HHsearch results for GI: 255764513 and protein with PDBid: 3hzr_A

>3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural genomics of pathogenic protozoa, MSGPP; 3.00A {Entamoeba histolytica}
Probab=98.36  E-value=4.5e-05  Score=53.29  Aligned_cols=193  Identities=12%  Similarity=0.074  Sum_probs=107.4

Q ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECC----CCCCCCCHHHH---HHHHHHHHHCCCCCCCCCCCC
Q ss_conf             05634843388785015999999999999718849999704----86663886799---999999886589888676558
Q gi|255764513|r    7 VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIED----TDSKRSTLESE---NAVMQSLKWCGLNWDEGPDIG   79 (492)
Q Consensus         7 v~~RfaPsPtG~lH~G~~rtal~n~l~a~~~~g~f~lRieD----td~~R~~~~~~---~~i~~~l~wlgl~~De~~~~~   79 (492)
                      |-|=|.||  |.|||||+-.+.+..-+-.+.|-..++=|=|    |+..-+.++..   .....++--+|+++|-.    
T Consensus        85 vytG~~PS--G~lHLGh~i~~~~~k~lQ~~~~~~v~I~iaD~~a~~~~~~~~ee~~~~~~e~~~~~lA~G~DpeKt----  158 (386)
T 3hzr_A           85 IFIQKYPQ--KEVALEEYITLEFARYLQDAFNIQVIIQILDDIKVLNREATINEASKMSNDLMKYILAFGFNEDKT----  158 (386)
T ss_dssp             EEEEECCC--SSCBGGGHHHHHHHHHHHHHHCCEEEEEECHHHHHHTTSCCHHHHHHHHHHHHHHHHHTCCCGGGE----
T ss_pred             EEECCCCC--CHHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCE----
T ss_conf             99486887--370898999999999999767975999974478724788999999999999999999958894722----


Q ss_pred             CCCCCEECCCCHHHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEE
Q ss_conf             87676323262899999999999889824514889997766887664310002366555788333001120257740788
Q gi|255764513|r   80 GAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRL  159 (492)
Q Consensus        80 g~~~p~~QS~r~~~y~~~~~~L~~~g~aY~c~~t~eel~~~r~~~~~~~~~~~Y~~~~r~l~~~e~~~~~~~g~~~~iR~  159 (492)
                         -.|+||+....|...+-.+-.                                   ..+-.++.+        +..|
T Consensus       159 ---~i~~qs~~~~~~~~~~~~l~k-----------------------------------~~t~~~~k~--------~~~~  192 (386)
T 3hzr_A          159 ---FIYTDYQYFGKMYRTISLVEK-----------------------------------ATAYNVVQP--------FFNF  192 (386)
T ss_dssp             ---EEEEHHHHHHHHHHHHHHHHH-----------------------------------HCBHHHHTT--------TSCC
T ss_pred             ---EEEEECHHCHHHHHHHHHHHC-----------------------------------CCCCCHHHH--------HHCC
T ss_conf             ---899825200065899999958-----------------------------------735052546--------5167


Q ss_pred             EECCCCEEECCCCCCCCEECCCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHHH---------HHCCCCCCCHHHHHHHH
Q ss_conf             622431143047513402136432356410004532489867887644444443---------11223543024788999
Q gi|255764513|r  160 TVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITH---------VARGEEWISSVPKHILL  230 (492)
Q Consensus       160 k~p~~~~~~~~D~i~G~~~~~~~~~~D~vi~r~dg~ptY~~a~vvDD~~m~ith---------viRg~d~~~~t~~q~~l  230 (492)
                                +|.         .++         |.-+|-+--+.|=..+..+|         |.=|.|...+--.-.-+
T Consensus       193 ----------~~~---------~n~---------g~~~YP~lQaaDil~~~~~~~~g~~~~~lVPvG~DQ~~~~~ltRdi  244 (386)
T 3hzr_A          193 ----------EYS---------DNI---------GKLASPSIMTASMFSQSYSHFFSSPARCLVLDSIKNVQFHSIIDQI  244 (386)
T ss_dssp             ----------CSS---------SBH---------HHHHHHHHHHHTTSGGGCTTTCSSCCEEEEEEEGGGHHHHHHHHHH
T ss_pred             ----------CCC---------CCC---------CCCCCCHHHHHHHHHCCCHHHHCCCCCEEECCCCCHHHHHHHHHHH
T ss_conf             ----------666---------777---------5204609888888760680541787530305773459999999999


Q ss_pred             HHHHHHCCCHHHHHHHHHHHHC-CCCCCCCCCCCHHHHHHCCCCHHHHHHHHHH
Q ss_conf             9985100000101455531101-3221223433024566629773779989985
Q gi|255764513|r  231 YQYFNFPIPEFIHLPLIKNPDK-SKLSKRRNPTSISYYSAMGYLPEALINFLAL  283 (492)
Q Consensus       231 ~~al~~~~p~f~H~pli~~~~g-~klSKR~~~~~i~~~~~~GylPeAilNyLal  283 (492)
                      ..-+|+..|...|.+++.+-+| +|+||.+...+|- +-   =.|+.+.+-+..
T Consensus       245 a~r~~~~~p~~i~~~~lpgL~G~~KMSsS~~~s~I~-L~---D~p~~I~kKI~k  294 (386)
T 3hzr_A          245 ATTLNFIQPTVLFHKMVPLLSGVTKFDIPSDHNSIL-LS---DNAKQVERKINK  294 (386)
T ss_dssp             HHHHTCCCCEEEEECCCCCTTCTTCCCCCCTTTSCB-TT---CCHHHHHHHHHH
T ss_pred             HHHCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEEE-EE---CCHHHHHHHHHE
T ss_conf             986356887021255445678876545689986257-50---798999887452