HHsearch results for GI: 255764513 and protein with PDBid: 3c8z_A

>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis}
Probab=99.22  E-value=1.6e-10  Score=90.21  Aligned_cols=236  Identities=15%  Similarity=0.119  Sum_probs=134.5

Q ss_pred             CCCCCC--CCCCHHHHHHHHHHHHHHH-----HCCCEEEEEECCCCCC-------------CCCHHHHHHHHHHHHHCCC
Q ss_conf             484338--8785015999999999999-----7188499997048666-------------3886799999999886589
Q gi|255764513|r   11 IAPSPT--GEPHIGTAYTALFNYLIAK-----RTGGKFILRIEDTDSK-------------RSTLESENAVMQSLKWCGL   70 (492)
Q Consensus        11 faPsPt--G~lH~G~~rtal~n~l~a~-----~~~g~f~lRieDtd~~-------------R~~~~~~~~i~~~l~wlgl   70 (492)
                      +.--||  +++||||+||+++--+++|     -+.-.|+.=|.|.|.+             -....+.+.+.++++-|++
T Consensus        43 Y~CGpTvy~~~HIGhaRt~v~~D~l~R~L~~~G~~V~~v~nitDiddKIi~~A~~~g~~~~e~a~~~~~~f~~~~~~L~i  122 (414)
T 3c8z_A           43 YVCGITPYDATHLGHAATYLTFDLVHRLWLDAGHTVQYVQNVTDVDDPLFERAERDGIDWRTLGDRETQLFREDMAALRV  122 (414)
T ss_dssp             EECCCCTTSCCBHHHHHHHHHHHHHHHHHHHTTCEEEEEEEECCSCHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHTTC
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             85899778886400032699999999999985996699865685338999998754999999999999999999987468


Q ss_pred             CCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             88867655887676323262899999999999889824514889997766887664310002366555788333001120
Q gi|255764513|r   71 NWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQ  150 (492)
Q Consensus        71 ~~De~~~~~g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~  150 (492)
                      .++...        -+.++..+.-.+++++|+++|.||.|--+.     .....-.....+.|..-+ ....++......
T Consensus       123 ~~~~~~--------~rate~i~~ii~~i~~l~~kg~aY~~~~~~-----~~~vyf~~~~~~~yg~l~-~~~~~~~~~~~~  188 (414)
T 3c8z_A          123 LPPHDY--------VAATDAIAEVVEMVEKLLASGAAYIVEDAE-----YPDVYFRADATAQFGYES-GYDRDTMLTLFA  188 (414)
T ss_dssp             CCCSEE--------EEGGGCHHHHHHHHHHHHHHTSEEECSCSS-----CCCEEECTTSSTTTTTTT-CCCHHHHHHHHH
T ss_pred             CCCCEE--------ECCCCCHHHHHHHHHHHHHHHHCCCCCCCC-----CCCEEEEECCHHHCCCCC-CCCHHHHHHHHH
T ss_conf             999566--------314002999999999986423200126875-----542799830333147421-111566655543


Q ss_pred             ------------CCCCCEEEEEECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHH-HH--HHHHH
Q ss_conf             ------------2577407886224311430475134021364323564100045324898678876444-44--44311
Q gi|255764513|r  151 ------------EQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHL-MK--ITHVA  215 (492)
Q Consensus       151 ------------~g~~~~iR~k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~-m~--ithvi  215 (492)
                                  +...+++- |....          |++.+++        -...|.|.+|..|++=-+. .|  +.--.
T Consensus       189 ~~~~~~~~~~K~~~~DF~Lw-k~~~~----------~~~~w~S--------pwG~GrPgWHiECsam~~~~lg~~~DIH~  249 (414)
T 3c8z_A          189 ERGGDPDRPGKSDQLDALLW-RAERP----------GEPSWPS--------PFGRGRPGWHVECSAIALTRIGTGLDIQG  249 (414)
T ss_dssp             HTTCCTTCTTCSSTTCEEEE-EECCT----------TSCCBCC--------TTCSEEECHHHHHHHHHHHHTCSCEEEEE
T ss_pred             HHCCCCCHHCCCCHHHHHHH-CCCCC----------CCCCCCC--------CCCCCCCCCCCCCCHHHHHCCCCCEEEEC
T ss_conf             20243200002587776411-02665----------7876348--------87762884674424888740698335740


Q ss_pred             CCCCCCC----HHHHHHHHHHHH-H-HCCC-HHHHHHHHHHHHCCCCCCCCCC-CCHHHHHHCCCCHHHHHHHHHH
Q ss_conf             2235430----247889999985-1-0000-0101455531101322122343-3024566629773779989985
Q gi|255764513|r  216 RGEEWIS----SVPKHILLYQYF-N-FPIP-EFIHLPLIKNPDKSKLSKRRNP-TSISYYSAMGYLPEALINFLAL  283 (492)
Q Consensus       216 Rg~d~~~----~t~~q~~l~~al-~-~~~p-~f~H~pli~~~~g~klSKR~~~-~~i~~~~~~GylPeAilNyLal  283 (492)
                      -|.||+-    |-..|.   +++ | .+.+ .|.|... ++.+|+|+||+.|. +.+.++.+.||-|+++.=+|..
T Consensus       250 GG~Dl~fPHHeneiAq~---~a~~g~~~~~~~w~h~g~-l~~~g~KMSKSlGN~~~~~d~l~~~~~~~~~R~~ll~  321 (414)
T 3c8z_A          250 GGSDLIFPHHEYSAAHA---ESVTGERRFARHYVHTGM-IGWDGHKMSKSRGNLVLVSQLRAQGVDPSAIRLGLFS  321 (414)
T ss_dssp             EEGGGTTTHHHHHHHHH---HHHHCCSCSEEEEEEECC-BC-------------CBHHHHHHTTCCHHHHHHHHHT
T ss_pred             CCCCCCCCCHHHHHHHH---HHHHCCCCCCHHHEECCE-EEECCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHH
T ss_conf             55655663167699999---997499740121223337-9850646777688703199998627988998999986