t~~q~~l~~al~~~~p~f  241 (492)
                        -++.|.|-|++...          ...++-.++|.+   .-|..|=.||+++-++|-. --|.-..+..+|-|-.|.|
T Consensus       263 y~VDtTwgdPI~~d~~----------~~~~~~n~~YF~---lap~qMi~tH~p~k~~wq~~~~~~d~~~~~~lp~vt~~~  329 (521)
T COG5279         263 YLVDTTWGDPIHPDQN----------SKSSKINHSYFL---LAPNQMIATHVPEKDDWQFIKPDLDMPIVMALPWVSPVF  329 (521)
T ss_pred             EEEEEECCCCCCCCCC----------CCCCCCCCHHCC---CCHHHHHHHCCCCCCHHHCCCCCHHHHHHHHCCCCCCHH
T ss_conf             9985003787765533----------333555700200---786787640489810545457750022222134236312


Q ss_pred             HHHHHHHHHHCCCCCCCCCC
Q ss_conf             01455531101322122343
Q gi|255764513|r  242 IHLPLIKNPDKSKLSKRRNP  261 (492)
Q Consensus       242 ~H~pli~~~~g~klSKR~~~  261 (492)
                      -...|.+-.--++||--++.
T Consensus       330 f~~~l~l~~~~~~~~~~~~~  349 (521)
T COG5279         330 FTLGLKLRKFNTSILHLNDL  349 (521)
T ss_pred             HCCCCEEEECCCCCCCCCCC
T ss_conf             20451365225432235762


No 125
>COG2969 SspB Stringent starvation protein B [General function prediction only]
Probab=28.53  E-value=22  Score=16.13  Aligned_cols=20  Identities=25%  Similarity=0.574  Sum_probs=13.8

Q ss_pred             CCEEEECCCCCCCCCCHHHH
Q ss_conf             77056348433887850159
Q gi|255764513|r    5 SKVRVRIAPSPTGEPHIGTA   24 (492)
Q Consensus         5 ~~v~~RfaPsPtG~lH~G~~   24 (492)
                      ..|+.-.||+-||.||+||-
T Consensus        48 gqIVLNvs~~Av~nL~l~Nd   67 (155)
T COG2969          48 GQIVLNIAPRAVGNLELGND   67 (155)
T ss_pred             CEEEEEECCCCCCCEEECCC
T ss_conf             85999717211036685375


No 126
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: IPR014088   Members of this protein family include S-adenosylmethionine-dependent C-20 methyltransferase (BchU), part of the pathway of bacteriochlorophyll c production in photosynthetic green sulphur bacteria. The position modified by this enzyme represents the difference between bacteriochlorophylls c and d; strains lacking this protein can only produce bacteriochlorophyll d..
Probab=28.19  E-value=33  Score=14.97  Aligned_cols=26  Identities=27%  Similarity=0.503  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             89867887644444443112235430
Q gi|255764513|r  197 TYHLANVIDDHLMKITHVARGEEWIS  222 (492)
Q Consensus       197 tY~~a~vvDD~~m~ithviRg~d~~~  222 (492)
                      .-..|..+||..|+.+.||||.--..
T Consensus        85 ~~~~A~L~~~yYl~L~~~VRG~~~F~  110 (306)
T TIGR02716        85 VDAIADLIDDYYLRLADVVRGKKDFK  110 (306)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCE
T ss_conf             99999998877554566524531440


No 127
>COG3350 Uncharacterized conserved protein [Function unknown]
Probab=28.05  E-value=43  Score=14.18  Aligned_cols=20  Identities=25%  Similarity=0.464  Sum_probs=15.5

Q ss_pred             CCCEEECCCCHHHHHHHHHHH
Q ss_conf             898245148899977668876
Q gi|255764513|r  104 KKLAFRCFCSTERLEEMRRAQ  124 (492)
Q Consensus       104 ~g~aY~c~~t~eel~~~r~~~  124 (492)
                      .|+-|+ |||++-.+..++..
T Consensus        24 ~GktYY-Fcse~~~~~F~~~P   43 (53)
T COG3350          24 GGKTYY-FCSEECKEKFKDNP   43 (53)
T ss_pred             CCEEEE-EECHHHHHHHHHCH
T ss_conf             887899-70899999987797


No 128
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]
Probab=27.27  E-value=22  Score=16.08  Aligned_cols=42  Identities=17%  Similarity=0.153  Sum_probs=22.8

Q ss_pred             HHHHHHHHHCCCEEEEEECCCCC---CCCCHHHHHHHHHHHHHCCCC
Q ss_conf             99999999718849999704866---638867999999998865898
Q gi|255764513|r   28 LFNYLIAKRTGGKFILRIEDTDS---KRSTLESENAVMQSLKWCGLN   71 (492)
Q Consensus        28 l~n~l~a~~~~g~f~lRieDtd~---~R~~~~~~~~i~~~l~wlgl~   71 (492)
                      ..|.++-++.  .=++-+-|--+   .|...+.++.|++=|.--|.+
T Consensus        79 ~~s~~~i~q~--~~~~s~~DpRplrdk~yqq~c~~~I~~yL~engfd  123 (622)
T COG5185          79 SVSRLSINQL--QQHLSNRDPRPLRDKNYQQACQEEIYDYLKENGFD  123 (622)
T ss_pred             HHHHHHHHHH--HHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             4259999861--30014589853331107899999999999975887


No 129
>pfam09424 YqeY Yqey-like protein. The function of this domain found in the YqeY protein is uncertain.
Probab=27.16  E-value=44  Score=14.07  Aligned_cols=56  Identities=14%  Similarity=0.171  Sum_probs=39.4

Q ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCC----HHHHCCEEEEEEECCCCCCCHHHHH
Q ss_conf             999999999840588899888999999999995798----2331012678896488888899999
Q gi|255764513|r  400 IDILKTTQEEFEVIQIWKRENIETALRNVAQHREKS----LKIIVKPLFLAITGSKYSLPLFDSI  460 (492)
Q Consensus       400 ~~iL~~~~~~L~~~~~w~~e~Ie~~ik~i~e~~giK----~k~l~~PLRiALTG~~~GP~L~eil  460 (492)
                      ..+|..++..     ..+.+.++.++.++..++|..    +|.||..+.-.+-|+.-|--+..++
T Consensus        80 i~il~~yLP~-----qlseeEl~~~i~~~i~e~ga~~~kdmGkVM~~l~~~~~G~~Dg~~vs~iV  139 (143)
T pfam09424        80 IAILEEYLPQ-----QLSDEEIEALVDEAIAEVGATSMKDMGKVMGALMPKVAGRADGKLVSALV  139 (143)
T ss_pred             HHHHHHHCCC-----CCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             9999974633-----69999999999999998389985889999999998758868779999999


No 130
>cd03348 pro_PheOH Prokaryotic phenylalanine-4-hydroxylase (pro_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes the eukaryotic proteins, phenylalanine-4-hydroxylase (eu_PheOH), tyrosine hydroxylase (TyrOH) and tryptophan hydroxylase (TrpOH). PheOH catalyzes the hydroxylation of L-Phe to L-tyrosine (L-Tyr). It uses (6R)-L-erythro-5,6,7,8-tetrahydrobiopterin (BH4) as the physiological electron donor.
Probab=26.93  E-value=13  Score=17.70  Aligned_cols=75  Identities=15%  Similarity=0.174  Sum_probs=47.3

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHH
Q ss_conf             67887644444443112235430247889999985100000101455531101322122343302456662977377998
Q gi|255764513|r  200 LANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALIN  279 (492)
Q Consensus       200 ~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~~~i~~~~~~GylPeAilN  279 (492)
                      |-...-+-..-+|.-||-.+++.=||--=.+.+       .|+|+||+.|++=...+..-|.+++..-      ...-+.
T Consensus        82 Ff~~LA~r~Fp~t~~iR~~~~~~YtpEPDifHe-------~~GH~P~L~np~fA~f~q~~G~~~l~a~------~~~~~~  148 (228)
T cd03348          82 FFEHLANRRFPVTNFIRRPEELDYLQEPDIFHD-------IFGHVPMLTNPVFADFMQAYGKGGLKAT------GLEDRA  148 (228)
T ss_pred             HHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHH-------HHCCCCCCCCHHHHHHHHHHHHHHHCCC------CHHHHH
T ss_conf             999986682433524458653566889428999-------8365620088899999999999984579------899999


Q ss_pred             HHHHCCCC
Q ss_conf             99850676
Q gi|255764513|r  280 FLALLFVH  287 (492)
Q Consensus       280 yLalLGws  287 (492)
                      +|++|=|-
T Consensus       149 ~L~rlyWf  156 (228)
T cd03348         149 LLARLYWY  156 (228)
T ss_pred             HHHHHHHE
T ss_conf             98777630


No 131
>PRK07941 DNA topoisomerase I; Validated
Probab=26.89  E-value=45  Score=14.04  Aligned_cols=73  Identities=21%  Similarity=0.226  Sum_probs=34.5

Q ss_pred             HHHHHHHHHHHHHCCC---CCCCCCCCCCCCCCEECC----C---C----HHHHHHHHHHHHHCCCEEEC-----CCCHH
Q ss_conf             6799999999886589---888676558876763232----6---2----89999999999988982451-----48899
Q gi|255764513|r   55 LESENAVMQSLKWCGL---NWDEGPDIGGAYGPYRQS----E---R----KNIYQPYVQNLLEKKLAFRC-----FCSTE  115 (492)
Q Consensus        55 ~~~~~~i~~~l~wlgl---~~De~~~~~g~~~p~~QS----~---r----~~~y~~~~~~L~~~g~aY~c-----~~t~e  115 (492)
                      ++..+.+.+.++--.+   ...+.+..-.|..||--|    +   +    -..=..+|++|-+.|+.=|-     +.|++
T Consensus       265 e~~A~~~~~~l~~~~~~V~~ve~K~~~r~P~pPFtTSTLQQeAsrkLgfSa~~TM~iAQ~LYE~GlITYmRTDS~~LS~e  344 (933)
T PRK07941        265 EARATALAAGLQGAQLSVASVEEKPYTRRPYAPFMTSTLQQEAGRKLRFSSERTMSIAQRLYENGYITYMRTDSTTLSES  344 (933)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCHH
T ss_conf             99999999972279638998874343568989976799999998737969999999999998477465404787626999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             977668876643
Q gi|255764513|r  116 RLEEMRRAQRKR  127 (492)
Q Consensus       116 el~~~r~~~~~~  127 (492)
                      -++..|+.....
T Consensus       345 ai~~ar~~I~~~  356 (933)
T PRK07941        345 AINAARTQARQL  356 (933)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999974


No 132
>PRK08780 DNA topoisomerase III; Provisional
Probab=26.86  E-value=34  Score=14.81  Aligned_cols=17  Identities=6%  Similarity=0.253  Sum_probs=7.4

Q ss_pred             CCHHHHHHHHHHHHHHH
Q ss_conf             85015999999999999
Q gi|255764513|r   19 PHIGTAYTALFNYLIAK   35 (492)
Q Consensus        19 lH~G~~rtal~n~l~a~   35 (492)
                      |-.|-+-|.-..++.-|
T Consensus       166 lSAGRVQSpaL~LIveR  182 (783)
T PRK08780        166 LSAGRVQSPALRMIVER  182 (783)
T ss_pred             CCCCCCCHHHHHHHHHH
T ss_conf             66310022888889999


No 133
>TIGR03388 ascorbase L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
Probab=26.64  E-value=45  Score=14.01  Aligned_cols=33  Identities=15%  Similarity=0.190  Sum_probs=19.2

Q ss_pred             CCEEEECCCCCCCCC----CHHHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             770563484338878----50159999999999997188499997
Q gi|255764513|r    5 SKVRVRIAPSPTGEP----HIGTAYTALFNYLIAKRTGGKFILRI   45 (492)
Q Consensus         5 ~~v~~RfaPsPtG~l----H~G~~rtal~n~l~a~~~~g~f~lRi   45 (492)
                      +.-+-||-....|-.    |.|.        .++.-.=|-+|++=
T Consensus        85 ~tftY~F~~~q~GTyWYHsH~~~--------Q~~dGl~GplII~~  121 (541)
T TIGR03388        85 ETFIYNFVVDRPGTYFYHGHYGM--------QRSAGLYGSLIVDV  121 (541)
T ss_pred             CCEEEEEECCCCEEEEEEECCCC--------HHHCCCEEEEEECC
T ss_conf             96899997889873686136330--------54366355799807


No 134
>TIGR01267 Phe4hydrox_mono phenylalanine-4-hydroxylase; InterPro: IPR005960    This entry represents the small, monomeric form of phenylalanine-4-hydroxylase (PAH; 1.14.16.1 from EC), as found in a certain Gram-negative bacteria. The enzyme is biopterin and metal dependent, and acts to irreversibly convert phenylalanine to tyrosine, the rate-limiting step in phenylalanine catabolism in some systems:    L-phenylalanine + tetrahydrobiopterin + O2 = L-tyrosine + dihydrobiopterin + H2O     The structure of PAH from Colwellia psychrerythraea (strain 34H / ATCC BAA-681), which binds tetrahydrobiopterin (BH4) as cofactor, is a cold-active form of the enzyme that has increased stability and flexibility around the active site .   More information about these proteins can be found at Protein of the Month: Phenylalanine Hydroxylase .; GO: 0004505 phenylalanine 4-monooxygenase activity, 0006559 L-phenylalanine catabolic process.
Probab=26.62  E-value=16  Score=16.98  Aligned_cols=12  Identities=50%  Similarity=0.847  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             010145553110
Q gi|255764513|r  240 EFIHLPLIKNPD  251 (492)
Q Consensus       240 ~f~H~pli~~~~  251 (492)
                      -|+|+||+.||=
T Consensus       115 ~FGHvPlL~nPv  126 (251)
T TIGR01267       115 LFGHVPLLTNPV  126 (251)
T ss_pred             CCCCCCCCCCCC
T ss_conf             037665345740


No 135
>pfam12000 DUF3495 Domain of unknown function (DUF3495). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 170 amino acids in length. This domain is found associated with pfam00534. This domain has a single completely conserved residue G that may be functionally important.
Probab=26.37  E-value=8.9  Score=18.80  Aligned_cols=57  Identities=19%  Similarity=0.156  Sum_probs=39.0

Q ss_pred             CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHHHHHHH-CCCCCCCCHHHH
Q ss_conf             302456662977377998998506766655301101467776520211-375544201565
Q gi|255764513|r  262 TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHH-LSKAGAVFDKQK  321 (492)
Q Consensus       262 ~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~FdL~~-I~Ks~A~FD~eK  321 (492)
                      -.+..++++||-|+-|   ++=-|||.+---++|+.---++-.|++-- -.-+..-||++-
T Consensus        55 ~aa~~L~~~Gf~PDvI---i~H~GWGe~LfLkdv~P~a~li~Y~E~~y~~~g~d~gFDpe~  112 (172)
T pfam12000        55 RAARQLRAQGFRPDVI---VAHPGWGETLFLKDVWPDARLIGYFEFYYRASGADVGFDPEF  112 (172)
T ss_pred             HHHHHHHHCCCCCCEE---EECCCCCCHHCHHHHCCCCCEEEEEEEEECCCCCCCCCCCCC
T ss_conf             9999999749999989---875876401057777658875788877874888767858577


No 136
>cd00361 arom_aa_hydroxylase Biopterin-dependent aromatic amino acid hydroxylase; a family of non-heme, iron(II)-dependent enzymes that includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH). PheOH converts L-phenylalanine to L-tyrosine, an important step in phenylalanine catabolism and neurotransmitter biosynthesis, and is linked to a severe variant of phenylketonuria in humans. TyrOH and TrpOH are involved in the biosynthesis of catecholamine and serotonin, respectively. The eukaryotic enzymes are all homotetramers.
Probab=25.76  E-value=10  Score=18.41  Aligned_cols=75  Identities=20%  Similarity=0.242  Sum_probs=49.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHH
Q ss_conf             67887644444443112235430247889999985100000101455531101322122343302456662977377998
Q gi|255764513|r  200 LANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALIN  279 (492)
Q Consensus       200 ~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~~~i~~~~~~GylPeAilN  279 (492)
                      |-...-+-..-+|..||-.+++.=||--=.+.+       .|+|+|++.|++=...+.+-|.+++..-      ...-+.
T Consensus        76 F~~~LA~r~Fp~t~~iR~~~~~~YtpEPDifHe-------~~GH~P~L~~p~fA~f~q~~G~~~~~a~------~~~~~~  142 (221)
T cd00361          76 FFALLAFRVFPVTQYIRHPEEPDYTPEPDIFHE-------LFGHVPLLADPSFADFSQEYGLASLGAS------DLEEIE  142 (221)
T ss_pred             HHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHH-------HHCCCCCCCCHHHHHHHHHHHHHHHCCC------CHHHHH
T ss_conf             999986581332534457876777899943877-------6167731179889999999999985679------999999


Q ss_pred             HHHHCCCC
Q ss_conf             99850676
Q gi|255764513|r  280 FLALLFVH  287 (492)
Q Consensus       280 yLalLGws  287 (492)
                      +|++|=|-
T Consensus       143 ~L~rlyWf  150 (221)
T cd00361         143 KLARLYWF  150 (221)
T ss_pred             HHHHHHHH
T ss_conf             99877731


No 137
>TIGR00432 arcsn_tRNA_tgt archaeosine tRNA-ribosyltransferase; InterPro: IPR004804   The archaeosine tRNA-guanine transglycosylase (tgt) differs from the tgt of Escherichia coli and other bacteria in the site of action and the modification that results. It exchanges 7-cyano-7-deazaguanine (preQ0) with guanine at position 15 of archaeal tRNA; this nucleotide is subsequently converted to archaeosine, found exclusively in the archaea. In contrast, bacterial tgt catalyzes the exchange of preQ0 or preQ1 for the guanine base at position 34; this nucleotide is subsequently modified to queuosine (IPR004803 from INTERPRO). Archaeoglobus fulgidus has both enzymes. .
Probab=25.72  E-value=33  Score=14.96  Aligned_cols=13  Identities=8%  Similarity=0.169  Sum_probs=9.5

Q ss_pred             CHHHHHHHHHHHH
Q ss_conf             0156556643555
Q gi|255764513|r  317 FDKQKLDWLNGRW  329 (492)
Q Consensus       317 FD~eKL~wlN~qy  329 (492)
                      +||+.|.-||++-
T Consensus       286 ytP~EL~~m~k~E  298 (658)
T TIGR00432       286 YTPEELASMEKEE  298 (658)
T ss_pred             CCHHHHHHCCHHH
T ss_conf             8827764127777


No 138
>COG0302 FolE GTP cyclohydrolase I [Coenzyme metabolism]
Probab=25.61  E-value=42  Score=14.23  Aligned_cols=27  Identities=33%  Similarity=0.288  Sum_probs=20.7

Q ss_pred             EECCCCCCCCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             9704866638867999999998865898886
Q gi|255764513|r   44 RIEDTDSKRSTLESENAVMQSLKWCGLNWDE   74 (492)
Q Consensus        44 RieDtd~~R~~~~~~~~i~~~l~wlgl~~De   74 (492)
                      ++++||.+|    .++.+-.-|.|+|.++|-
T Consensus         6 ~~~~~~~e~----~e~avr~lL~~~Gedp~r   32 (195)
T COG0302           6 MDRETDAER----IEAAVRELLEALGEDPDR   32 (195)
T ss_pred             CCCHHHHHH----HHHHHHHHHHHHCCCCCC
T ss_conf             123334899----999999999982799770


No 139
>cd00498 Hsp33 Heat shock protein 33 (Hsp33):  Cytosolic protein that acts as a molecular chaperone under oxidative conditions.  In normal (reducing) cytosolic conditions, four conserved Cys residues are coordinated by a Zn ion.  Under oxidative stress (such as heat shock), the Cys are reversibly oxidized to disulfide bonds, which causes the chaperone activity to be turned on.  Hsp33 is homodimeric in its functional form.
Probab=25.46  E-value=47  Score=13.87  Aligned_cols=11  Identities=27%  Similarity=0.181  Sum_probs=6.2

Q ss_pred             CCCCCEECCCC
Q ss_conf             51340213643
Q gi|255764513|r  172 KVYGEMEIPWN  182 (492)
Q Consensus       172 ~i~G~~~~~~~  182 (492)
                      .|||-+.++..
T Consensus        81 ~vRGy~~~~~~   91 (275)
T cd00498          81 TVRGYVRNPEV   91 (275)
T ss_pred             CEEEEEECCCC
T ss_conf             48999806632


No 140
>pfam10863 DUF2702 Protein of unknown function (DUF2702). This eukaryotic family of proteins has no known function.
Probab=25.18  E-value=40  Score=14.38  Aligned_cols=29  Identities=34%  Similarity=0.594  Sum_probs=11.8

Q ss_pred             HHHCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             0110146777652021137554420156556643
Q gi|255764513|r  293 DELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLN  326 (492)
Q Consensus       293 ~Eifsl~eli~~FdL~~I~Ks~A~FD~eKL~wlN  326 (492)
                      +||-.-++|-..|-+. ++.+.+    +-|.||.
T Consensus         5 kEIKeK~aLQAkfQla-fS~nn~----kvl~WL~   33 (142)
T pfam10863         5 KEIKEKQALQAKFQLA-FSNNTA----KVLSWLK   33 (142)
T ss_pred             HHHHHHHHHHHHHHHH-HHHHHH----HHHHHCC
T ss_conf             8899999999999999-877679----9986328


No 141
>pfam03315 SDH_beta Serine dehydratase beta chain. L-serine dehydratase (EC:4.2.1.13) is a found as a heterodimer of alpha and beta chain or as a fusion of the two chains in a single protein. This enzyme catalyses the deamination of serine to form pyruvate. This enzyme is part of the gluconeogenesis pathway.
Probab=24.94  E-value=24  Score=15.85  Aligned_cols=19  Identities=26%  Similarity=0.487  Sum_probs=9.6

Q ss_pred             CCCCCCHHHHHHHH-HHHHH
Q ss_conf             38878501599999-99999
Q gi|255764513|r   15 PTGEPHIGTAYTAL-FNYLI   33 (492)
Q Consensus        15 PtG~lH~G~~rtal-~n~l~   33 (492)
                      |+--=.+|-+|.|. |.-++
T Consensus         5 PSSSHTvGPmrAa~~f~~~l   24 (148)
T pfam03315         5 PSSSHTVGPMRAARRFRDLL   24 (148)
T ss_pred             CCHHHHHHHHHHHHHHHHHH
T ss_conf             76017899999999999985


No 142
>pfam01430 HSP33 Hsp33 protein. Hsp33 is a molecular chaperone, distinguished from all other known chaperones by its mode of functional regulation. Its activity is redox regulated. Hsp33 is a cytoplasmically localized protein with highly reactive cysteines that respond quickly to changes in the redox environment. Oxidising conditions like H2O2 cause disulfide bonds to form in Hsp33, a process that leads to the activation of its chaperone function.
Probab=24.72  E-value=49  Score=13.78  Aligned_cols=12  Identities=33%  Similarity=0.548  Sum_probs=7.0

Q ss_pred             CCCHHHHHHHHH
Q ss_conf             977377998998
Q gi|255764513|r  271 GYLPEALINFLA  282 (492)
Q Consensus       271 GylPeAilNyLa  282 (492)
                      |-+.+.+-+|+.
T Consensus       132 g~iae~l~~Yf~  143 (274)
T pfam01430       132 GEIAEDLEYYFA  143 (274)
T ss_pred             CCHHHHHHHHHH
T ss_conf             989999999997


No 143
>pfam03206 NifW Nitrogen fixation protein NifW. Nitrogenase is a complex metalloenzyme composed of two proteins designated the Fe-protein and the MoFe-protein. Apart from these two proteins, a number of accessory proteins are essential for the maturation and assembly of nitrogenase. Even though experimental evidence suggests that these accessory proteins are required for nitrogenase activity, the exact roles played by many of these proteins in the functions of nitrogenase are unclear. Using yeast two-hybrid screening it has been shown that NifW can interact with itself as well as NifZ.
Probab=24.41  E-value=49  Score=13.74  Aligned_cols=53  Identities=19%  Similarity=0.279  Sum_probs=34.6

Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHH-HHHHHHHHHH
Q ss_conf             998865898886765588767632326289999999999988982451488999-7766887664
Q gi|255764513|r   63 QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTER-LEEMRRAQRK  126 (492)
Q Consensus        63 ~~l~wlgl~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~ee-l~~~r~~~~~  126 (492)
                      +=++.||+.+|...         .+..|++|-+..-+.|-+...+ ++- ++++ +...|....+
T Consensus        15 dff~~f~v~yDp~v---------v~V~RLHILkrF~~yl~~~~~~-~~~-~e~~~~~~yr~~L~~   68 (103)
T pfam03206        15 EFFDFFGVPYDPKV---------VNVNRLHILKRFGQYLAAEDFN-EDL-SEAEKLALYRAALER   68 (103)
T ss_pred             HHHHHHCCCCCHHH---------HHHHHHHHHHHHHHHHHHCCCC-CCC-CHHHHHHHHHHHHHH
T ss_conf             99998489977004---------5599999999999999854467-899-999999999999999


No 144
>TIGR02930 vnfG_nitrog V-containing nitrogenase, delta subunit; InterPro: IPR014279   Nitrogenase, also called dinitrogenase, is the enzyme which catalyses the conversion of molecular nitrogen to ammonia (biological nitrogen fixation). The most widespread and most efficient nitrogenase contains a molybdenum cofactor. This entry, also known as the VnfG family, represents the delta subunit of the vanadium-containing V nitrogenase. It is homologous to AnfG, the delta subunit of the iron-only nitrogenase..
Probab=24.11  E-value=50  Score=13.70  Aligned_cols=80  Identities=15%  Similarity=0.180  Sum_probs=50.3

Q ss_pred             HCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCHHHHCC
Q ss_conf             25320356677556752246788854554331486679999999999840588899888999999999995798233101
Q gi|255764513|r  362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVK  441 (492)
Q Consensus       362 eRi~tL~Di~~~~~ffF~~~~~~d~e~~~k~~~~~e~~~~iL~~~~~~L~~~~~w~~e~Ie~~ik~i~e~~giK~k~l~~  441 (492)
                      +|=++...|.....-+|......-+-...|.  .=.+++.+..++.+.+.=+.+.+++.|.+.+..+...+         
T Consensus        23 DReENI~Gv~~~~~~Ll~GE~~~~eTp~dkl--FYaDA~~l~~d~k~~~PWi~~l~k~~i~el~~svK~~L---------   91 (109)
T TIGR02930        23 DREENIEGVLKKAGKLLNGEKVKKETPMDKL--FYADAKVLVSDLKERFPWIKELDKDQIKELLESVKKRL---------   91 (109)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCCCCHHHHH--HHHHHHHHHHHHHHCCCCHHCCCHHHHHHHHHHHHHHH---------
T ss_conf             4142078899999787508723202512465--67648999999763177201079767899999887667---------


Q ss_pred             EEEEEEECCCCC
Q ss_conf             267889648888
Q gi|255764513|r  442 PLFLAITGSKYS  453 (492)
Q Consensus       442 PLRiALTG~~~G  453 (492)
                       +-+|+|++.+|
T Consensus        92 -~~iai~~S~N~  102 (109)
T TIGR02930        92 -VEIAITRSLNG  102 (109)
T ss_pred             -HHHHHCCCCCC
T ss_conf             -88763013475


No 145
>PRK10122 UTP--glucose-1-phosphate uridylyltransferase subunit GalF; Provisional
Probab=23.80  E-value=51  Score=13.66  Aligned_cols=76  Identities=12%  Similarity=0.144  Sum_probs=50.3

Q ss_pred             CCHHHHHHHHHHCCCCCCCCCHHHCC-HHHHHHHHHHHHCCCCCCCCHH-HHHHHHHHHHHHCCCCHHHHHHHHHHHHCC
Q ss_conf             77377998998506766655301101-4677765202113755442015-655664355551269989999864442000
Q gi|255764513|r  272 YLPEALINFLALLFVHKSEDDDELMD-MQQLIHHFDLHHLSKAGAVFDK-QKLDWLNGRWIREKLSTTEFLSRVSQWMKE  349 (492)
Q Consensus       272 ylPeAilNyLalLGws~~~~d~Eifs-l~eli~~FdL~~I~Ks~A~FD~-eKL~wlN~qyIr~~l~~~el~~~l~~~l~~  349 (492)
                      +++..+++||..+.-|.. ||-|+-+ ++.|++.-.+..+.-.|-+||. .++.|+.++ |.-.+...++-..+..|+++
T Consensus       216 i~~p~IF~~L~~~~p~~~-GEiqLTDAi~~l~~~~~v~~~~~~G~~~D~G~~~g~l~A~-i~~al~~~~~~~~~~~~l~~  293 (297)
T PRK10122        216 VLSADIWPELERTQPGAW-GRIQLTDAIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAF-VKYGLRNLKEGAKFRKGIEK  293 (297)
T ss_pred             EECHHHHHHHHHCCCCCC-CEEEHHHHHHHHHCCCCEEEEEECCEEECCCCHHHHHHHH-HHHHHCCHHHHHHHHHHHHH
T ss_conf             728799999970899999-8588999999997019879999551797579862699999-99996798788999999999


No 146
>PRK13531 regulatory ATPase RavA; Provisional
Probab=23.53  E-value=25  Score=15.78  Aligned_cols=71  Identities=18%  Similarity=0.250  Sum_probs=36.9

Q ss_pred             EEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECCCC-CHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             78862243114304751340213643235641000453-24898678876444444431122354302478899999851
Q gi|255764513|r  157 VRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDG-MPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN  235 (492)
Q Consensus       157 iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg-~ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~  235 (492)
                      -||-+|+        .|.|++.+..-.-++--.+..+| .|+-++|-. |            |=|-+|++....+.-.+|
T Consensus        74 tRFstPe--------ElFGP~si~~Lk~~g~y~R~t~G~LP~A~iaFL-D------------EIfKansAILNtLLtilN  132 (498)
T PRK13531         74 TRFSTPE--------EVFGPLSIQALKDEGRYERLTSGYLPEAEIVFL-D------------EIWKAGPAILNTLLTAIN  132 (498)
T ss_pred             HCCCCHH--------HHCCCCCHHHHHHCCEEEEECCCCCCCCEEEHH-H------------HHHHCCHHHHHHHHHHHH
T ss_conf             7469888--------853833299871178489722675886613157-8------------786148899999999864


Q ss_pred             HCC----CHHHHHHHHH
Q ss_conf             000----0010145553
Q gi|255764513|r  236 FPI----PEFIHLPLIK  248 (492)
Q Consensus       236 ~~~----p~f~H~pli~  248 (492)
                      -..    -+=..+||+.
T Consensus       133 Er~f~nG~~~~~vPL~~  149 (498)
T PRK13531        133 ERRFRNGAHEEKIPMRL  149 (498)
T ss_pred             HHEECCCCCEECCCHHH
T ss_conf             64034798313044688


No 147
>pfam01589 Alpha_E1_glycop Alphavirus E1 glycoprotein. E1 forms a heterodimer with E2 pfam00943. The virus spikes are made up of 80 trimers of these heterodimers (sindbis virus).
Probab=23.49  E-value=48  Score=13.82  Aligned_cols=91  Identities=15%  Similarity=0.320  Sum_probs=63.1

Q ss_pred             EEECCC--CCCCCEECCCCCCCCCCEECCCCCHHHHHH-------HHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             143047--513402136432356410004532489867-------88764444444311223543024788999998510
Q gi|255764513|r  166 SCVFQD--KVYGEMEIPWNAVDMQVLLKSDGMPTYHLA-------NVIDDHLMKITHVARGEEWISSVPKHILLYQYFNF  236 (492)
Q Consensus       166 ~~~~~D--~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a-------~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~  236 (492)
                      ...+.|  .|.|+++..+.-+|-.|++.+|..+-|.|.       -.--|+..+-+.   +.|...||...++      -
T Consensus       217 p~~~~~~K~i~GPiStawsPFD~KiVvyk~eVYNyDfP~YGag~pG~FGDIQsrt~~---s~DlyAnT~l~L~------r  287 (502)
T pfam01589       217 PARIGDLKFIAGPISTAWSPFDNKVVVYKGEVYNYDFPPYGAGQPGRFGDIQSRTTT---SNDLYANTALKLL------R  287 (502)
T ss_pred             CCCCCCEEEEECCCCCCCCCCCCEEEEECCEEECCCCCCCCCCCCCCCCCCCCCCCC---CCCEEECCCCEEC------C
T ss_conf             520376069942344666888843799756051267886568998665542314588---4331402363783------6


Q ss_pred             CCCHHHHHHHHHHHHCCCCCCCCCCCCHH
Q ss_conf             00001014555311013221223433024
Q gi|255764513|r  237 PIPEFIHLPLIKNPDKSKLSKRRNPTSIS  265 (492)
Q Consensus       237 ~~p~f~H~pli~~~~g~klSKR~~~~~i~  265 (492)
                      +...-.|+|.--.++|=+.=|++...++.
T Consensus       288 P~ag~vHVPYTQapSGF~~W~k~~g~~L~  316 (502)
T pfam01589       288 PSAGNVHVPYTQTPSGFEYWKKEKGRPLN  316 (502)
T ss_pred             CCCCCEECCCCCCCCHHHHHHHCCCCCCC
T ss_conf             78995406644686078898745898643


No 148
>PRK11750 gltB glutamate synthase subunit alpha; Provisional
Probab=23.20  E-value=52  Score=13.59  Aligned_cols=97  Identities=16%  Similarity=0.114  Sum_probs=41.4

Q ss_pred             CCCCC-CHHHHHHH--HHHHHHHHHCCCEEEEEECC-------CCCCCCCHHHHHHHHHHHHHCCCCCCCC-----CCCC
Q ss_conf             38878-50159999--99999999718849999704-------8666388679999999988658988867-----6558
Q gi|255764513|r   15 PTGEP-HIGTAYTA--LFNYLIAKRTGGKFILRIED-------TDSKRSTLESENAVMQSLKWCGLNWDEG-----PDIG   79 (492)
Q Consensus        15 PtG~l-H~G~~rta--l~n~l~a~~~~g~f~lRieD-------td~~R~~~~~~~~i~~~l~wlgl~~De~-----~~~~   79 (492)
                      |--+| |=|-.-|-  -.||..||...-+--+ ++|       ++..-|.....|+.++-|---|..--+.     |..-
T Consensus       234 PfR~laHNGEINTirGN~nwm~ARe~~l~s~~-~~dl~~l~Pii~~~~SDSa~lDn~lElLv~~Grsl~~A~~mliPeAw  312 (1483)
T PRK11750        234 PFRYLAHNGEINTITGNRQWARARAYKFQTPL-LPDLQEAAPFVNETGSDSSSLDNMLELLLAGGMDLFRAMRLLVPPAW  312 (1483)
T ss_pred             CCHHCEECCHHHHHHHHHHHHHHHHHHCCCCC-CCCHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHH
T ss_conf             15103216278788889999997576435865-23176528747999981788999999998749988999986187021


Q ss_pred             CCCCCEECCCCHHHHHHHHHHHHH--CCCEEECCCCH
Q ss_conf             876763232628999999999998--89824514889
Q gi|255764513|r   80 GAYGPYRQSERKNIYQPYVQNLLE--KKLAFRCFCST  114 (492)
Q Consensus        80 g~~~p~~QS~r~~~y~~~~~~L~~--~g~aY~c~~t~  114 (492)
                       ...+-.-.++.+.| +|...+++  .|=|--||+.-
T Consensus       313 -~~~~~m~~~~rafY-eY~s~~mEPWDGPAaI~ftDG  347 (1483)
T PRK11750        313 -QNNPDMDPDLRAFY-EFNSMHMEPWDGPAGIVMTDG  347 (1483)
T ss_pred             -CCCCCCCHHHHHHH-HHHHHCCCCCCCCEEEEEECC
T ss_conf             -18877898999999-998721687778547886069


No 149
>COG2461 Uncharacterized conserved protein [Function unknown]
Probab=22.94  E-value=36  Score=14.64  Aligned_cols=22  Identities=0%  Similarity=-0.311  Sum_probs=16.1

Q ss_pred             CCCHHHHCCEEEEEEECCCCCC
Q ss_conf             7982331012678896488888
Q gi|255764513|r  433 EKSLKIIVKPLFLAITGSKYSL  454 (492)
Q Consensus       433 giK~k~l~~PLRiALTG~~~GP  454 (492)
                      .+.+++.+.-+|++-.-...|-
T Consensus       363 w~~~~~~~i~i~Y~av~de~ge  384 (409)
T COG2461         363 WINMGDKFIHIRYFAVKDEEGE  384 (409)
T ss_pred             HCCCCCCEEEEEEEEEECCCCC
T ss_conf             4557873589999998758883


No 150
>cd03346 eu_TrpOH Eukaryotic tryptophan hydroxylase (TrpOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH) and eukaryotic tyrosine hydroxylase (TyrOH). TrpOH oxidizes L-tryptophan to 5-hydroxy-L-tryptophan, the rate-limiting step in the biosynthesis of serotonin (5-hydroxytryptamine), a widely distributed hormone and neurotransmitter.
Probab=22.93  E-value=17  Score=16.86  Aligned_cols=77  Identities=16%  Similarity=0.146  Sum_probs=45.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHH
Q ss_conf             48986788764444444311223543024788999998510000010145553110132212234330245666297737
Q gi|255764513|r  196 PTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPE  275 (492)
Q Consensus       196 ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~~~i~~~~~~GylPe  275 (492)
                      |.=.|-...-.-..-.|.-||-.+..-=||--=.+.+       .|+|+||+.|+.=...|..-|-.++.      - ++
T Consensus       132 ~~r~F~~~LA~r~F~~TqyIRh~~~p~YtpEPDi~HE-------l~GHvPlLadp~fA~f~q~iG~asl~------a-sd  197 (287)
T cd03346         132 SPRDFLAGLAFRVFHCTQYVRHSSDPFYTPEPDTCHE-------LLGHVPLLADPSFAQFSQEIGLASLG------A-SD  197 (287)
T ss_pred             CHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCHHHH-------HHCCCCCCCCHHHHHHHHHHHHHHCC------C-CH
T ss_conf             8889999873163762134525888777899962656-------64456333798899999999998638------9-99


Q ss_pred             HHHHHHHHCCC
Q ss_conf             79989985067
Q gi|255764513|r  276 ALINFLALLFV  286 (492)
Q Consensus       276 AilNyLalLGw  286 (492)
                      .-+.+|++|=|
T Consensus       198 e~i~~LarlYW  208 (287)
T cd03346         198 EDIQKLATCYF  208 (287)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999866663


No 151
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004558   This family represents HemN, the oxygen-independent coproporphyrinogen III oxidase that replaces HemF function under anaerobic conditions. HemN catalyses the anaerobic transformation of coproporhyrinogen-III into protoporphyrinogen-IX during porphyrin biosynthesis. Several species, including Escherichia coli, Helicobacter pylori, and Aquifex aeolicus, have both a member of this family and a member of another, closely related family for which there is no evidence of coproporphyrinogen III oxidase activity, IPR004559 from INTERPRO. Members of this family have a perfectly conserved motif PYRT[SC]YP in a region N-terminal to the region of homology with the related uncharacterised protein.; GO: 0004109 coproporphyrinogen oxidase activity, 0006779 porphyrin biosynthetic process, 0005737 cytoplasm.
Probab=22.93  E-value=39  Score=14.47  Aligned_cols=127  Identities=20%  Similarity=0.305  Sum_probs=62.3

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHC--CCCCCCH--------HHHHHHHHHHHHHCCCHHHHHHHHHH--HHCCCCCCCCCC
Q ss_conf             32489867887644444443112--2354302--------47889999985100000101455531--101322122343
Q gi|255764513|r  194 GMPTYHLANVIDDHLMKITHVAR--GEEWISS--------VPKHILLYQYFNFPIPEFIHLPLIKN--PDKSKLSKRRNP  261 (492)
Q Consensus       194 g~ptY~~a~vvDD~~m~ithviR--g~d~~~~--------t~~q~~l~~al~~~~p~f~H~pli~~--~~g~klSKR~~~  261 (492)
                      |+|||-=..=++-....|+.+.-  ++|-=-|        |-=|+.-..+.|++.-.|+    |-+  ..=+|+=-|=-+
T Consensus       113 GTP~YL~~~Q~~~l~~~i~~~F~nf~~daEiSiEidPR~~~~e~~~~L~~~GFNRlS~G----vQDfd~~VQ~avnR~QP  188 (462)
T TIGR00538       113 GTPTYLSPEQIEELMKEIREAFPNFSEDAEISIEIDPRYLTKEVIKALRDEGFNRLSFG----VQDFDKEVQQAVNRIQP  188 (462)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEECC----EECCCHHHHHHHCCCCC
T ss_conf             98333788999999999998732011584477652374137889999997589664235----21078555444313486


Q ss_pred             -----CCHHHHHHCCCCHHHHHHHHHHCCCCCCCCCHHHCCHHHHHHH---HHHHHCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             -----3024566629773779989985067666553011014677765---20211375544201565566435555126
Q gi|255764513|r  262 -----TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHH---FDLHHLSKAGAVFDKQKLDWLNGRWIREK  333 (492)
Q Consensus       262 -----~~i~~~~~~GylPeAilNyLalLGws~~~~d~Eifsl~eli~~---FdL~~I~Ks~A~FD~eKL~wlN~qyIr~~  333 (492)
                           .+++..|+.||.+   +|.  =|..|-|+-..|  |..+-+++   -|.+||    |+|+..=+-|+-.. .| +
T Consensus       189 ~e~i~~~~~~~R~~Gf~S---iN~--DLIYGLP~Qt~e--sF~~Tl~~v~~LnPDRl----AvFnyAyvP~vk~~-q~-k  255 (462)
T TIGR00538       189 EEMIFELMEKAREAGFES---INL--DLIYGLPKQTKE--SFEKTLEKVAELNPDRL----AVFNYAYVPWVKPA-QR-K  255 (462)
T ss_pred             HHHHHHHHHHHHHCCCCE---EEE--EEECCCCCCCHH--HHHHHHHHHHHCCCCEE----HHHHHHHHCCHHHH-HC-C
T ss_conf             899999999998669827---874--201388887867--89999999853187700----12102221015778-50-2


Q ss_pred             CCHH
Q ss_conf             9989
Q gi|255764513|r  334 LSTT  337 (492)
Q Consensus       334 l~~~  337 (492)
                      ++.+
T Consensus       256 ~~~~  259 (462)
T TIGR00538       256 IPEE  259 (462)
T ss_pred             CCHH
T ss_conf             7620


No 152
>TIGR02541 flagell_FlgJ flagellar rod assembly protein/muramidase FlgJ; InterPro: IPR013377    The N-terminal region of this protein acts directly in flagellar rod assembly, while the C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring .; GO: 0016798 hydrolase activity acting on glycosyl bonds, 0001539 ciliary or flagellar motility, 0009296 flagellum biogenesis, 0009288 flagellin-based flagellum.
Probab=22.87  E-value=23  Score=16.04  Aligned_cols=20  Identities=20%  Similarity=0.147  Sum_probs=13.7

Q ss_pred             HHCCCCHHHHHHHHHHC-CCC
Q ss_conf             66297737799899850-676
Q gi|255764513|r  268 SAMGYLPEALINFLALL-FVH  287 (492)
Q Consensus       268 ~~~GylPeAilNyLalL-Gws  287 (492)
                      ++.|..|+-|+-=.||= |||
T Consensus       201 q~~GVp~~l~lAQAALEsGWG  221 (332)
T TIGR02541       201 QQLGVPPHLILAQAALESGWG  221 (332)
T ss_pred             HHHCCCHHHHHHHHHHHCCCC
T ss_conf             871883678999987522655


No 153
>COG1160 Predicted GTPases [General function prediction only]
Probab=22.83  E-value=53  Score=13.54  Aligned_cols=76  Identities=12%  Similarity=0.153  Sum_probs=33.2

Q ss_pred             CHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCCC-CCCHHHHHHHHHHHHHHH
Q ss_conf             206888725320356677556752246788854554331486679999999999840588-899888999999999995
Q gi|255764513|r  355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ-IWKRENIETALRNVAQHR  432 (492)
Q Consensus       355 ~il~likeRi~tL~Di~~~~~ffF~~~~~~d~e~~~k~~~~~e~~~~iL~~~~~~L~~~~-~w~~e~Ie~~ik~i~e~~  432 (492)
                      .-|+++.++-.++.++...+.-.|. ...+.+--+... ........++..+....+... ..+...+..++......+
T Consensus       297 NKWDl~~~~~~~~~~~k~~i~~~l~-~l~~a~i~~iSA-~~~~~i~~l~~~i~~~~~~~~~ri~Ts~LN~~l~~a~~~~  373 (444)
T COG1160         297 NKWDLVEEDEATMEEFKKKLRRKLP-FLDFAPIVFISA-LTGQGLDKLFEAIKEIYECATRRISTSLLNRVLEDAVAKH  373 (444)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHC-CCCCCEEEEEEE-CCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHC
T ss_conf             7532578516679999999998722-136772799970-4787727889999999998654547689999999999738


No 154
>PHA00451 protein kinase
Probab=22.65  E-value=10  Score=18.32  Aligned_cols=26  Identities=35%  Similarity=0.658  Sum_probs=21.4

Q ss_pred             HHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             9988982451488999776688766431000236
Q gi|255764513|r  101 LLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYD  134 (492)
Q Consensus       101 L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~  134 (492)
                      -.++|-||..||        |-.|...|.|-+|+
T Consensus        98 KEDSGAAYtAFC--------RMhQGR~GIPnVY~  123 (364)
T PHA00451         98 KEDSGAAYTAFC--------RMHQGRAGIPNVYD  123 (364)
T ss_pred             CCCCCHHHHHHH--------HHHCCCCCCCCHHH
T ss_conf             456542899999--------87069889970788


No 155
>cd06568 GH20_SpHex_like A subgroup of  the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex).  SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
Probab=22.54  E-value=54  Score=13.50  Aligned_cols=71  Identities=20%  Similarity=0.137  Sum_probs=36.9

Q ss_pred             CCCCC--CHHHHHHHHHHHHHCCCC---CCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCC------CEEECCCCHHHH
Q ss_conf             66638--867999999998865898---8867655887676323262899999999999889------824514889997
Q gi|255764513|r   49 DSKRS--TLESENAVMQSLKWCGLN---WDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKK------LAFRCFCSTERL  117 (492)
Q Consensus        49 d~~R~--~~~~~~~i~~~l~wlgl~---~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g------~aY~c~~t~eel  117 (492)
                      |..|.  ..+.+..+++.|.|+.|+   |.=.-         -||=|+++-  ..-+|-+.|      ....-|.|++|+
T Consensus         9 D~aR~f~~~~~ik~~id~ma~~KlN~lH~HltD---------dqgwrle~~--~~P~lt~~ga~~~~~~~~~g~YT~~d~   77 (329)
T cd06568           9 DVARHFFTVAEVKRYIDLLALYKLNVLHLHLTD---------DQGWRIEIK--SWPKLTEIGGSTEVGGGPGGYYTQEDY   77 (329)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEEC---------CCCCEEEEC--CCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             637887589999999999998388556888862---------898703007--877623356656668888870789999


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             7668876643100
Q gi|255764513|r  118 EEMRRAQRKRNIP  130 (492)
Q Consensus       118 ~~~r~~~~~~~~~  130 (492)
                      .++-+-+.++|..
T Consensus        78 ~eiv~yA~~rgI~   90 (329)
T cd06568          78 KDIVAYAAERHIT   90 (329)
T ss_pred             HHHHHHHHHCCCE
T ss_conf             9999999975998


No 156
>PRK12365 ribonucleotide-diphosphate reductase subunit alpha; Provisional
Probab=22.08  E-value=55  Score=13.44  Aligned_cols=48  Identities=17%  Similarity=0.131  Sum_probs=16.3

Q ss_pred             HHHHHHHHCCCEEEEEECCCCCCCCC-HHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             99999997188499997048666388-6799999999886589888676
Q gi|255764513|r   29 FNYLIAKRTGGKFILRIEDTDSKRST-LESENAVMQSLKWCGLNWDEGP   76 (492)
Q Consensus        29 ~n~l~a~~~~g~f~lRieDtd~~R~~-~~~~~~i~~~l~wlgl~~De~~   76 (492)
                      +.+|-+|++.|.--.|.-|....=.+ +.|.+...++=.|-=+.++|.|
T Consensus       546 eeFLdlRkn~Gde~~Ra~dln~avwIpDlFMkrVe~d~~W~Lf~P~e~p  594 (1046)
T PRK12365        546 EDFLELRKNTGDERRRTHDINTASWIPDLFFKRLEQKGTWTLFSPDDVP  594 (1046)
T ss_pred             HHHHHHCCCCCCHHHHHCCCCCHHCCCHHHHHHHHCCCCEEEECHHHCC
T ss_conf             9999723568817664314810224799999999759964765822256


No 157
>COG0282 ackA Acetate kinase [Energy production and conversion]
Probab=22.02  E-value=37  Score=14.62  Aligned_cols=19  Identities=11%  Similarity=0.036  Sum_probs=11.6

Q ss_pred             CHHHHHHHHHHHHHCCCCC
Q ss_conf             8679999999988658988
Q gi|255764513|r   54 TLESENAVMQSLKWCGLNW   72 (492)
Q Consensus        54 ~~~~~~~i~~~l~wlgl~~   72 (492)
                      -.+++..+++.|.-.++.-
T Consensus        60 h~~al~~i~~~l~~~~ii~   78 (396)
T COG0282          60 HKEALKLLLETLEEHKIIK   78 (396)
T ss_pred             HHHHHHHHHHHHHHCCCCC
T ss_conf             9999999999998614114


No 158
>TIGR00368 TIGR00368 Mg chelatase homolog; InterPro: IPR004482   This family of bacterial proteins are variously described as 'hypothetical protein yifB', 'competence protein', 'hypothetical protein' or 'Mg chelatase-related protein'. These proteins are a subset of the magnesium chelatase, ChlI subunit family and either belong to or show significant homology to the non-peptidase homologs of the MEROPS peptidase family S16 (lon protease family, clan SF), IPR001984 from INTERPRO. .
Probab=21.56  E-value=34  Score=14.84  Aligned_cols=57  Identities=16%  Similarity=0.093  Sum_probs=34.4

Q ss_pred             HHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCC
Q ss_conf             444431122354302478899999851000001014555311013221223433024566629773779989985067
Q gi|255764513|r  209 MKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFV  286 (492)
Q Consensus       209 m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~~~i~~~~~~GylPeAilNyLalLGw  286 (492)
                      -|-=||=|..--+.--|-+-+|.-|+|-.|--|  .       |+|.  .|...          .|+-+.||+-+||-
T Consensus       324 dg~i~iSRa~~ki~kyPA~FqL~aAmNpcPcG~--~-------~~~~--~~c~c----------Sp~q~~~Yl~kLsg  380 (505)
T TIGR00368       324 DGSISISRAKAKIFKYPARFQLVAAMNPCPCGH--Y-------GGKI--THCRC----------SPQQISRYLNKLSG  380 (505)
T ss_pred             CCCEEEEECCCHHHCCCHHHHHHHHHCCCCCCC--C-------CCCC--CCCCC----------CHHHHHHHHHHCCC
T ss_conf             670688632201000872455675617887767--7-------7874--44658----------97899999874271


No 159
>cd03347 eu_PheOH Eukaryotic phenylalanine-4-hydroxylase (eu_PheOH); a member of the biopterin-dependent aromatic amino acid hydroxylase family of non-heme, iron(II)-dependent enzymes that also includes prokaryotic phenylalanine-4-hydroxylase (pro_PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan hydroxylase (TrpOH).  PheOH catalyzes the first and rate-limiting step in the metabolism of the amino acid L-phenylalanine (L-Phe), the hydroxylation of L-Phe to L-tyrosine (L-Tyr). It uses (6R)-L-erythro-5,6,7,8-tetrahydrobiopterin (BH4) as the physiological electron donor. The catalytic activity of the tetrameric enzyme is tightly regulated by the binding of L-Phe and BH4 as well as by phosphorylation. Mutations in the human enzyme are linked to a severe variant of phenylketonuria.
Probab=21.37  E-value=18  Score=16.72  Aligned_cols=77  Identities=17%  Similarity=0.217  Sum_probs=45.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCHH
Q ss_conf             48986788764444444311223543024788999998510000010145553110132212234330245666297737
Q gi|255764513|r  196 PTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPE  275 (492)
Q Consensus       196 ptY~~a~vvDD~~m~ithviRg~d~~~~t~~q~~l~~al~~~~p~f~H~pli~~~~g~klSKR~~~~~i~~~~~~GylPe  275 (492)
                      |.=.|-...-+-..-.|.-||--+..--||--=.+.+       .|+|+||+.+++=.-.|..-|..++..       ++
T Consensus       132 s~rdF~~~LA~rvF~~TqyiRh~~~p~YtpEPDi~He-------~~GH~p~ladp~fA~f~q~iG~a~l~a-------~~  197 (306)
T cd03347         132 SSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDICHE-------LLGHVPLFADPSFAQFSQEIGLASLGA-------PD  197 (306)
T ss_pred             CHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCHHHH-------HHCCCCCCCCHHHHHHHHHHHHHHCCC-------CH
T ss_conf             8899999974183541013426777777899962656-------644574447888999999999987189-------99


Q ss_pred             HHHHHHHHCCC
Q ss_conf             79989985067
Q gi|255764513|r  276 ALINFLALLFV  286 (492)
Q Consensus       276 AilNyLalLGw  286 (492)
                      .-+..|++|=|
T Consensus       198 e~i~~La~lyW  208 (306)
T cd03347         198 EYIEKLATVYW  208 (306)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999988886


No 160
>PRK03003 engA GTP-binding protein EngA; Reviewed
Probab=21.32  E-value=57  Score=13.34  Aligned_cols=39  Identities=5%  Similarity=0.107  Sum_probs=25.0

Q ss_pred             CHHHHHHHHHHHHHHCCCC-CCCHHHHHHHHHHHHHHHCC
Q ss_conf             6679999999999840588-89988899999999999579
Q gi|255764513|r  396 PEEIIDILKTTQEEFEVIQ-IWKRENIETALRNVAQHREK  434 (492)
Q Consensus       396 ~e~~~~iL~~~~~~L~~~~-~w~~e~Ie~~ik~i~e~~gi  434 (492)
                      ......++..+...++... ..+...+..++..+.+.+.-
T Consensus       367 g~~i~kL~~~i~~v~~~~~krI~Ts~LN~~L~~a~~~~pp  406 (474)
T PRK03003        367 GRAVQKLVPALETALESWDTRIPTGRLNAWLKELVAAHPP  406 (474)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             8798999999999999964739879999999999983899


No 161
>PRK06599 DNA topoisomerase I; Validated
Probab=21.00  E-value=43  Score=14.18  Aligned_cols=72  Identities=15%  Similarity=0.148  Sum_probs=32.8

Q ss_pred             HHHHHHHHHHHHHCC---CCCCCCCCCCCCCCCEECCC-------CH----HHHHHHHHHHHHC--------CCE-EEC-
Q ss_conf             679999999988658---98886765588767632326-------28----9999999999988--------982-451-
Q gi|255764513|r   55 LESENAVMQSLKWCG---LNWDEGPDIGGAYGPYRQSE-------RK----NIYQPYVQNLLEK--------KLA-FRC-  110 (492)
Q Consensus        55 ~~~~~~i~~~l~wlg---l~~De~~~~~g~~~p~~QS~-------r~----~~y~~~~~~L~~~--------g~a-Y~c-  110 (492)
                      ++..+.|.+.++=-.   ......+..-.|..||--|.       |+    ..=..+|++|-+.        |+. |+= 
T Consensus       228 ~~~A~~i~~~l~~~~~~V~~v~~k~~k~~Pp~PFtTStLQqeAs~klg~Sak~TM~iAQ~LYE~~~~~~e~~GlITYmRT  307 (776)
T PRK06599        228 EKEAKDLTKKLKSQKFHVDKIEKKQQKRQPQPPFITSSLQQEAARKLGFSAKKTMQIAQKLYEGVDIGKETIGLITYMRT  307 (776)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEECC
T ss_conf             99999999985169749999876542127989976689999999871888999999999998515557565525899658


Q ss_pred             ---CCCHHHHHHHHHHHHH
Q ss_conf             ---4889997766887664
Q gi|255764513|r  111 ---FCSTERLEEMRRAQRK  126 (492)
Q Consensus       111 ---~~t~eel~~~r~~~~~  126 (492)
                         +.|++-++..|+....
T Consensus       308 DS~~LS~e~~~~~~~~I~~  326 (776)
T PRK06599        308 DGVTLSNDAIADIRKLIDK  326 (776)
T ss_pred             CCCCCCHHHHHHHHHHHHH
T ss_conf             8861399999999999987


No 162
>KOG0433 consensus
Probab=20.11  E-value=60  Score=13.17  Aligned_cols=88  Identities=28%  Similarity=0.542  Sum_probs=46.8

Q ss_pred             CCCCCCHHHHHHHHH-----HHHHHHHCCCEEE-------EEECCCC-------CC--CC-----------CHHHHHHHH
Q ss_conf             388785015999999-----9999997188499-------9970486-------66--38-----------867999999
Q gi|255764513|r   15 PTGEPHIGTAYTALF-----NYLIAKRTGGKFI-------LRIEDTD-------SK--RS-----------TLESENAVM   62 (492)
Q Consensus        15 PtG~lH~G~~rtal~-----n~l~a~~~~g~f~-------lRieDtd-------~~--R~-----------~~~~~~~i~   62 (492)
                      -.|.||+|+|+.-+.     -|++|....-.++       |-||-|-       ++  |+           -.++++...
T Consensus        66 anG~lhlghAlnKILkdiinr~~l~~g~~v~yvPGWDCHGLPIEs~Kals~l~~~~~~~spleiR~kAr~fA~~AIk~Q~  145 (937)
T KOG0433          66 ANGNLHLGHALNKILKDIINRILLAQGKSALYVPGWDCHGLPIESTKALSSLTESEGSRTPLEIRAKARIFADEAIKKQM  145 (937)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHCCCEECCCCCCCCCCCCHHHHHHHHHCHHHCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             88980167789899999999999974874425789876887368778755321211467818999999999999999999


Q ss_pred             HHHHHCCC--CCCCCCCCCCCCCCEEC-CCCHH-HHHHHHHHHHHCCCEEECC
Q ss_conf             99886589--88867655887676323-26289-9999999999889824514
Q gi|255764513|r   63 QSLKWCGL--NWDEGPDIGGAYGPYRQ-SERKN-IYQPYVQNLLEKKLAFRCF  111 (492)
Q Consensus        63 ~~l~wlgl--~~De~~~~~g~~~p~~Q-S~r~~-~y~~~~~~L~~~g~aY~c~  111 (492)
                      +.+.-.|+  +|.         .||.- |..++ --.+...+|.++|+.|+-|
T Consensus       146 e~F~r~gv~aDW~---------npY~T~~~~yeaaQL~iF~~lyekgLvyR~~  189 (937)
T KOG0433         146 EAFRRWGVTADWE---------NPYVTKSPSYEAAQLDIFAKLYEKGLVYRSF  189 (937)
T ss_pred             HHHHHHEEECCCC---------CCEEECCHHHHHHHHHHHHHHHHCCCEECCC
T ss_conf             9988750110578---------8306238077899999999998666133057


No 163
>PRK05773 3,4-dihydroxy-2-butanone 4-phosphate synthase; Validated
Probab=20.08  E-value=21  Score=16.26  Aligned_cols=37  Identities=32%  Similarity=0.405  Sum_probs=26.4

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCC--CHHHHHHCCCCHHHHHHH
Q ss_conf             1014555311013221223433--024566629773779989
Q gi|255764513|r  241 FIHLPLIKNPDKSKLSKRRNPT--SISYYSAMGYLPEALINF  280 (492)
Q Consensus       241 f~H~pli~~~~g~klSKR~~~~--~i~~~~~~GylPeAilNy  280 (492)
                      =+|+|++...   .+.+|.|.+  ||.=-+-.|.-|-|++-=
T Consensus       144 PGHv~pL~a~---Gvl~R~GHTEasVdL~~lAGl~P~avicE  182 (218)
T PRK05773        144 PGHVPILLGR---GLGERRGHTELSLILAEAAGLPPSAVIAE  182 (218)
T ss_pred             CCCCCCCCCC---CCCCCCCCHHHHHHHHHHCCCCCEEEEEE
T ss_conf             9985700046---65667884379999999829996189999


Done!