BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764513|ref|YP_003065530.2| glutamyl-tRNA synthetase
[Candidatus Liberibacter asiaticus str. psy62]
         (492 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|255764513|ref|YP_003065530.2| glutamyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254547864|gb|ACT57590.2| glutamyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 492

 Score =  424 bits (1090), Expect = e-116,   Method: Composition-based stats.
 Identities = 492/492 (100%), Positives = 492/492 (100%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA
Sbjct: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
           VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM
Sbjct: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP
Sbjct: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
           WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE
Sbjct: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240

Query: 241 FIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           FIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ
Sbjct: 241 FIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLA 360
           LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLA
Sbjct: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLA 360

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
           QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN
Sbjct: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS
Sbjct: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480

Query: 481 SLVQNHKKKELK 492
           SLVQNHKKKELK
Sbjct: 481 SLVQNHKKKELK 492


>gi|269925198|ref|YP_003321821.1| glutamyl-tRNA synthetase [Thermobaculum terrenum ATCC BAA-798]
 gi|269788858|gb|ACZ40999.1| glutamyl-tRNA synthetase [Thermobaculum terrenum ATCC BAA-798]
          Length = 492

 Score =  409 bits (1050), Expect = e-112,   Method: Composition-based stats.
 Identities = 189/487 (38%), Positives = 280/487 (57%), Gaps = 12/487 (2%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +S+VRVR  PSPTG  H+G   TA+FN+L+A+  GGKFILRIEDTD  R    +   + 
Sbjct: 1   MNSEVRVRFPPSPTGYLHVGNLRTAVFNWLLARHHGGKFILRIEDTDRARVVPGAVEVIY 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++L+W G++WDEGPDIGG + PY QSERK IY+ Y + L+ +  A+RCFCS ERLE +R 
Sbjct: 61  ETLRWIGIDWDEGPDIGGPHAPYVQSERKEIYREYAELLISQGKAYRCFCSQERLEALRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            QRK N+P+RYD  C  L  +E +RL    + +VVR   P +G+    D + G +    +
Sbjct: 121 EQRKNNLPTRYDRKCRYLGPEEAKRLVDSGQPYVVRFATPLEGTTTMVDLLRGPVTYQND 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +D  V+LKSDG P YH A V+DDHLM ITHV RG+E+ISS  + ILL++   +  P + 
Sbjct: 181 QIDDFVILKSDGYPPYHFAVVVDDHLMGITHVLRGDEYISSGARDILLHEALGWNPPLYA 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H  +I  PD+S+LSKR        Y  +G +PEA+ N+LALL    S D + +   ++LI
Sbjct: 241 HTAIILGPDRSRLSKRHGALPALEYRDIGIIPEAMFNYLALLGASYSADRE-IFSREELI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------KDR 352
             FD+  +S + A+FD  KL+W+N  +I   LS  +  SRV   ++           +  
Sbjct: 300 ELFDIDKMSPSPAIFDANKLEWMNAYYINHVLSVDDLASRVKPILENAGLVKTEDLDEGY 359

Query: 353 LTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEV 412
           L + + L + RI  L  + ++TDF F+     +AE      L  +E  ++L+  ++    
Sbjct: 360 LIEVIGLVKDRIKLLPDVVELTDFFFRD-PDPSAEEIAGKKLTLQEAQELLQKVKDRVSP 418

Query: 413 IQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRL 472
           I  W  E +ET LR++A         +   + +AITG   S  LF+++ +LG+     R+
Sbjct: 419 IDNWSEEILETELRSMASELGVKTGTLFMLIRVAITGKTASPGLFETMAVLGKDRTISRI 478

Query: 473 RHAIALV 479
             AI  +
Sbjct: 479 GRAIDKL 485


>gi|284047863|ref|YP_003398202.1| glutamyl-tRNA synthetase [Acidaminococcus fermentans DSM 20731]
 gi|283952084|gb|ADB46887.1| glutamyl-tRNA synthetase [Acidaminococcus fermentans DSM 20731]
          Length = 488

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 177/489 (36%), Positives = 276/489 (56%), Gaps = 14/489 (2%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VRVR APSPTG  HIG A TALFN+L A+  GGK ILRIEDTD  R   +S + ++ 
Sbjct: 1   MSEVRVRFAPSPTGYLHIGGARTALFNWLFARSQGGKMILRIEDTDRDRLKEDSVSQIIT 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           SLKW GL+WDEGP++GG +GPY QSER ++Y+ Y Q L+++  A+ CFCS   LE  R  
Sbjct: 61  SLKWLGLDWDEGPEVGGDHGPYYQSERLDLYRKYCQQLVDEGKAYYCFCSAADLEAQREE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           QRK+  P  Y G C  L   E ++  +  + H +R+ +P+ G+    D ++G++   WN 
Sbjct: 121 QRKKKQPFHYAGTCRNLDPSEAKKRVEAGEPHSIRIKLPHDGTITVHDMIHGDVTFNWNQ 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
            D  V++K++G+PTY+ A V+DDHLM +THV R EE +++ PK +++Y+   +  PEF H
Sbjct: 181 FDDFVIMKTNGIPTYNFAVVVDDHLMGMTHVLRAEEHLTNTPKQLVIYEALGWKAPEFGH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +P+I  PD+SKLSKR   TS+  +   GYL EA+IN+L LL      +D+E+  ++  + 
Sbjct: 241 MPMILAPDRSKLSKRHGATSVEEFRDKGYLAEAIINYLTLLG-WAPGNDEEIFTLEDTVK 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWI------REKLSTTEFLSRV-----SQWMKEKDR 352
            FD   +SK  AV+D +KL WLNG+++      +   +   F  +      S     ++ 
Sbjct: 300 AFDFSKMSKKAAVYDVKKLTWLNGQYLSNLPLRKIADAAVPFFKKAGLIDDSYLPAHQEY 359

Query: 353 LTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEV 412
               + + + R+ TL  L   + + F        +    +     E  D+L+   +    
Sbjct: 360 FDHLVDVVRVRVKTLEELADGSSYFFHDFDSYDPKGAAKSF--KPEAADLLQKAHDALAA 417

Query: 413 IQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRL 472
           + ++  +  E     +A+    SL  ++ P  LA+TG  +S  +FD + +LGR     RL
Sbjct: 418 LPVFDLKTTEECYNKLAEELGLSLGKVIHPTRLALTGRTFSPGMFDVMVLLGREKTLERL 477

Query: 473 RHAIALVSS 481
             AI+ + +
Sbjct: 478 EKAISFIKA 486


>gi|227824324|ref|ZP_03989156.1| glutamyl-tRNA synthetase [Acidaminococcus sp. D21]
 gi|226904823|gb|EEH90741.1| glutamyl-tRNA synthetase [Acidaminococcus sp. D21]
          Length = 488

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 177/492 (35%), Positives = 272/492 (55%), Gaps = 16/492 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
              +VRVR APSPTG  HIG A TALFN+L A+  GGK +LRIEDTD  R   +S + ++
Sbjct: 1   MDKEVRVRFAPSPTGYLHIGGARTALFNWLFARSQGGKLVLRIEDTDQDRLKEDSVSQII 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            SLKW GL+WDEGP++GG  GPY QSER +IY+ Y Q L+++  A+ CFCS E L E R 
Sbjct: 61  TSLKWLGLSWDEGPEVGGPVGPYFQSERFDIYRKYCQQLIDEGKAYYCFCSAEDLAEQRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            QR    P  Y   C  +  +E ++  +  + + VR+ VP +G+  F D ++G+++   N
Sbjct: 121 KQRALKQPFHYARTCRDIPPEEAKKRVENGESYSVRIKVPLEGTIGFHDMIHGDIQFDVN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
             D  V++KS G+PTY+ A V+DDHLM +THV R EE +S+ PK + +YQ   +  P+F 
Sbjct: 181 QYDDFVIMKSSGIPTYNFAVVVDDHLMGMTHVLRAEEHVSNTPKQLFIYQALGWEAPQFG 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+P+I  PD+SKLSKR   TS+  + + GYLPEA+IN+L LL      +D+E+  ++  +
Sbjct: 241 HMPMILAPDRSKLSKRHGATSVEEFRSQGYLPEAIINYLTLLG-WAPGNDEEIFSLEDTV 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------EK 350
             FD   +S+  AV+D +KL W+NG+++   L     +     + K             K
Sbjct: 300 KVFDFSKMSQKAAVYDVKKLTWMNGQYL-SSLPLDRIVEAAIPFFKEKGLVDDAYLAAHK 358

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
           D     + + + R+ TL+ +   + + FK       +  +           +L+   ++ 
Sbjct: 359 DYFAHLVDVVRVRVKTLAEVADASTYFFKDLDGYEEKGVEKHF--KPGNASLLRKCHDKL 416

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
             + ++     E A   +A     S   ++ P  LA+TG  +S  +FD + +LGR     
Sbjct: 417 AALPVFDLATTEQAYHEIADEMGISFGKVIHPTRLALTGRTFSPGMFDVMVLLGREKTLE 476

Query: 471 RLRHAIALVSSL 482
           RL  AIA + + 
Sbjct: 477 RLEKAIAFIENK 488


>gi|323141171|ref|ZP_08076072.1| glutamate--tRNA ligase [Phascolarctobacterium sp. YIT 12067]
 gi|322414314|gb|EFY05132.1| glutamate--tRNA ligase [Phascolarctobacterium sp. YIT 12067]
          Length = 489

 Score =  405 bits (1041), Expect = e-111,   Method: Composition-based stats.
 Identities = 173/492 (35%), Positives = 270/492 (54%), Gaps = 16/492 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VRVR APSPTG  HIG A TALFN+L A++ GGK ILRIEDTD +R   +S + ++ 
Sbjct: 1   MSEVRVRFAPSPTGYLHIGGARTALFNWLFARKMGGKLILRIEDTDIERLKEDSVSQILT 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           SLKW G+NWDEGP+ GG YGPY QSER +IY+ Y Q LL++  A+ CFC+TE L   R  
Sbjct: 61  SLKWLGINWDEGPEAGGEYGPYYQSERFDIYKKYAQQLLDEGKAYYCFCTTEDLAAQREK 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           QR    P RY   C  + ++E +      + + +R+ +P +GS    D ++GE+    + 
Sbjct: 121 QRAAKQPFRYARTCRDIPAEEAKARIAAGEPYSIRIKIPAEGSITVHDLIHGEVTFNMDQ 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
            D  V++KS+G+PTY+ A  +DDHLM +THV R EE +S+ PK +L+Y+   +  P+F H
Sbjct: 181 FDDFVIVKSNGIPTYNFAVCVDDHLMGMTHVLRAEEHLSNTPKQLLVYEALGWEPPKFGH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +P+I   D+SKLSKR   TS+  + + GYLPEA+IN+L LL     ++ + +  +++ + 
Sbjct: 241 MPMILAMDRSKLSKRHGATSVEEFRSQGYLPEAIINYLTLLGWGPGDERE-IFTLEETVK 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFL-------------SRVSQWMKEK 350
            F+L  +SK  A++D +KL W+NG+++ E                              +
Sbjct: 300 LFELEQMSKKAAIYDTKKLTWMNGQYLSELPLEKILPDAKPFFVKDGLVTEEWFNDAANE 359

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
               + + + + R+ TL  +   + + FK       +          E I +L+      
Sbjct: 360 AYFEKLVDVVRVRVKTLQEVADASTYFFKDVEEYDEKGVAKHF--KAENIPVLEQCIAAI 417

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
           +   ++   + E A   +A     +L  ++ P  LA+TG   S  +FD + +LG+     
Sbjct: 418 KADDVYDLASTEAAYNKIAADNGLALGKVIHPTRLALTGRTVSPGMFDVMVLLGKERTLA 477

Query: 471 RLRHAIALVSSL 482
           RL  A+  + SL
Sbjct: 478 RLEKAVEFIKSL 489


>gi|332981278|ref|YP_004462719.1| glutamyl-tRNA synthetase [Mahella australiensis 50-1 BON]
 gi|332698956|gb|AEE95897.1| glutamyl-tRNA synthetase [Mahella australiensis 50-1 BON]
          Length = 489

 Score =  402 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 181/492 (36%), Positives = 271/492 (55%), Gaps = 15/492 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            + +RVR APSPTG  HIG A TALFN+L A+   G+FILRIEDTD  R   +S   ++ 
Sbjct: 1   MTDIRVRFAPSPTGYLHIGGARTALFNWLFARHNNGRFILRIEDTDRGRLKADSVEQIIS 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           S+KW GL+WDEGPD+GG YGPY QS+R ++Y   ++ LL++  A+ C+C+ E LE+ R+ 
Sbjct: 61  SMKWLGLDWDEGPDVGGDYGPYFQSQRLDLYSKEIRRLLDEDKAYYCYCTQEELEQRRQQ 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             K    SRYDG C  L+  E + L ++ +K VVRL VP++G  V +D + G +      
Sbjct: 121 AIKEGKASRYDGRCRNLAVGEQQSLQKQGRKPVVRLKVPSEGVTVVEDVIRGTVTFDNAL 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  ++ KSDGMPTY+    +DDH M+I+HV R EE +S+ PK +L+YQ   +  P F H
Sbjct: 181 LDDFIIQKSDGMPTYNFVCAVDDHAMEISHVIRAEEHLSNTPKQLLVYQALGYDAPVFAH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +P+I  PD+SKLSKR   TS+  +   GYLPEA++N+LALL        + ++ M++ + 
Sbjct: 241 VPMILAPDRSKLSKRHGATSVEEFRDQGYLPEAIVNYLALLGWSPEGGQE-MISMEECVK 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------EKD 351
            FDL  +SK  A++D +KL WLNG +IR  +     +     +M              +D
Sbjct: 300 QFDLAKVSKNAAIYDTKKLTWLNGNYIRS-IDIDRLVDLSIPFMWQKGLLPEQISPDMRD 358

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
            L + +   + R  TL  L     +   +D        K   L  E + ++L+  +   +
Sbjct: 359 YLKRVVAAVRERTRTLVELADACSYFLTNDFEFDVAGVKKYFL-KEGVAELLQKGRLVLQ 417

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            +  +   + E A R +          I+ P  LAI+G      LFD +E+LG+     R
Sbjct: 418 SLDKFDAASTEAAYRALIDELGIKGADIIHPTRLAISGRTVGPGLFDIMELLGKERTLDR 477

Query: 472 LRHAIALVSSLV 483
           +  AI  +  L 
Sbjct: 478 MARAIEYIKKLA 489


>gi|296131809|ref|YP_003639056.1| glutamyl-tRNA synthetase [Thermincola sp. JR]
 gi|296030387|gb|ADG81155.1| glutamyl-tRNA synthetase [Thermincola potens JR]
          Length = 484

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 176/483 (36%), Positives = 267/483 (55%), Gaps = 12/483 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  HIG A +ALFN+L+A++  G  I+RIEDTD +RS+ ESE  ++++L+
Sbjct: 4   VRVRFAPSPTGPLHIGGARSALFNWLLARKYNGTMIVRIEDTDLERSSRESEENILKALE 63

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEG   GG+ GPYRQ+ER +IY+ Y Q LL    A+ C+C+ E L+  R+A   
Sbjct: 64  WLGLDWDEGIGKGGSNGPYRQTERLDIYREYAQKLLAAGQAYYCYCTEEELDAERQALLA 123

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           +    RY G C  L+ ++  R   E +K V+R  VP   + V +D V G +    N +  
Sbjct: 124 KGEMPRYLGKCRHLTEEDRARYEAEGRKPVIRFRVPENENIVVRDLVRGNVVFESNGIGD 183

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            V++KSDG+PTY+ A V+DD LM ITHV RGEE +S+ P+ +++Y       P+F H+ L
Sbjct: 184 YVIVKSDGIPTYNFAVVLDDALMGITHVVRGEEHLSNTPRQLMIYDALGLQAPQFAHVSL 243

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D+SK+SKR   T+I  Y  +GYLPEAL+NFL LL      + +E+  ++QL+  F 
Sbjct: 244 ILGKDRSKMSKRHGATAIEQYEKLGYLPEALVNFLVLLGWSPEGE-EEIFSLEQLVEQFS 302

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLST----------TEFLSRVSQWMKEKDRLTQA 356
           L  ++K  AVFD  KL+WLNG +IR+               E      Q   + + L   
Sbjct: 303 LDRVAKNPAVFDLDKLNWLNGYYIRQSPVERIAAMALPYLKEAGYVSDQVTADSEWLKMV 362

Query: 357 LTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIW 416
           +   Q  ++ ++ + +     F  D    +E      L  E+   + +  +E+   ++  
Sbjct: 363 VASVQEYLSYVAEITEHVKIYFNEDFDFESEE-AKNILLDEDFPRVAELFKEKITALEEL 421

Query: 417 KRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI 476
             E  +  L+ + +  +   K +  PL +A+TG  +   LF  I ILG+     RL  + 
Sbjct: 422 TPETAKQMLKALTKELKLGGKKVYMPLRVALTGQTHGPELFYIIPILGKEKALARLASSQ 481

Query: 477 ALV 479
           A +
Sbjct: 482 AKL 484


>gi|83644930|ref|YP_433365.1| glutamyl-tRNA synthetase [Hahella chejuensis KCTC 2396]
 gi|115305768|sp|Q2SK84|SYE_HAHCH RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|83632973|gb|ABC28940.1| glutamyl-tRNA synthetase [Hahella chejuensis KCTC 2396]
          Length = 501

 Score =  399 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 219/486 (45%), Positives = 316/486 (65%), Gaps = 2/486 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR RIAPSPTG+PH+GTAY ALFN   A++ GGKFILRIEDTD  RST ESE  ++ +L+
Sbjct: 3   VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGKFILRIEDTDQARSTTESEQDILSALR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEGPD+GG + PYRQSERK+ Y+ Y + L+ K  A+ CF + E L+ +R  ++ 
Sbjct: 63  WLGLEWDEGPDVGGPHAPYRQSERKDSYRAYAEELVAKGRAYYCFRTPEELDVIREERKA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + +P    G  L+L   E++R     + HV+R+ VP++G CV +D + G++EI W  VD 
Sbjct: 123 QGLPPGIKG-DLELPDDEVKRRLAAGEPHVIRMKVPDEGVCVVKDMLRGDIEIDWGQVDC 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           Q+LLKSDGMPTYHLANV+DDHLM+ITHV RGEEWI+S PKH+LLYQYF + +P   H+PL
Sbjct: 182 QILLKSDGMPTYHLANVVDDHLMEITHVIRGEEWINSAPKHMLLYQYFGWEMPTLCHMPL 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDK+KLSKR+NPTSI++Y  +G +PEAL+N+L  +     ++ ++   + Q+I +FD
Sbjct: 242 LRNPDKTKLSKRKNPTSINFYERLGVMPEALLNYLGRMGWSMPDESEK-FTLDQMIENFD 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD  KL WLNG W+RE LS T+FL R+  W    D   + +   QSR  T
Sbjct: 301 IKRVSLGGPVFDIVKLRWLNGLWMRENLSETQFLERLVHWSYNNDYAAKMIPHVQSRAET 360

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
            S +  +  F+F   L +  E F ++ L  E++  +L+ +    E  + W +ENI   L+
Sbjct: 361 FSDVAPLAAFMFSGYLPIKQEDFAASKLEEEQLKKVLQYSLWRLEAQRHWTKENIFADLK 420

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            +++     +   + P+F++I G+  S  + DS+E LG  +   RLR A+ ++  L +  
Sbjct: 421 ALSKAMSVKMGDFMMPIFVSIAGTPNSWSVVDSMETLGPDMTRARLRFALEVLGGLSKKG 480

Query: 487 KKKELK 492
            K   K
Sbjct: 481 LKAAEK 486


>gi|77458105|ref|YP_347610.1| glutamyl-tRNA synthetase [Pseudomonas fluorescens Pf0-1]
 gi|77382108|gb|ABA73621.1| putative glutamyl-tRNA synthetase [Pseudomonas fluorescens Pf0-1]
          Length = 514

 Score =  399 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 220/490 (44%), Positives = 327/490 (66%), Gaps = 2/490 (0%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
           + + VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  + 
Sbjct: 21  AMTTVRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQIF 80

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +L+W G++W EGPD+GG +GPYRQSER +IYQ Y Q L++   AF CFC+ E L++MR 
Sbjct: 81  DALRWLGIDWSEGPDVGGPHGPYRQSERGDIYQKYCQQLVDMGHAFPCFCTAEELDQMRA 140

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RYDG  L LS +E+ R     + HV+R+ VP++G CV  D + G++EIPW+
Sbjct: 141 EQMARGETPRYDGRALLLSKEEVARRLAAGEPHVIRMKVPSEGVCVVPDMLRGDVEIPWD 200

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  PE  
Sbjct: 201 RMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWEQPELC 260

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q+++
Sbjct: 261 YMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEMV 319

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQS 362
            +FDL  +S  G +FD +KL WLNG+W+R+ L   EF +RV +W    + + +     Q 
Sbjct: 320 DNFDLKRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFAARVQKWAFNSEYMMKIAPHVQG 378

Query: 363 RITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIE 422
           R+ T S +  +  F F   ++  A+ F+S  L  +++  +++    + E ++ W++++I 
Sbjct: 379 RVETFSQVAPLAGFFFAGGVNPDAKLFESKKLSGDQVRQLMQLILWKLESLRQWEKDSIT 438

Query: 423 TALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSL 482
             ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  FRLR AI L+  +
Sbjct: 439 ATIQAVVESLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRQAIDLLGGV 498

Query: 483 VQNHKKKELK 492
            +   K+  K
Sbjct: 499 SKKENKEWEK 508


>gi|221633863|ref|YP_002523089.1| glutamyl-tRNA synthetase [Thermomicrobium roseum DSM 5159]
 gi|221155759|gb|ACM04886.1| glutamyl-tRNA synthetase [Thermomicrobium roseum DSM 5159]
          Length = 506

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 188/496 (37%), Positives = 273/496 (55%), Gaps = 17/496 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++++VRVR APSPTG+ H+G A TALFN+L A++ GG FILRIEDTD  R   +S   +
Sbjct: 1   MTTARVRVRFAPSPTGDLHVGGARTALFNWLFARQHGGAFILRIEDTDQARLVGQSIAGI 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           ++ LKW GL WDEGPDIGG YGPY QS+R  +Y+ + + L+E   A+ CFC+ ERLE +R
Sbjct: 61  IEGLKWLGLEWDEGPDIGGPYGPYIQSQRLPLYREHARWLVEHGHAYYCFCTPERLERVR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           + QR R  P  YD HC  L  +E+E      +  V+R  +P +G     D + GE+    
Sbjct: 121 QEQRARGEPPGYDRHCRFLPPEEVEARLARGEPAVIRFKMPLEGVTTIVDLLRGEITYEN 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             +   VLLKSDG PTYHLANV+DDH M+I+H+ R EEWI S P H  LY+ F + +P  
Sbjct: 181 RLLQDLVLLKSDGFPTYHLANVVDDHFMEISHILRAEEWIPSAPLHAQLYRAFGWEMPVL 240

Query: 242 IHLPLIKNPD-KSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
            HLPLI +PD K KLSKR   T +  +  +GYLPEA+IN+LALL     + + E+   ++
Sbjct: 241 CHLPLILSPDGKGKLSKRHGATGVLEFKRLGYLPEAMINYLALLG-WAYDAEREIFSREE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
           LI  F L  ++   A F+ +KL W+N  +I   LS  EF  R   ++++           
Sbjct: 300 LIQLFRLEEVNPHPARFNFEKLLWMNQYYINHVLSVDEFARRCVPFLRDAGLVGPEADDP 359

Query: 350 ----KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
                  + + + L + R   LS +P +T F F        E      + PE ++  L  
Sbjct: 360 ASPAFAYVREVVALVKDRAKLLSEVPDLTRFFFADVEDYDPELLLQRKVEPERVLQALDR 419

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
                         ++E  LR +A+        +  P+ +A+TG   S  LF+++ +LG 
Sbjct: 420 VIATLRQANFADETDLEQRLRGLAEELGLKTGQLFMPIRVAVTGRTVSPGLFETLRVLGA 479

Query: 466 SVVYFRLRHAIALVSS 481
                RL  A   +++
Sbjct: 480 ERSLERLARAREKLAA 495


>gi|239825670|ref|YP_002948294.1| glutamyl-tRNA synthetase [Geobacillus sp. WCH70]
 gi|239805963|gb|ACS23028.1| glutamyl-tRNA synthetase [Geobacillus sp. WCH70]
          Length = 486

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 187/489 (38%), Positives = 289/489 (59%), Gaps = 19/489 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S +VRVR APSPTG  HIG A TALFNYL A+   GKFI+RIEDTD +R+    E + +
Sbjct: 1   MSQEVRVRYAPSPTGHLHIGGARTALFNYLFARHHNGKFIVRIEDTDIERNVEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++LKW G+++DE  D  G YGPYRQ+ER +IY+ YV  LLEK  A++CFC+ E LE+ R 
Sbjct: 61  ENLKWLGIDYDESVDKDGGYGPYRQTERLDIYRKYVNELLEKGYAYKCFCTPEELEKERE 120

Query: 123 AQR-KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           AQR       +Y G C  L+ +++ +L  E K + +R+ VP      F+D V G++    
Sbjct: 121 AQRTAGIAAPQYSGKCRHLTKEQVAQLEAEGKPYTIRVKVPEGKVYEFEDIVRGKVTFES 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             +   V++K++G+PTY+ A VIDDHLMKITHV RGEE +S+ PK +++Y YF +  P+F
Sbjct: 181 KDIGDWVIMKANGIPTYNFAVVIDDHLMKITHVFRGEEHLSNTPKQLMIYDYFGWEPPKF 240

Query: 242 IHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            HL LI N ++ KLSKR       +S Y  +GYLPEAL NF ALL      + +E+   +
Sbjct: 241 AHLTLIVNENRKKLSKRDESIIQFVSQYKELGYLPEALFNFFALLGWSPEGE-EEIFSKE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD+  LSK+ ++FD +KL W+N ++I++ L     +                   
Sbjct: 300 ELIRIFDVSRLSKSPSMFDTKKLTWMNNQYIKK-LDLDRLVEISLPHLIKAGRLPEQMSE 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           +++      + L Q +++  + + ++++  FK D+    E+     L  E++ D+LKT  
Sbjct: 359 EQRQWARDLIALYQEQMSYGAEIVELSELFFKEDIEYNEEA--KEVLAGEQVPDVLKTFL 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           EE + ++ +  ENI+ A+++V +   +  K +  P+ +A+TG  +   L  +I++LG+  
Sbjct: 417 EEVKRLEPFTAENIKAAIKSVQKATGQKGKKLFMPIRVAVTGQTHGPELPFAIQLLGKEK 476

Query: 468 VYFRLRHAI 476
           V  RL   I
Sbjct: 477 VISRLEKVI 485


>gi|317120926|ref|YP_004100929.1| glutamyl-tRNA synthetase [Thermaerobacter marianensis DSM 12885]
 gi|315590906|gb|ADU50202.1| glutamyl-tRNA synthetase [Thermaerobacter marianensis DSM 12885]
          Length = 506

 Score =  399 bits (1024), Expect = e-109,   Method: Composition-based stats.
 Identities = 173/488 (35%), Positives = 267/488 (54%), Gaps = 13/488 (2%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S  VRVR APSPTG  HIG   T LFN+L A++ GG+F+LR EDTD +RS  E    ++
Sbjct: 1   MSQPVRVRYAPSPTGYLHIGGVRTILFNWLFARKYGGRFVLRFEDTDPERSRDELIEPML 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +S++W GL+WDEGPD+GG YGPYRQS+R ++Y+  +  LL +  A+ C+C+ E L+  R 
Sbjct: 61  ESIRWLGLDWDEGPDVGGPYGPYRQSQRLHLYREALDRLLAEGKAYYCYCTPEELDAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           A R    P+ Y G C  L+ +E  RL  E  +  VRL VP+ G    +D V G++     
Sbjct: 121 AARAAGRPAVYGGRCRHLTEEERRRLEAEGCRPAVRLRVPDAGEITVRDLVKGDVTFDVG 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
                ++ ++DGMP Y+ A V+DDH M ITHV RG+E +S+ PK +L+Y+   +  P F 
Sbjct: 181 QFGDFIIARADGMPVYNFAVVVDDHHMAITHVIRGDEHLSNTPKQLLVYRALGWEPPHFA 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+P+I  PD++KLSKR    ++  Y   G+LPEA++N++ALL     +D + L   + +I
Sbjct: 241 HVPMILAPDRTKLSKRHGAVAVDEYRRQGFLPEAILNYVALLGWSPGDDREILSLGE-MI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKEKD 351
             FDL  +S+  A++D +K+ W+NG ++RE          +               +E+ 
Sbjct: 300 ELFDLDRVSRTAAIYDVEKMAWMNGHYLRELDLDQVVERAIPRFVAAGLIQGEPHGEERR 359

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
           RL   +   + R+ TL  L + + + F           +      ++ I IL+   E   
Sbjct: 360 RLYAIVDAVRQRVRTLEELVEASRYFFTDFDGYEEAGVRKH-FDRDDAIPILEAVAETLA 418

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            ++ W +  IE ALR +A+ +      I  P  LA++G      +FD I  +GR     R
Sbjct: 419 QVEPWSQAAIEQALRGLAERKGVGTGRIFHPTRLAVSGRTVGPGVFDVICWVGRERCLER 478

Query: 472 LRHAIALV 479
           ++ AI  +
Sbjct: 479 IQRAIEWI 486


>gi|115305790|sp|Q3KF35|SYE_PSEPF RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
          Length = 493

 Score =  398 bits (1023), Expect = e-109,   Method: Composition-based stats.
 Identities = 220/491 (44%), Positives = 328/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G++W EGPD+GG +GPYRQSER +IYQ Y Q L++   AF CFC+ E L++MR
Sbjct: 59  FDALRWLGIDWSEGPDVGGPHGPYRQSERGDIYQKYCQQLVDMGHAFPCFCTAEELDQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDG  L LS +E+ R     + HV+R+ VP++G CV  D + G++EIPW
Sbjct: 119 AEQMARGETPRYDGRALLLSKEEVARRLAAGEPHVIRMKVPSEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  PE 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWEQPEL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF +RV +W    + + +     Q
Sbjct: 298 VDNFDLKRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFAARVQKWAFNSEYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   ++  A+ F+S  L  +++  +++    + E ++ W++++I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVNPDAKLFESKKLSGDQVRQLMQLILWKLESLRQWEKDSI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  FRLR AI L+  
Sbjct: 417 TATIQAVVESLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRQAIDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|134298069|ref|YP_001111565.1| glutamyl-tRNA synthetase [Desulfotomaculum reducens MI-1]
 gi|238685537|sp|A4J0Y7|SYE_DESRM RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|134050769|gb|ABO48740.1| glutamate--tRNA(Gln) ligase [Desulfotomaculum reducens MI-1]
          Length = 482

 Score =  398 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 175/483 (36%), Positives = 271/483 (56%), Gaps = 15/483 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           +RVR APSPTG  HIG A +ALFN+L A+  GG+F++RIEDTD +RS+ ESE  ++ +L+
Sbjct: 3   IRVRFAPSPTGPLHIGGARSALFNWLYARHHGGQFLVRIEDTDMERSSRESEENILNALR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G++WDEG ++GG  GPYRQ+ER +IY+   + L++   A+ C+CS E L   R A  +
Sbjct: 63  WLGIDWDEGIEVGGPNGPYRQTERLDIYRQLAKELVDAGHAYYCYCSEEELAVEREALME 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           +    RY G C  L  ++  +   E KK V+R  VP   +    D V G++E   N +  
Sbjct: 123 KGELPRYLGRCRNLCPEDKAKFEAEGKKPVLRFRVPENQTITINDHVRGQVEFESNGIGD 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +++KSD +PTY+ A V+DDH M ITHV R EE +S+ P+ IL+Y+   +  PEF H+ L
Sbjct: 183 FIIMKSDNIPTYNFAVVVDDHDMGITHVVRAEEHLSNTPRQILIYEALGWQKPEFAHISL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D+SK+SKR   TSI  Y  +GYLPEAL+NFLALL      + +E+  ++++   F 
Sbjct: 243 ILGKDRSKMSKRHGATSIEQYHNLGYLPEALVNFLALLGWSPGGE-EEIFTLKEIKEQFT 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKDRLT 354
           L  ++K  AVFD  KL+WLNG +IR + S          +             ++   L 
Sbjct: 302 LDRVAKNPAVFDIDKLNWLNGHYIR-QASVERLTKLAVPYLQGAGYLKEEISTEKMAWLE 360

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           Q + +A++ I+ +  + Q  D  F+ ++ +T E  K      E++  ++K   E F    
Sbjct: 361 QVVAIARNYISYMQEITQHVDVFFRDNVEITEEDAKQVQGW-EQMPVVMKAAHELFSAAN 419

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
               E+++  ++ + +      K I +PL + ITG  +   L   I ++G+     RL  
Sbjct: 420 ELTEESVKAIIKAIGKQTGLKGKFIFQPLRVGITGQTHGPELHQIIPVIGKERTLARLEA 479

Query: 475 AIA 477
           A+ 
Sbjct: 480 ALK 482


>gi|152996892|ref|YP_001341727.1| glutamyl-tRNA synthetase [Marinomonas sp. MWYL1]
 gi|229470621|sp|A6VZB3|SYE_MARMS RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|150837816|gb|ABR71792.1| glutamyl-tRNA synthetase [Marinomonas sp. MWYL1]
          Length = 493

 Score =  398 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 231/489 (47%), Positives = 321/489 (65%), Gaps = 1/489 (0%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VR RIAPSPTG+PH+GTAY ALFN   A++ GGKFILRIEDTD  RST ESE  ++ 
Sbjct: 1   MSEVRTRIAPSPTGDPHVGTAYIALFNMAFARKMGGKFILRIEDTDQTRSTPESEKMILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L+W GL+W EGPD+GG YGPYRQSER +IY  Y Q L++K  AF  F +TE L++MR  
Sbjct: 61  ALRWLGLDWAEGPDVGGPYGPYRQSERGDIYGQYAQELIDKGHAFYAFETTEELDQMRNE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q+++ +P +YDG  L L+++E++        +V+R+ +P +G+CV QD + G +EI W  
Sbjct: 121 QKEQGLPQKYDGRALNLTAEEVQAKLDAGVPYVIRMKIPEEGTCVVQDMLRGTIEIDWAQ 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           VDMQVLLK+DGMPTYHLANV+DDHLMKITHV RGEEWI+S PKHILLYQYF + +P   H
Sbjct: 181 VDMQVLLKADGMPTYHLANVVDDHLMKITHVIRGEEWINSAPKHILLYQYFGWDMPTLCH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +PL++NPDKSKLSKR+NPTSI YY  MGY+ EA+IN+L  +     ++ ++   + ++I 
Sbjct: 241 MPLLRNPDKSKLSKRKNPTSILYYQRMGYMSEAVINYLGRMGWSMPDEREK-FSLDEMIE 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSR 363
           HFD+  +S  G VFD +KL WLNG WIRE L+   F  +  +W    + L + L L   R
Sbjct: 300 HFDIQRVSLGGPVFDVEKLSWLNGMWIRENLTPETFAQKYVEWALNPEYLMKILPLVIPR 359

Query: 364 ITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIET 423
           + T S +  +  F  K  L +T E F S  L  E +   ++      E +  W+++ I  
Sbjct: 360 VETFSDVADVAGFFLKGMLPITKEDFSSIKLEEETLRKAMQFALWRLEALSKWEKDEIFN 419

Query: 424 ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLV 483
            ++ +AQ  E   K    PLF+AI+G+  S+ +FDS+ ILG  +   R+R A+ ++    
Sbjct: 420 EMKALAQVMEIKPKDFFAPLFVAISGTTASVSVFDSMAILGSDISRARMRTAVNVLGGPS 479

Query: 484 QNHKKKELK 492
           +   K+  K
Sbjct: 480 KKEAKRWEK 488


>gi|330974325|gb|EGH74391.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 493

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 222/491 (45%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G++W EGPD+GG +GPYRQSER +IYQ Y Q L++   AF CFC+ E L++MR
Sbjct: 59  FDALRWLGIDWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVDMGHAFPCFCTAEELDQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SR+  W    D + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRLKTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L PE++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR AI L+  
Sbjct: 417 MGCIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQAIDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|70729429|ref|YP_259167.1| glutamyl-tRNA synthetase [Pseudomonas fluorescens Pf-5]
 gi|115305788|sp|Q4KF16|SYE_PSEF5 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|68343728|gb|AAY91334.1| glutamyl-tRNA synthetase [Pseudomonas fluorescens Pf-5]
          Length = 493

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 222/491 (45%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+NW EGPD+GG +GPYRQSER +IYQ Y Q L++   AF CFC+ E L++MR
Sbjct: 59  FDALRWLGINWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVDLGHAFPCFCTAEELDQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDG  L LS +E+ R     + HV+R+ VP +G CV  D + G++EIPW
Sbjct: 119 AEQMARGETPRYDGRALLLSKEEVARRLAAGEPHVIRMKVPTEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SRV  W    D + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVQEFASRVQTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   ++  A+ F+S  L  +++  +++    + E ++ W++++I
Sbjct: 357 GRVETFSQIAPLAGFFFAGGVNPDAKLFESKKLSGDQVRQLMQLILWKLESLRQWEKDSI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  FRLR AI L+  
Sbjct: 417 TATIQAVVESLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRQAIDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|295401943|ref|ZP_06811906.1| glutamyl-tRNA synthetase [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109238|ref|YP_003987554.1| glutamyl-tRNA synthetase [Geobacillus sp. Y4.1MC1]
 gi|294976073|gb|EFG51688.1| glutamyl-tRNA synthetase [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214339|gb|ADP72943.1| glutamyl-tRNA synthetase [Geobacillus sp. Y4.1MC1]
          Length = 486

 Score =  397 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 186/487 (38%), Positives = 285/487 (58%), Gaps = 19/487 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S +VRVR APSPTG  HIG A TALFNYL A+   GKFI+RIEDTD +R+    E + +
Sbjct: 1   MSQEVRVRYAPSPTGHLHIGGARTALFNYLFARHHNGKFIVRIEDTDIERNVEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++LKW G+++DE  D  G YGPYRQ+ER +IY+ YV  LLEK  A++CFC+ E LE+ R 
Sbjct: 61  ENLKWLGIDYDESVDKDGGYGPYRQTERLDIYRKYVNELLEKGYAYKCFCTPEELEQERE 120

Query: 123 AQRKRNIPSRYD-GHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           AQR   I +    G C  L+ ++I +L  E K + +R+ VP      F+D V G++    
Sbjct: 121 AQRAAGIAAPQYSGKCRHLTKEQIAQLEAEGKPYTIRVKVPEGKVYEFEDIVRGKVTFES 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             +   V++K++G+PTY+ A VIDDHLMKITHV RGEE +S+ PK +++Y YF +  P+F
Sbjct: 181 KDIGDWVIMKANGIPTYNFAVVIDDHLMKITHVFRGEEHLSNTPKQLMIYDYFGWEPPQF 240

Query: 242 IHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            HL LI N ++ KLSKR       +S Y  +GYLPEAL NF ALL      + +E+   +
Sbjct: 241 GHLTLIVNENRKKLSKRDESIIQFVSQYKELGYLPEALFNFFALLGWSPEGE-EEIFSKE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD+  LSK+ ++FD +KL W+N ++I++ L     +                   
Sbjct: 300 ELIRIFDVSRLSKSPSMFDTKKLTWMNNQYIKK-LDLDRLVEISLPHLIKAGRLPEQMSE 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           +++      + L Q +++  + + Q+++  FK D+    E+     L  E++ D+LK   
Sbjct: 359 EQRQWARDLIALYQEQMSYGAEIVQLSELFFKEDIEYNEEA--KEVLSGEQVPDVLKAFL 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           EE + +  +  ENI+ A+++V +   +  K +  P+ +A TG  +   L  ++++LG+  
Sbjct: 417 EEVKQLDPFTAENIKAAIKSVQKSTGQKGKKLFMPIRVAATGQTHGPELPVALQLLGKEK 476

Query: 468 VYFRLRH 474
           V  RL  
Sbjct: 477 VISRLEK 483


>gi|315122582|ref|YP_004063071.1| glutamyl-tRNA synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495984|gb|ADR52583.1| glutamyl-tRNA synthetase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 483

 Score =  397 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 406/479 (84%), Positives = 451/479 (94%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M ++S +RVRIAPSPTGEPHIGTAYTALFNYLIAK TGGKFILRIEDTDSKRSTLESENA
Sbjct: 1   MTANSDLRVRIAPSPTGEPHIGTAYTALFNYLIAKSTGGKFILRIEDTDSKRSTLESENA 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
           V++SLKWCGL+WDEGPDIGG+YGPYRQSERK+IYQPYVQNLL+KKLAFRCFCS ERL+EM
Sbjct: 61  VIKSLKWCGLHWDEGPDIGGSYGPYRQSERKDIYQPYVQNLLDKKLAFRCFCSEERLKEM 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R +QRK+NIPS+YDGHCL+LSSQEIERLSQE+K HVVRL +P+QG C FQDKVYG +EIP
Sbjct: 121 RFSQRKKNIPSKYDGHCLRLSSQEIERLSQEKKPHVVRLKIPDQGCCTFQDKVYGHVEIP 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
           WNAVDMQVLLKSDGMPTYHLANV+DDHLMKITHVARGEEW+SSVPKHILLYQY NFP+PE
Sbjct: 181 WNAVDMQVLLKSDGMPTYHLANVVDDHLMKITHVARGEEWLSSVPKHILLYQYLNFPLPE 240

Query: 241 FIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           FIHLPLIKNPDKSKLSKR+NPTSISYYSAMGYLPEALINFLALLF+ K+E++DELM+MQQ
Sbjct: 241 FIHLPLIKNPDKSKLSKRKNPTSISYYSAMGYLPEALINFLALLFIQKNEEEDELMNMQQ 300

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLA 360
           LIHHF+L +LSKAGAVFD+QKLDWLNGRWIRE+LSTT+F+SRVSQW KE+DRLT+ALTLA
Sbjct: 301 LIHHFNLLNLSKAGAVFDRQKLDWLNGRWIREQLSTTDFISRVSQWTKEEDRLTKALTLA 360

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
           QSRI+T ++LP M DFLFKSDL+LT ESFK+ +L PEEI+ ILK TQEEFE IQIW REN
Sbjct: 361 QSRISTFASLPSMVDFLFKSDLYLTKESFKNISLTPEEIVTILKKTQEEFEGIQIWTREN 420

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           IETALRNVAQ  EKSLK+IVKPLFL+ITGSKYSLPLFDSIEILGRSVVY RL+HAI LV
Sbjct: 421 IETALRNVAQSLEKSLKVIVKPLFLSITGSKYSLPLFDSIEILGRSVVYSRLKHAIQLV 479


>gi|330951647|gb|EGH51907.1| glutamyl-tRNA synthetase [Pseudomonas syringae Cit 7]
          Length = 493

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 220/491 (44%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G++W EGPD+GG +GPYRQSER +IY+ Y Q L++   AF CFC+ E L++MR
Sbjct: 59  FDALRWLGIDWSEGPDVGGPHGPYRQSERGDIYKKYAQQLVDMGHAFPCFCTAEELDQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ R    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQARGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SR+  W    D + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVDEFASRLKTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L PE++  +++    + E ++ W+++ I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVIQLILWKLESLRQWEKDRI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGCIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|66045217|ref|YP_235058.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. syringae B728a]
 gi|81308342|sp|Q4ZV02|SYE_PSEU2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|63255924|gb|AAY37020.1| Glutamyl-tRNA synthetase bacterial/mitochondrial [Pseudomonas
           syringae pv. syringae B728a]
          Length = 493

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 221/491 (45%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G++W EGPD+GG +GPYRQSER +IYQ Y Q L++   AF CFC+ E L++MR
Sbjct: 59  FDALRWLGIDWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVDMGHAFPCFCTAEELDQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SR+  W    D + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRLKTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L PE++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGCIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|312962073|ref|ZP_07776568.1| glutamyl-tRNA synthetase [Pseudomonas fluorescens WH6]
 gi|311283625|gb|EFQ62211.1| glutamyl-tRNA synthetase [Pseudomonas fluorescens WH6]
          Length = 493

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 220/491 (44%), Positives = 327/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IY+ Y Q L++   AF CFC+ E L++MR
Sbjct: 59  FDALRWLGITWAEGPDVGGPHGPYRQSERSDIYKQYTQQLVDMGHAFPCFCTAEELDQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ R    RYDG  L LS +E+ R     + HV+R+ VP++G CV  D + G++EIPW
Sbjct: 119 AEQQARGETPRYDGRALLLSKEEVARRLAAGEPHVIRMKVPSEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SRV QW    D + +   L Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRVQQWALNPDYMMKIAPLVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   ++   + F+S  L  +++  +++    + E ++ W+++ I
Sbjct: 357 GRVETFSQVAPLASFFFAGGVNPDPKLFESKKLSGDQVRQLMQLILWKLESLRQWEKDAI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 TATIQAVVESLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|257453622|ref|ZP_05618912.1| glutamyl-tRNA synthetase [Enhydrobacter aerosaccus SK60]
 gi|257449080|gb|EEV24033.1| glutamyl-tRNA synthetase [Enhydrobacter aerosaccus SK60]
          Length = 498

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 228/489 (46%), Positives = 321/489 (65%), Gaps = 2/489 (0%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            SKVR RIAPSPTG PH+GTAY ALFN   AK  GG FILRIEDTD  RST +SE  ++ 
Sbjct: 1   MSKVRTRIAPSPTGFPHVGTAYIALFNLAFAKAHGGDFILRIEDTDQTRSTAQSEQMILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L+W GL+W EGPD+GG + PYRQSERK+IY+ Y + LL+K  AFRCF +++ L++MR  
Sbjct: 61  ALRWVGLDWSEGPDVGGPHAPYRQSERKDIYKQYAEELLDKGHAFRCFATSDELDQMRAE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q  R    +YDG    L+ ++ ++L+ E K  V+R+ VP++G C F D + GE+EIPW  
Sbjct: 121 QMARGETPKYDGRYANLTREQSDKLAAEGKPFVIRMRVPDEGVCKFDDMLRGEVEIPWAQ 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           VDMQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEWI+S PKH LLY+YF + +P   H
Sbjct: 181 VDMQVLLKTDGLPTYHLANVVDDHLMQITHVIRGEEWINSAPKHQLLYKYFGWDMPVLCH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +PL++NPDKSKLSKR+NPTSI+YY   G LPEAL+N+L  +     ++ ++   + ++I 
Sbjct: 241 MPLLRNPDKSKLSKRKNPTSITYYRDAGVLPEALLNYLGRMGYSMPDEAEK-FTLDEMIA 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSR 363
            FD+  +S  G +FD +KL WLNG W+R  LS     +++  W  + D+LT      Q R
Sbjct: 300 SFDIKRVSLGGPIFDVEKLTWLNGEWLRS-LSPEALKTKILDWANDSDKLTAIAKAIQPR 358

Query: 364 ITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIET 423
           I  LS     + F F++   ++   F+   L  E+ ++IL+  Q + E + +W  ENI+ 
Sbjct: 359 INLLSDAVNWSGFYFQNLPTISEVDFEHKVLSTEQTVEILQLAQWQLETLPVWTEENIQA 418

Query: 424 ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLV 483
            L  +A      L+  + P F+AI GSK S P+ +S+ ++G  +   RLRHAI ++  + 
Sbjct: 419 VLSGLAGEMGIKLRDFMSPFFIAIAGSKSSTPVMNSMYLIGADMTLQRLRHAIEVLGGVS 478

Query: 484 QNHKKKELK 492
           +   K+  K
Sbjct: 479 KKKAKELEK 487


>gi|222087176|ref|YP_002545711.1| glutamyl-tRNA synthetase protein [Agrobacterium radiobacter K84]
 gi|221724624|gb|ACM27780.1| glutamyl-tRNA synthetase protein [Agrobacterium radiobacter K84]
          Length = 485

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 296/482 (61%), Positives = 367/482 (76%), Gaps = 1/482 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RST E E  V
Sbjct: 1   MTTSGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTPEFETKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +LKWCGL W EGPDIGG YGPYRQS+RK++Y+PYV+ +++    FRCFC+ ERLE+MR
Sbjct: 61  LDALKWCGLKWSEGPDIGGPYGPYRQSDRKDLYKPYVEKIVDAGHGFRCFCTPERLEQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR   +P +YDGHCL LS++E+       + HVVR+ +P +GSC F D VYG++EIPW
Sbjct: 121 AAQRAAGLPPKYDGHCLNLSAEEVSSRVAAGEPHVVRMKIPTEGSCKFHDGVYGDVEIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           +AVDMQVLLK+DGMPTYH+ANV+DDHLMKITHVARGEEW++SVPKHIL+Y+Y     P F
Sbjct: 181 DAVDMQVLLKADGMPTYHMANVVDDHLMKITHVARGEEWLASVPKHILIYRYLGLEPPVF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYY+A+GY+PEAL+NFL L FV +  + DEL+ M +L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYTALGYIPEALMNFLGLFFV-QIAEGDELLTMDEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
              FD  +LSKAGA+FD QKLDWLNGRWIREKLS  EF  RV  W  E  RL + L L+Q
Sbjct: 300 AEKFDPENLSKAGAIFDIQKLDWLNGRWIREKLSEEEFQQRVLTWAMENSRLQEGLKLSQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           SRI+ L  LP +T FLFKSDL+L   +F      PEE+++IL T Q + E I  W  E I
Sbjct: 360 SRISKLGELPDLTGFLFKSDLNLDPSAFARIKSTPEELLEILNTVQPDLEKILEWNVETI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
           E  LR +A    K LK+IV PLF+A++GS  SLPLFDS+ ILGRSVV  RL+ A   V++
Sbjct: 420 EAELRAIADRMGKKLKVIVAPLFVAVSGSSRSLPLFDSMAILGRSVVRQRLKLAAQTVAT 479

Query: 482 LV 483
           LV
Sbjct: 480 LV 481


>gi|330980696|gb|EGH78799.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 493

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 221/491 (45%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G++W EGPD+GG YGPYRQSER +IY+ Y Q L++   AF CFC+ E L+EMR
Sbjct: 59  FDALRWLGIDWSEGPDVGGPYGPYRQSERGDIYKKYAQQLVDMGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SR+  W    D + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRLKTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L PE++  +++    + E ++ W+++ I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKDRI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGCIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|323141392|ref|ZP_08076283.1| glutamate--tRNA ligase [Phascolarctobacterium sp. YIT 12067]
 gi|322414141|gb|EFY04969.1| glutamate--tRNA ligase [Phascolarctobacterium sp. YIT 12067]
          Length = 491

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 176/489 (35%), Positives = 269/489 (55%), Gaps = 15/489 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           + + +VRVR APSPTG  HIG A +ALFNYL+A++TGGK ILRIEDTD +RST ESE  +
Sbjct: 1   MCNDEVRVRFAPSPTGPFHIGGARSALFNYLLARKTGGKLILRIEDTDRERSTPESEENI 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +LKW G++WDEG D+GG  GPY Q ER +IY+ Y   LL +  A+ C+C+ E LE+ R
Sbjct: 61  KAALKWLGMDWDEGVDVGGPNGPYHQMERLDIYKKYTDKLLAEGKAYYCYCTDEELEKER 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           ++  K     RY G C  L+ ++I +   E +K  VR  VP     + +D V G++    
Sbjct: 121 QSLIKEGKMPRYMGKCRHLTEEQIAQFKAEGRKPTVRFRVPADKQILVRDMVRGDVVFDS 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           N +   V++KSDG+PTY+ A VIDD LM ITHV R EE +S+ P+  L+Y    F  P F
Sbjct: 181 NNIGDFVIVKSDGIPTYNYAVVIDDALMHITHVIRAEEHLSNTPRQCLVYDALGFKQPTF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+ LI   D +K+SKR   TS+  Y  +GYLPEA+ NFLALL       + E+  M +L
Sbjct: 241 GHISLILGKDHTKMSKRHGATSVDQYRQLGYLPEAINNFLALLG-WAPNSEQEIFSMDEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRL-------- 353
           IH F +  ++K  AVFD  KL+W+N  ++R +L    F       M     +        
Sbjct: 300 IHEFSMDRVAKNPAVFDIDKLNWINQHYMR-QLDAEAFFEAAKPHMIAAGYMTGEEEGEK 358

Query: 354 ----TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + +  AQ  I+  + +P+  +  F  +     E  ++  L  E +  ++    EE
Sbjct: 359 LAWLKRVVATAQEHISYAAQIPECVEMYFNDEFDFENEEAEA-VLKAETVPTVINMLLEE 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
              ++    + ++   + + +  +   K +  P+ +A+TG+++   L   + +LG     
Sbjct: 418 LPKVEKLDNDAVKALFKQIQKATKLKGKDVFMPIRVALTGNQHGPELAAMVPLLGVERTA 477

Query: 470 FRLRHAIAL 478
            R++ ++A 
Sbjct: 478 KRIKSSLAK 486


>gi|192360175|ref|YP_001981869.1| glutamyl-tRNA synthetase [Cellvibrio japonicus Ueda107]
 gi|238692426|sp|B3PD15|SYE_CELJU RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|190686340|gb|ACE84018.1| glutamyl-tRNA synthetase [Cellvibrio japonicus Ueda107]
          Length = 504

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 237/489 (48%), Positives = 322/489 (65%), Gaps = 1/489 (0%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S++R RIAPSPTG+PH+GTAY ALFN   A++ GGKF+LRIEDTD  RST ESE A++ 
Sbjct: 1   MSEIRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGKFLLRIEDTDQTRSTPESEQAILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           SL+W GL WDEGPD+GG +GPYRQSER +IY  Y   L+EK  AF CF + E L+EMRR 
Sbjct: 61  SLRWLGLEWDEGPDVGGPHGPYRQSERMDIYGKYALELVEKGHAFYCFATAEELDEMRRE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q+ R    RYDG  L L+S E++      + +V+R+ +P +G C   D + G++EI W+ 
Sbjct: 121 QQARGETPRYDGRGLTLTSAEVQSRLDAGEPYVIRMKIPEEGVCEIDDMLRGKIEIEWSQ 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           VDMQVLLK+DGMPTYHLANV+DDHLM+ITHV RGEEWI+S PKH+ LY+YF +  P   H
Sbjct: 181 VDMQVLLKADGMPTYHLANVVDDHLMQITHVIRGEEWINSAPKHLKLYEYFGWRAPVLCH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           LPL++NPDKSKLSKR+NPTSI YY  MGYLPEA++N+L  +     ++ ++   + ++  
Sbjct: 241 LPLLRNPDKSKLSKRKNPTSILYYKRMGYLPEAMLNYLGRMGWSMPDEREK-FTLVEMQE 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSR 363
           HFDL  +S  G +FD +KL WLN  WIRE  +  +   R+  W   KD L QAL  AQSR
Sbjct: 300 HFDLLRVSLGGPIFDVEKLSWLNSLWIRENFTIEQLAQRLHDWALNKDMLLQALPHAQSR 359

Query: 364 ITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIET 423
           +TTLS    +  FL    + +T  SF S  L  E+  + L+      E ++ W+R+ +  
Sbjct: 360 MTTLSDFAPLAGFLVSGMMPVTEASFASNKLPVEQQKEFLQFALWRLEALRTWERDTLFA 419

Query: 424 ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLV 483
            L+ +A+     +K  + P+F+AI GS  S P+ DS++I+G  +   R+RHAI  +    
Sbjct: 420 ELKTLAEQMGLKIKDAIAPVFVAIAGSTASFPVVDSMQIIGPDMSRARIRHAINALGGFG 479

Query: 484 QNHKKKELK 492
           +N +K   K
Sbjct: 480 KNKQKDLEK 488


>gi|326794728|ref|YP_004312548.1| glutamyl-tRNA synthetase [Marinomonas mediterranea MMB-1]
 gi|326545492|gb|ADZ90712.1| glutamyl-tRNA synthetase [Marinomonas mediterranea MMB-1]
          Length = 505

 Score =  396 bits (1018), Expect = e-108,   Method: Composition-based stats.
 Identities = 226/489 (46%), Positives = 321/489 (65%), Gaps = 1/489 (0%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VR RIAPSPTG+PH+GTAY ALFN   A++ GGKFILRIEDTD  RST ESE  ++ 
Sbjct: 13  MSEVRTRIAPSPTGDPHVGTAYIALFNMAFARKMGGKFILRIEDTDQTRSTPESEKMILD 72

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L+W GL+W EGPD+GG +GPYRQSER +IY  Y   L+E   AF  F + E L+ MR  
Sbjct: 73  ALRWLGLDWAEGPDVGGPHGPYRQSERGDIYGQYAMQLVENGHAFYAFETPEELDAMRDE 132

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q+   +P +YDG  L L+ +EI+        +V+R+ +P +G+CVFQD + G++EI W  
Sbjct: 133 QKANGLPQKYDGRALNLTQEEIQAKLDAGVPYVIRMKIPEEGTCVFQDMLRGQIEIDWAQ 192

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           VDMQVLLK+DGMPTYHLANV+DDHLMKITHV RGEEWI+S PKHILLYQYF + +P   H
Sbjct: 193 VDMQVLLKADGMPTYHLANVVDDHLMKITHVIRGEEWINSAPKHILLYQYFGWDMPTLCH 252

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +PL++NPDKSKLSKR+NPTSI YY  MGYLPEA++N+L  +     ++ ++   + ++I 
Sbjct: 253 MPLLRNPDKSKLSKRKNPTSILYYQRMGYLPEAVVNYLGRMGWSMPDEREK-FSLDEMIE 311

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSR 363
           +FD+  +S  G VFD +KL WLNG W+RE L+   F  + ++W  + + +   L L   R
Sbjct: 312 NFDIQRVSLGGPVFDVEKLSWLNGVWMREDLTPENFAQKYAEWAFQPEYINAILPLVIPR 371

Query: 364 ITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIET 423
           + T S +  +    FK  L +T + F++  +  E +   ++    + E ++ W+++NI  
Sbjct: 372 VETFSDVADVAGLFFKGMLPITEQDFENVKIEREALRKAMQFALWKLEALRSWEKQNIFD 431

Query: 424 ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLV 483
            ++ +AQ  +  LK    P+F+AI GS  S+ +FDS+ ILG  +   R R A+ ++    
Sbjct: 432 TIKELAQTMDIKLKDFNAPIFIAIAGSTASVSVFDSMAILGPDITRARFRKAVTVLGGPS 491

Query: 484 QNHKKKELK 492
           +   K+  K
Sbjct: 492 KKEMKRWEK 500


>gi|229591635|ref|YP_002873754.1| glutamyl-tRNA synthetase [Pseudomonas fluorescens SBW25]
 gi|229363501|emb|CAY50735.1| putative glutamyl-tRNA synthetase [Pseudomonas fluorescens SBW25]
          Length = 493

 Score =  396 bits (1018), Expect = e-108,   Method: Composition-based stats.
 Identities = 218/491 (44%), Positives = 327/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IY+ Y Q L++   AF CFC+ E L++MR
Sbjct: 59  FDALRWLGITWAEGPDVGGPHGPYRQSERSDIYKQYTQQLVDMGHAFPCFCTAEELDQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ R    RYDG  L LS +E+ +     + HV+R+ VP++G CV  D + G++EIPW
Sbjct: 119 AEQQARGETPRYDGRALLLSKEEVAQRLAAGEPHVIRMKVPSEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SRV QW    + + +   L Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRVQQWALNPEYMMKIAPLVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   ++   + F+S  L  +++  +++    + E ++ W+++ I
Sbjct: 357 GRVETFSQVAPLASFFFAGGVNPDPKLFESKKLSGDQVRQLMQLILWKLESLRQWEKDAI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 TATIQAVVESLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|260892428|ref|YP_003238525.1| glutamyl-tRNA synthetase [Ammonifex degensii KC4]
 gi|260864569|gb|ACX51675.1| glutamyl-tRNA synthetase [Ammonifex degensii KC4]
          Length = 494

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 180/485 (37%), Positives = 268/485 (55%), Gaps = 14/485 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  HIG A TALFNYL A+  GGKF+LR+EDTD +R   E+E  ++++L+
Sbjct: 7   VRVRFAPSPTGSLHIGGARTALFNYLFARSRGGKFVLRLEDTDFERHQEEAEANILENLR 66

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEGPD GG YGPYRQSER  +Y+   + LLE  LA+ C+C+ E L   R   R+
Sbjct: 67  WLGLEWDEGPDCGGPYGPYRQSERLELYRQEARRLLEAGLAYPCYCTPEELAAERERMRR 126

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RY G C  L+ +E   L  +  K  +RL VP +G  V  D + GE+    +A+D 
Sbjct: 127 EGKVPRYSGRCRNLTPEERAELEAKGIKPALRLRVPAEGQIVVNDLLRGEVVFDCSALDD 186

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +++KS G+PTY+ A V+DD  MKI+HV R EE +S+ PK +L+YQ   +  P F H+P+
Sbjct: 187 FIIMKSSGVPTYNFACVVDDAHMKISHVIRAEEHLSNTPKQLLVYQALGYEPPAFAHVPM 246

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD+SKLSKR   T +  + A G++PEAL+N+LALL     ++ + +   ++LI  F 
Sbjct: 247 ILAPDRSKLSKRHGATGVEEFRANGFVPEALLNYLALLGWSPGDEQE-IFSKEELIARFS 305

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK-----------EKDRLTQ 355
           L  +SK  AV+D QKL W N +++   L           + +           E+D + +
Sbjct: 306 LEAVSKHAAVYDIQKLTWFNSQYLNL-LPLERLYELALPFFREAGLGEEVEKAERDYVLR 364

Query: 356 ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
            L   +SR  TL  L  M+ + F+ D     +        P  + ++L+  +E    +  
Sbjct: 365 VLAAVRSRARTLVELVDMSSYFFRDDFAYDPKGVDKFFRRP-GVAELLREGREILARLPS 423

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA 475
           +   ++E A R + + +      ++ P  LA+TG      LF+ + +LG+     RL  A
Sbjct: 424 FDEASVEAAYRRLIEEKGIKGGDLIHPTRLALTGRTVGPGLFEIMALLGKERCLARLERA 483

Query: 476 IALVS 480
              + 
Sbjct: 484 ARWIE 488


>gi|289627847|ref|ZP_06460801.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289650797|ref|ZP_06482140.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330869808|gb|EGH04517.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 493

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 222/491 (45%), Positives = 325/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IYQ Y Q L+E   AF CFC+ E L+EMR
Sbjct: 59  FDALRWLGIEWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVELGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SR+  W    D + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRLKTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L PE++  +++    + E ++ W+++ I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKDRI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGCIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|330810808|ref|YP_004355270.1| glutamate--tRNA ligase (glutamyl-tRNA synthetase) [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327378916|gb|AEA70266.1| Glutamate--tRNA ligase (glutamyl-tRNA synthetase) [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 493

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 219/491 (44%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G++W EGPD+GG +GPYRQSER +IY+ Y Q L++   AF CFC+ E L++MR
Sbjct: 59  FDALRWLGIDWSEGPDVGGPHGPYRQSERGDIYKQYCQQLVDMGHAFPCFCTAEELDQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDG  L LS +E+ R     + HV+R+ VP +G CV  D + G++EIPW
Sbjct: 119 AEQMARGETPRYDGRALLLSKEEVARRLAAGEPHVIRMKVPTEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+R+ L   EF +RV +W    + + +     Q
Sbjct: 298 VEHFDLSRVSLGGPIFDVEKLSWLNGQWLRD-LPVEEFAARVQKWALNPEYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +   A+ F+S  L  +++  +++    + E ++ W++++I
Sbjct: 357 GRVETFSQIAPLAGFFFAGGVTPDAKLFESKKLSGDQVRQLMQLILWKLESLRQWEKDSI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  FRLR AI L+  
Sbjct: 417 TATIQAVVESLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRQAIDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|320324864|gb|EFW80936.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320329229|gb|EFW85226.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 493

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 221/491 (45%), Positives = 325/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IYQ Y Q L+E   AF CFC+ E L+EMR
Sbjct: 59  FDALRWLGIEWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVELGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SR+  W    D + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRLKTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L PE++  +++    + E ++ W+++ I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKDRI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H +  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGCIQAVVEHLKLKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|257485512|ref|ZP_05639553.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|330987409|gb|EGH85512.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331010688|gb|EGH90744.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 493

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 221/491 (45%), Positives = 325/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IYQ Y Q L+E   AF CFC+ E L+EMR
Sbjct: 59  FDALRWLGIEWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVELGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SR+  W    + + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRLKTWALNPEYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L PE++  +++    + E ++ W+++ I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKDRI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGCIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|92113337|ref|YP_573265.1| glutamyl-tRNA synthetase [Chromohalobacter salexigens DSM 3043]
 gi|123265742|sp|Q1QY92|SYE_CHRSD RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|91796427|gb|ABE58566.1| glutamyl-tRNA synthetase [Chromohalobacter salexigens DSM 3043]
          Length = 494

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 222/486 (45%), Positives = 316/486 (65%), Gaps = 1/486 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  ++ SL+
Sbjct: 3   VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDRVRSTAESEQMILDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEGPD+GG +GPYRQSER +IY  Y Q LL+   AF+C+ ++E L+E+R A++ 
Sbjct: 63  WLGLEWDEGPDVGGPHGPYRQSERGDIYAQYAQQLLDAGHAFKCYRTSEELDELREARKA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
             +        L L   E+ R  +EQ  +VVR+ VP +GSCV  D + GE+E+ W  VD 
Sbjct: 123 AGLHLALKPADLALPDDEVARREREQWPYVVRMKVPGEGSCVVSDMLRGEIEVDWAQVDA 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           Q+LLKSDGMPTYHLANV+DDHLM ITHV RGEEWI+S PKH LLY+YF++P+P   H+PL
Sbjct: 183 QILLKSDGMPTYHLANVVDDHLMGITHVMRGEEWINSAPKHKLLYEYFDWPMPTLCHMPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  MG+LP+A+ N+L  +     +D ++   +++++ +FD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYRRMGFLPQAVTNYLGRMGWSMPDDREK-FTLEEMMANFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD +KL WLNG +IRE L     L  + +W      + Q L   + RI+T
Sbjct: 302 IQRVSLGGPVFDLEKLTWLNGVYIREDLDDAALLQALREWAFNDAYVNQILPQVRPRIST 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS +  +    F     L A SF    L  E ++ +L+      E +  W+++ +   ++
Sbjct: 362 LSDVMPLAGHFFSGVPPLEASSFDGIKLEHETLLKLLQFLTWRLEGVSRWEKDVLLDDVK 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            +A+  +  +K  + P+F+A+TGS  S  + D++ ILG  +   RLRHAI ++  + +  
Sbjct: 422 ALAEAFDMKMKAFLAPVFIAVTGSATSTSVLDAMAILGSDMTRARLRHAIEVLGGVSKKQ 481

Query: 487 KKKELK 492
            K+  K
Sbjct: 482 AKRFEK 487


>gi|220934751|ref|YP_002513650.1| glutamyl-tRNA synthetase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996061|gb|ACL72663.1| glutamyl-tRNA synthetase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 470

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/486 (31%), Positives = 251/486 (51%), Gaps = 28/486 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  HIG A TALF++L A++ GG FILR+EDTD  RS  ES NA+++ +
Sbjct: 2   KVRTRFAPSPTGYLHIGGARTALFSWLYARKHGGDFILRVEDTDLARSNAESVNAILEGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W GL +DEG        P+ Q++R + Y+  +Q LL+   A+ C+C+ E L+ MR  Q 
Sbjct: 62  SWLGLEYDEG--------PFYQTQRFDRYKEVIQQLLDADKAYHCYCTKEELDAMREQQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYDG C   +        +E  + VVR   P +G+ V  D V G +    + +D
Sbjct: 114 ANKEKPRYDGRCRHRTE------PREGVEPVVRFRNPTEGATVVDDMVRGRVVFQNSELD 167

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ +SDG PTY+   V+DD  M+I+HV RG++ +++ P+ I +++      P + HLP
Sbjct: 168 DLIIARSDGSPTYNFTVVVDDWDMQISHVIRGDDHLNNTPRQINIFKALGVEPPRYAHLP 227

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I  PD +KLSKR    S+  Y   G+LP+AL+N+L  L       D E+  + +LI  F
Sbjct: 228 MILGPDGAKLSKRHGAVSVMQYRDDGFLPQALLNYLVRLGWS--HGDQEVFSLDELIELF 285

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALT------- 358
           D+ +++ + +  +  KL WLN  +I+   S  + ++R   W      +  +L        
Sbjct: 286 DIANVNHSASAINPDKLLWLNQHYIKT--SDPDHVARHLSWHMGNHGIDPSLPPPLRDVV 343

Query: 359 -LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
                R  TL  +   + + ++       ++ K       E   +L+  +   + +  W+
Sbjct: 344 VAQCERAKTLVEMAANSVYFYRDFEDYDEKAAKKN--LDAEAKPVLQALRAALDAVSDWQ 401

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E I  A+  VA+  E  L  + +PL +A++G   S P+  ++ +LGR     R+  AI 
Sbjct: 402 PEAIHAAVEGVAERLELKLGKVAQPLRVAVSGGGVSPPIDQTLALLGRERTLGRIERAID 461

Query: 478 LVSSLV 483
            + +  
Sbjct: 462 YIEARS 467


>gi|330888120|gb|EGH20781.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 485

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 221/488 (45%), Positives = 324/488 (66%), Gaps = 4/488 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IYQ Y Q L+E   AF CFC+ E L+EMR
Sbjct: 59  FDALRWLGIEWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVELGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SR+  W    D + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRLKTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L PE++  +++    + E ++ W+++ I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKDRI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGCIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKK 489
           + +   K+
Sbjct: 477 VSKKENKE 484


>gi|325275794|ref|ZP_08141663.1| glutamyl-tRNA synthetase [Pseudomonas sp. TJI-51]
 gi|324099065|gb|EGB97042.1| glutamyl-tRNA synthetase [Pseudomonas sp. TJI-51]
          Length = 493

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 219/491 (44%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W+EGPD+GG +GPYRQSER  IY  Y + L++   AF CFC+ E LE+MR
Sbjct: 59  FDALRWLGIEWNEGPDVGGPHGPYRQSERGEIYAQYAKQLVDAGHAFYCFCTAEELEQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ R    RYDG  L LS +E++R     + HV+R+ VP++G CV  D + G++EIPW
Sbjct: 119 AEQQARGETPRYDGRALLLSDEEVQRRLAAGEPHVIRMKVPSEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKNDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPKL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF +R+ +W    D + +     Q
Sbjct: 298 VEHFDLSRISLGGPIFDIEKLSWLNGQWLRE-LPVEEFAARLQKWAFNSDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F+  L L A+ F+S  L  +++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLGGFFFEGALKLDAKLFESKKLSADQVRQVIQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVVEALELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRYRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|304316612|ref|YP_003851757.1| glutamyl-tRNA synthetase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778114|gb|ADL68673.1| glutamyl-tRNA synthetase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 480

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 174/488 (35%), Positives = 270/488 (55%), Gaps = 20/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  HIG A TALFN+L A+   GK ILR++DTD +RST +S  A++  LK
Sbjct: 4   VRVRFAPSPTGNLHIGGARTALFNWLFARHNNGKMILRVDDTDLERSTGDSMKAIIDGLK 63

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G++WDEG        P  QS+R ++Y+ Y   L+++  A+ CFC+ E L+EMR+  +K
Sbjct: 64  WLGIDWDEG--------PIYQSKRLDLYKNYADKLVKEGKAYYCFCTKEELDEMRKEAQK 115

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
              P  Y G C  L + E+++   E KK+VVRL VP +G     D + G++E   +  D 
Sbjct: 116 AGKPPMYSGKCRNLPADEVKKYMDEGKKYVVRLKVPKEGKTTVHDIIRGDVEFDNSTFDD 175

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +++KSD MPTY+ A VIDD+ +KI+H+ RGEE +S+ PK IL+Y    F  P F H+ +
Sbjct: 176 FIIMKSDNMPTYNFATVIDDYDLKISHIIRGEEHLSNTPKQILIYDALGFEKPSFAHVSM 235

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD+SKLSKR   TS+  +  +GYLPEA+IN++ LL      D +E+   ++ I  F 
Sbjct: 236 ILAPDRSKLSKRHGATSVQEFRDLGYLPEAIINYITLLG-WIPSDGEEVFSTEKSISEFT 294

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLTQAL 357
           L  +SK  A++D +KL WLNG +IR+          V  +           + D + + +
Sbjct: 295 LDRVSKNPAIYDTKKLTWLNGIYIRD-CDIDRLTKEVIPFLINKGLIGDNYDYDYIKKVV 353

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
           +  + R  TL+ + +   + F  +     +  K      + + +ILK   E  + +  + 
Sbjct: 354 SAVREREKTLNEIAEAMSYYFNDEFDYDEKGVKK-YFEKDGVDNILKEAIEVLDKVDDFN 412

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
               E A R++ +  +     +  P  LAI+G  +   LFD +E+LG+     R++ AI 
Sbjct: 413 LVETEKAYRDLIEKLDIKSGDLFHPTRLAISGKTFGPGLFDIMELLGKKKTIERIKKAIK 472

Query: 478 LVSSLVQN 485
            + ++   
Sbjct: 473 YIENIKGK 480


>gi|213970441|ref|ZP_03398569.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. tomato T1]
 gi|301385867|ref|ZP_07234285.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. tomato Max13]
 gi|302063921|ref|ZP_07255462.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. tomato K40]
 gi|302134972|ref|ZP_07260962.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213924759|gb|EEB58326.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. tomato T1]
          Length = 493

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 222/491 (45%), Positives = 325/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IYQ Y Q L+E   AF CFC+ E L+EMR
Sbjct: 59  FDALRWLGIEWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVELGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIQLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF SR+  W    + + +     Q
Sbjct: 298 VDHFDLSRVSLGGPIFDIEKLSWLNGQWLRE-LPVEEFASRLQTWALNPEYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L P+++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPDQVRQVMQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
             +++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGSIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|330968329|gb|EGH68589.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 493

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 224/491 (45%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IYQ Y Q L+E   AF CFC+ E L+EMR
Sbjct: 59  FDALRWLGIEWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVELGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF SR+  W    D + +     Q
Sbjct: 298 VDHFDLSRVSLGGPIFDIEKLSWLNGQWLRE-LPVEEFASRLQTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L P+++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPDQVRQVMQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
             +++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGSIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|302189259|ref|ZP_07265932.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. syringae 642]
          Length = 493

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 219/491 (44%), Positives = 324/491 (65%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G++W EGPD+GG +G YRQSER +IY+ Y Q L++   AF CFC+ E L+ MR
Sbjct: 59  FDALRWLGIDWSEGPDVGGPHGTYRQSERGDIYKKYAQQLVDMGHAFPCFCTAEELDAMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SR+  W    D + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRLKTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L PE++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVIQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGCIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|313902762|ref|ZP_07836159.1| glutamyl-tRNA synthetase [Thermaerobacter subterraneus DSM 13965]
 gi|313466882|gb|EFR62399.1| glutamyl-tRNA synthetase [Thermaerobacter subterraneus DSM 13965]
          Length = 507

 Score =  394 bits (1013), Expect = e-107,   Method: Composition-based stats.
 Identities = 175/488 (35%), Positives = 267/488 (54%), Gaps = 13/488 (2%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S  VRVR APSPTG  HIG   T LFN+L A++ GG+F+LR EDTD +RS  E    ++
Sbjct: 1   MSQPVRVRYAPSPTGYLHIGGVRTILFNWLFARKHGGRFVLRFEDTDPERSRDELIEPML 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +S++W GL+WDEGPD+GG YGPYRQS+R ++Y+  +  LL +  A+ C+C+ E L   R 
Sbjct: 61  ESIRWLGLDWDEGPDVGGPYGPYRQSQRLDLYRQELDRLLAEGKAYYCYCTPEELNAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           A R    P+ Y G C  L+  +   L  E ++  VRL VP+QG    +D V GE+     
Sbjct: 121 AARAAGRPAVYSGRCRHLTEAQRRELEAEGRRPAVRLRVPDQGLVTVRDLVKGEVAFDVA 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
                ++ ++DGMP Y+ A V+DDH M I+HV RG+E +S+ PK +L+YQ   +  P+F 
Sbjct: 181 QFGDFIIARADGMPVYNFAVVVDDHHMAISHVIRGDEHLSNTPKQLLVYQALGWEPPQFA 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+P+I  PD+SKLSKR    ++  Y   G+LPEA++N++ALL     +D + ++ + ++I
Sbjct: 241 HVPMILAPDRSKLSKRHGAVAVDEYRRQGFLPEAILNYVALLGWSPGDDRE-ILSLDEMI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKEKD 351
             FDL  +S   A++D +K+ W+NG ++RE          +               +E+ 
Sbjct: 300 QLFDLDRVSHTAAIYDVEKMAWMNGHYLREADLDRVVELALPRLQAAGLLDAPPQGEERR 359

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
           RL   L   + R+ TL  L + + + F           +      ++ I IL+   E   
Sbjct: 360 RLRAILDAVRQRVRTLDELVEASRYFFTDVEGYDEAGVRKH-FDRDDAIPILEAVAETLA 418

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            ++ W +  IE ALR +A+        I  P  LA++G      +FD I  +GR     R
Sbjct: 419 RVEPWTQAAIEQALRGLAERLGVGTGRIFHPTRLAVSGRTVGPGVFDVICWVGRERCLER 478

Query: 472 LRHAIALV 479
           +R AI  +
Sbjct: 479 IRRAIGWI 486


>gi|330959089|gb|EGH59349.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 493

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 222/491 (45%), Positives = 325/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G++W EGPD+GG +GPYRQSER +IYQ Y Q L+E   AF CFC+ E L+EMR
Sbjct: 59  FDALRWLGIDWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVELGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF SR+  W    + + +      
Sbjct: 298 VDHFDLSRVSLGGPIFDIEKLSWLNGQWLRE-LPVEEFASRLQTWALNPEYMMKIAPHVH 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L P+++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPDQVRQVMQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGCIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|28869369|ref|NP_791988.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|37999389|sp|Q884C8|SYE_PSESM RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|28852610|gb|AAO55683.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|330875739|gb|EGH09888.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 493

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 223/491 (45%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IYQ Y Q L+E   AF CFC+ E L+EMR
Sbjct: 59  FDALRWLGIEWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVELGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF SR+  W    + + +     Q
Sbjct: 298 VDHFDLSRVSLGGPIFDIEKLSWLNGQWLRE-LPVEEFASRLQTWALNPEYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L P+++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPDQVRQVMQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
             +++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGSIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|26988703|ref|NP_744128.1| glutamyl-tRNA synthetase [Pseudomonas putida KT2440]
 gi|37999408|sp|Q88LF6|SYE_PSEPK RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|24983491|gb|AAN67592.1|AE016388_12 glutamyl-tRNA synthetase [Pseudomonas putida KT2440]
 gi|313499915|gb|ADR61281.1| GltX [Pseudomonas putida BIRD-1]
          Length = 493

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 218/491 (44%), Positives = 327/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W+EGPD+GG +GPYRQSER  IY  Y + L++   AF CFC+ E LE+MR
Sbjct: 59  FDALRWLGIEWNEGPDVGGPHGPYRQSERGEIYAKYAKELVDAGHAFYCFCTAEELEQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ R    RYDG  L +S++E++R     + HV+R+ VP++G CV  D + G++EIPW
Sbjct: 119 AEQQARGETPRYDGRALLMSAEEVQRRLDAGEPHVIRMKVPSEGICVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKNDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPKL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF +R+ +W    D + +     Q
Sbjct: 298 VEHFDLSRISLGGPIFDIEKLSWLNGQWLRE-LPVEEFAARLQKWAFNSDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F+  L L A+ F+S  L  +++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLGGFFFEGALKLDAKLFESKKLSADQVRQVIQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVVEALELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRYRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|167032518|ref|YP_001667749.1| glutamyl-tRNA synthetase [Pseudomonas putida GB-1]
 gi|189082161|sp|B0KF73|SYE_PSEPG RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|166859006|gb|ABY97413.1| glutamyl-tRNA synthetase [Pseudomonas putida GB-1]
          Length = 493

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 219/491 (44%), Positives = 328/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W+EGPD+GG +GPYRQSER +IY  Y + L++   AF CFC+ E LE+MR
Sbjct: 59  FDALRWLGIEWNEGPDVGGPHGPYRQSERGDIYAKYAKELVDAGHAFYCFCTAEELEQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ R    RYDG  L LS++E++R     + HV+R+ VP++G CV  D + G++EIPW
Sbjct: 119 AEQQARGETPRYDGRALLLSAEEVQRRLDAGEPHVIRMKVPSEGICVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKNDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPKL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF +R+ +W    D + +     Q
Sbjct: 298 VEHFDLSRISLGGPIFDIEKLSWLNGQWLRE-LPVEEFATRLQKWAFNSDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F+  L L A+ F+S  L  +++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLGGFFFEGALKLDAKLFESKKLSADQVRQVIQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVVEALELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRYRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|225851438|ref|YP_002731672.1| glutamyl-tRNA synthetase [Persephonella marina EX-H1]
 gi|225644923|gb|ACO03109.1| glutamyl-tRNA synthetase [Persephonella marina EX-H1]
          Length = 478

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 183/480 (38%), Positives = 270/480 (56%), Gaps = 9/480 (1%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  H+G A TALFNY+ A+ TGGK ILRIEDTD +RS  E E+ ++  LK
Sbjct: 2   VRVRFAPSPTGYLHLGNARTALFNYIYARHTGGKLILRIEDTDRERSKKEYEDLLIDDLK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEGPDIGG YGPYRQSER +IY  YV+ L E    ++CFCS E LEE R+    
Sbjct: 62  WLGIEWDEGPDIGGDYGPYRQSERTDIYNQYVEKLKESGHIYKCFCSPEELEEERKKALS 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
              P RY G C  L+  +I++L  E K +V R  VP+    +F+D + G +EI  +    
Sbjct: 122 EGRPPRYSGKCRNLTEDQIKKLESEGKPYVWRFRVPDGEFIIFEDVIKGTVEINVDEFGD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            V+++SDG P Y+   V+DD LMKIT V RGE+ +S+ PK IL+Y+   F  P F HLP+
Sbjct: 182 FVIVRSDGSPVYNFVVVVDDALMKITDVIRGEDHLSNTPKQILIYRALGFEEPRFAHLPI 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D+SKLSKR    S+  +   GY+ EA+ N L+LL  H   D++ ++  +++I  FD
Sbjct: 242 ILGEDRSKLSKRHGAVSVRAFRDDGYVSEAMFNGLSLLGWHPKGDNE-VLSKEEIIREFD 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------EKDRLTQALTLA 360
           +  +  A AVFD+ KL WLNG +IREK+   +   R   + +      + D   + +   
Sbjct: 301 IKDIHNAPAVFDRAKLRWLNGVYIREKIDLDDLTERAVPFFEGFGYKADFDYYRKVMEAI 360

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
           +  + TL  + Q     F  D H   ++     L  E    +++   E+ + +   K+E+
Sbjct: 361 RDSLETLMDIEQRAKPFFVDDFHYEEDA--QQFLKDETGYRVVQLFYEKVKDMDEIKKED 418

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
            +   + + +      K +  P+ +A+TG    + +   +E++G   V  RL+ A+    
Sbjct: 419 FKRITKEIQKELGVKGKNLFMPIRVALTGVTSGVDMAVLVEVIGVERVKHRLQRALEYFG 478


>gi|311070739|ref|YP_003975662.1| glutamyl-tRNA synthetase [Bacillus atrophaeus 1942]
 gi|310871256|gb|ADP34731.1| glutamyl-tRNA synthetase [Bacillus atrophaeus 1942]
          Length = 483

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 186/487 (38%), Positives = 283/487 (58%), Gaps = 18/487 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+R+EDTD KR+    E + +
Sbjct: 1   MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDQKRNIEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW G++WDE  D+GG YGPYRQSER +IY+ Y + LLEK LA++CFC+ E LE+ R 
Sbjct: 61  NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYRVYYEELLEKGLAYKCFCTEEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ +E ++   E +K  +R  VP      F D V GE+    +
Sbjct: 121 EQIARGEMPRYSGKHRNLTQEEQDQFLAEGRKPSIRFRVPEGKIIAFNDIVKGEISFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  +DD+LMK+THV RGE+ IS+ PK I++YQ F + IP F 
Sbjct: 181 GIGDFVIVKKDGTPTYNFAVAVDDYLMKMTHVLRGEDHISNTPKQIMIYQAFGWDIPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ LL       ++EL   +Q
Sbjct: 241 HMTLIVNESRKKLSKRDESIIQFIEQYKDLGYLPEALFNFIGLLGWS-PVGEEELFTKEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MK 348
            I  FD++ LSK+ A+FD  KL W+N ++++E L   + +                   +
Sbjct: 300 FIEIFDVNRLSKSPALFDMHKLKWVNNQYVKE-LDLEQVVELTLPHLQKAGKVGTELSPE 358

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           +++ + + ++L   +++  + + ++TD  FK D+    E+   T L  E++ ++L     
Sbjct: 359 QQEWIRKLISLYHEQLSFGAEIVELTDLFFKEDIEYNQEA--KTVLDEEQVPEVLSVFAA 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E ++ +  ++I+ +++ V +      K +  P+ +A+TG  +   L  SIE++GR  V
Sbjct: 417 KLEELEEFTPDHIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGRETV 476

Query: 469 YFRLRHA 475
             RL++A
Sbjct: 477 IKRLKNA 483


>gi|88799982|ref|ZP_01115553.1| glutamyl-tRNA synthetase [Reinekea sp. MED297]
 gi|88777260|gb|EAR08464.1| glutamyl-tRNA synthetase [Reinekea sp. MED297]
          Length = 498

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 228/475 (48%), Positives = 325/475 (68%), Gaps = 1/475 (0%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            SK+R RIAPSPTG+PH+GTAY ALFN + A+  GG+FILRIEDTD  RST ESE A++ 
Sbjct: 1   MSKIRTRIAPSPTGDPHVGTAYIALFNKVFAESQGGEFILRIEDTDQARSTAESEQAILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           SL+W GLNW EGPD+GG +GPYRQSER++IYQ Y Q L+++  AF CFC+ ERL+E+R  
Sbjct: 61  SLRWLGLNWVEGPDVGGPHGPYRQSERRDIYQKYAQQLIDQGHAFHCFCTAERLDEVREQ 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           QR       YDGHC+ L   ++ +     ++HVVR+ VP +G C   D++   +EI W  
Sbjct: 121 QRAAGEDIGYDGHCMHLDPSDVAKRIAAGEEHVVRMKVPQEGVCTIHDELRDTVEIDWKQ 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +DMQVL+KSDG+PTYHLA+V+DDHLM+I+H+ RGEEWISS PK I LYQYF + +P ++H
Sbjct: 181 IDMQVLMKSDGLPTYHLASVVDDHLMEISHIMRGEEWISSTPKQIALYQYFGWDVPTYVH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           LPL++N DKSKLSKR+NPTS++YY  +G LPEAL+NFL ++     +  +E+  ++Q+  
Sbjct: 241 LPLLRNADKSKLSKRKNPTSVTYYRELGILPEALLNFLGMMGWTMPDG-EEVFSLEQMKA 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSR 363
            F +  +S  G VFD++KL+WLNG+++RE  +  + L R+  W    +  TQ + LAQ+R
Sbjct: 300 KFSVERISLGGPVFDQEKLNWLNGKYLREHHTPEQLLQRLVDWKFNAEFATQLMPLAQTR 359

Query: 364 ITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIET 423
             TL  +  +  F F+  L +T +SF S  L  EE+  +L+    + E  + W+++NI  
Sbjct: 360 AETLGDIAPLLAFFFQGTLAITEDSFASVKLETEELKQVLQLILWKLETQRHWEKDNIFA 419

Query: 424 ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
            ++ +A  +E   K I  PLF+AITGS  S+ + D++ ILG  +   R+R+AI +
Sbjct: 420 DIKAIADFKELKFKDINAPLFIAITGSTASVSVMDAMAILGPDITRGRIRYAINV 474


>gi|87121496|ref|ZP_01077385.1| glutamyl-tRNA synthetase [Marinomonas sp. MED121]
 gi|86163339|gb|EAQ64615.1| glutamyl-tRNA synthetase [Marinomonas sp. MED121]
          Length = 493

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 234/489 (47%), Positives = 314/489 (64%), Gaps = 1/489 (0%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S++R RIAPSPTG+PH+GTAY ALFN   A++ GGKFILRIEDTD  RST ESE  ++ 
Sbjct: 1   MSEIRTRIAPSPTGDPHVGTAYIALFNMAFARKMGGKFILRIEDTDQTRSTPESEKMILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L+W GL+W EGPD+GG YGPYRQSER +IY  Y + L++K  AF  F + E L++MR  
Sbjct: 61  ALRWLGLDWAEGPDVGGEYGPYRQSERGDIYTEYAKELVQKGHAFYAFETAEELDQMRNE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           QR+  +  +YDG  L LS  E++        +V+R+ +P +G C  QD + GE+EI W  
Sbjct: 121 QRENGLQPKYDGRALNLSDAEVQAKLDAGVPYVIRMKIPEEGICRVQDMLRGEIEIDWAQ 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           VDMQVLLK+DGMPTYHLANV+DDHLMKITHV RGEEWI+S PKHILLYQYF + +P   H
Sbjct: 181 VDMQVLLKADGMPTYHLANVVDDHLMKITHVIRGEEWINSAPKHILLYQYFGWDMPTLCH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +PL++NPDKSKLSKR+NPTSI YY  MGYL EA++N+L  +     ++ ++   +  +I 
Sbjct: 241 MPLLRNPDKSKLSKRKNPTSILYYQRMGYLAEAVVNYLGRMGWSMPDEREK-FSLDDMIE 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSR 363
           HFD+  +S  G VFD +KL WLNG WIRE L+   F  +  +W    + L Q L L   R
Sbjct: 300 HFDIQRVSLGGPVFDVEKLSWLNGLWIREDLNPQAFAQKFQEWALNPEYLMQILPLITPR 359

Query: 364 ITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIET 423
           I   S +  +  F  K  L + A SF    L  E +   L+    + E +  W+++ I  
Sbjct: 360 IEKFSDVADVAGFFLKGHLDIHASSFDGLKLEDETLRKALQFATWKLESLSKWEKDEIFN 419

Query: 424 ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLV 483
           A++++AQ  E   K    PLF+AI G+  S+ +FDS+ ILG  +   RLR A+  V S  
Sbjct: 420 AMKSLAQTMEIKPKDFFAPLFVAIAGTTSSVSVFDSMAILGPDISRARLRAAVNAVGSPS 479

Query: 484 QNHKKKELK 492
           +   K+  K
Sbjct: 480 KKEGKRWEK 488


>gi|148548989|ref|YP_001269091.1| glutamyl-tRNA synthetase [Pseudomonas putida F1]
 gi|166226847|sp|A5W6Z7|SYE_PSEP1 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|148513047|gb|ABQ79907.1| glutamyl-tRNA synthetase [Pseudomonas putida F1]
          Length = 493

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 219/491 (44%), Positives = 327/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W+EGPD+GG +GPYRQSER  IY  Y + L++   AF CFC+ E LE+MR
Sbjct: 59  FDALRWLGIEWNEGPDVGGPHGPYRQSERGEIYAKYAKELVDAGHAFYCFCTAEELEQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ R    RYDG  L LS++E++R     + HV+R+ VP++G CV  D + G++EIPW
Sbjct: 119 AEQQARGETPRYDGRALLLSAEEVQRRLDAGEPHVIRMKVPSEGICVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKNDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPKL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF +R+ +W    D + +     Q
Sbjct: 298 VEHFDLSRISLGGPIFDIEKLSWLNGQWLRE-LPVEEFAARLQKWAFNSDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F+  L L A+ F+S  L  +++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLGGFFFEGALKLDAKLFESKKLSADQVRQVIQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVVEALELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRYRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|52078587|ref|YP_077378.1| glutamyl-tRNA synthetase [Bacillus licheniformis ATCC 14580]
 gi|52783948|ref|YP_089777.1| glutamyl-tRNA synthetase [Bacillus licheniformis ATCC 14580]
 gi|319649139|ref|ZP_08003347.1| glutamyl-tRNA synthetase [Bacillus sp. BT1B_CT2]
 gi|67461714|sp|Q65PD0|SYE_BACLD RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|52001798|gb|AAU21740.1| glutamyl-tRNA synthetase [Bacillus licheniformis ATCC 14580]
 gi|52346450|gb|AAU39084.1| GltX [Bacillus licheniformis ATCC 14580]
 gi|317388839|gb|EFV69658.1| glutamyl-tRNA synthetase [Bacillus sp. BT1B_CT2]
          Length = 485

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 187/488 (38%), Positives = 283/488 (57%), Gaps = 18/488 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+RIEDTD KR+    E + +
Sbjct: 1   MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDRKRNIEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW G++WDE  D+GG YGPYRQSER +IY+ Y + LLEK LA++C+C+ E LE+ R 
Sbjct: 61  NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKTYYEELLEKGLAYKCYCTEEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G C  L+ +E E+L  E ++  +R  VP      F D V GE+    +
Sbjct: 121 EQAARGEMPRYSGKCRNLTKEEQEKLEAEGRQPSIRFKVPQGEVIRFDDIVKGEISFETD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  +DD+LMK+THV RGE+ IS+ PK I++Y    + IP F 
Sbjct: 181 GIGDFVIVKKDGTPTYNFAVAVDDYLMKMTHVLRGEDHISNTPKQIMIYNALGWDIPAFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ LL       ++EL   +Q
Sbjct: 241 HMTLIVNESRKKLSKRDESIIQFIEQYEELGYLPEALFNFITLLGWS-PVGEEELFTKEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
            I  FD++ LSK+ AVFD  KL W+N +++++ L   + +      +++           
Sbjct: 300 FIEIFDVNRLSKSPAVFDTHKLKWVNNQYVKK-LDLDQVIELTVPHLQKAGKVSEELSGS 358

Query: 350 -KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
            ++ + + ++L Q +++  + + ++T+  FK D+    E+   T L  E++ ++L+   E
Sbjct: 359 EQEWVRKLISLYQEQLSYGAEIVELTELFFKDDIQYNREA--RTVLEEEQVPEVLRVFAE 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E +  +  + I+ +++ V +      K +  P+ +A TG  +   L  SIE+LG+  V
Sbjct: 417 KLEQLDSFTADEIKASIKAVQKETGHKGKKLFMPIRVATTGQTHGPELPQSIELLGKDTV 476

Query: 469 YFRLRHAI 476
             RL + I
Sbjct: 477 LKRLHNII 484


>gi|307545709|ref|YP_003898188.1| glutamyl-tRNA synthetase [Halomonas elongata DSM 2581]
 gi|307217733|emb|CBV43003.1| glutamyl-tRNA synthetase [Halomonas elongata DSM 2581]
          Length = 492

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 222/486 (45%), Positives = 311/486 (63%), Gaps = 1/486 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  ++ SL+
Sbjct: 3   VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDRLRSTAESEQMILDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEGPD+GG +GPYRQSER +IY  Y + LL+   AF+C+ ++E L+ +R  ++ 
Sbjct: 63  WLGLEWDEGPDVGGPHGPYRQSERGDIYVEYARQLLDAGHAFKCYRTSEELDALRDERKA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                      L L   E+ R  +E   HVVR+ VP  G+CV +D + G +E+ W  VD 
Sbjct: 123 AGQHLALKPDDLALPEAEVARREREGWPHVVRMKVPADGTCVVEDMLRGTIEVDWAQVDA 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           Q+LLKSDGMPTYHLANV+DDHLM ITHV RGEEWI+S PKH LLY+YF +P+P   H+PL
Sbjct: 183 QILLKSDGMPTYHLANVVDDHLMGITHVLRGEEWINSAPKHQLLYEYFGWPMPSLCHMPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  MG+LP+A+ N+L  +     ++ ++   + +++ HFD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYRRMGFLPQAVANYLGRMGWSMPDEREK-FTLDEMMAHFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD QKL WLNG +IRE L     L  + +W   +D + Q L   + R+ T
Sbjct: 302 IQRVSLGGPVFDLQKLTWLNGLYIREDLDDDALLEALKEWAFNEDYVRQILPQVRPRVET 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS +  +    F     +  ESF    L  E ++ +L+     FEV+  W +E +   ++
Sbjct: 362 LSEVMPLAGHFFSGLPAIDEESFARVKLEREPLLKLLQFLVWRFEVVPAWNKEALLGEVK 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            ++ H E  +K  + P+F+AITGS  S  + D++ ILG  +   RLRHAI ++  + +  
Sbjct: 422 ALSAHFELKMKEFLAPVFIAITGSPSSTSVMDAMAILGSDMTRARLRHAIEVLGGVSKKQ 481

Query: 487 KKKELK 492
            K+  K
Sbjct: 482 AKRFEK 487


>gi|71737617|ref|YP_274170.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|115305787|sp|Q48KA5|SYE_PSE14 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|71558170|gb|AAZ37381.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 493

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 221/491 (45%), Positives = 325/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IYQ Y Q L+E   AF CFC+ E L+EMR
Sbjct: 59  FDALRWMGIEWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVELGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + +FDL  +S  G +FD +KL WLNG+W+R+ L   EF SR+  W    D + +     Q
Sbjct: 298 VDNFDLSRVSLGGPIFDIEKLSWLNGQWLRD-LPVEEFASRLKTWALNPDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L PE++  +++    + E ++ W+++ I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKDRI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H +  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGCIQAVVEHLKLKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|330722502|gb|EGH00328.1| Glutamyl-tRNA synthetase @ Glutamyl-tRNA(Gln) synthetase [gamma
           proteobacterium IMCC2047]
          Length = 493

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 236/486 (48%), Positives = 322/486 (66%), Gaps = 1/486 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R+APSPTG+PH+GTAY ALFN   A+  GGKFILRIEDTD  RST ESE A++ SLK
Sbjct: 3   VRTRVAPSPTGDPHVGTAYIALFNMAFARNLGGKFILRIEDTDQARSTPESEQAILDSLK 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GLNWDEGPD+GG +GPYRQSER  IY+ + Q L++   AF CFC++ERL+ +R  Q  
Sbjct: 63  WLGLNWDEGPDVGGEFGPYRQSERTEIYRQHSQQLIDDGHAFHCFCTSERLDALRAEQMA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                 YDGHC  LS +E+++     + HVVR+ +P++GSC  +D +  ++EI W  VDM
Sbjct: 123 NKQTPGYDGHCAHLSKEEVQQRIDAGEPHVVRMKIPSKGSCTVKDFLRDDIEIDWQQVDM 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVL+K+DGMPTYHLANV+DDHLM ITHV RGEEWI+S PKHILLYQYF + +P   H+PL
Sbjct: 183 QVLMKADGMPTYHLANVVDDHLMGITHVIRGEEWINSAPKHILLYQYFGWDMPVLCHMPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  MGYLPEA++N+L  +      + ++   +Q++I +FD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYKRMGYLPEAVVNYLGRMGWSMPNEAEK-FTLQEMIDNFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           L  +S  G +FD +KL WLNG W+RE LS  EF  RV QW    D   Q   L + RI  
Sbjct: 302 LSRVSLGGPIFDVEKLGWLNGGWLREDLSVDEFAERVKQWAFNPDYFMQIAPLIKERIEI 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
            S +  +  F     L ++ + F+   L  E+   IL+ T    E  Q + R+N+E+ ++
Sbjct: 362 FSDIAPLASFFCAGMLDISEQHFEHKTLEQEDCKRILQFTLWRLETEQDFSRDNLESIIK 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
           +++      ++  + PLF+AI G+  S  +FDS+ +LG  +   RLRHA+ ++  L +  
Sbjct: 422 HMSDIMGLKIRDYLFPLFIAIAGTNVSTSVFDSMTVLGPDLSRARLRHAVNVLGGLSKKQ 481

Query: 487 KKKELK 492
            KK  K
Sbjct: 482 TKKWEK 487


>gi|331018631|gb|EGH98687.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 493

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 223/491 (45%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W EGPD+GG +GPYRQSER +IYQ Y Q L+E   AF CFC+ E L+EMR
Sbjct: 59  FDALRWLGIEWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVELGHAFPCFCTAEELDEMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q+ +    RYDG  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW
Sbjct: 119 AEQQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF SR+  W    + + +     Q
Sbjct: 298 VDHFDLSRVSLGGPIFDIEKLSWLNGQWLRE-LPVEEFASRLQTWALNPEYMMKITPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   +    + F+   L P+++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPDQVRQVMQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
             +++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 MGSIQAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|20807410|ref|NP_622581.1| glutamyl- and glutaminyl-tRNA synthetase [Thermoanaerobacter
           tengcongensis MB4]
 gi|30173180|sp|Q8RB93|SYE1_THETN RecName: Full=Glutamyl-tRNA synthetase 1; AltName:
           Full=Glutamate--tRNA ligase 1; Short=GluRS 1
 gi|20515931|gb|AAM24185.1| Glutamyl- and glutaminyl-tRNA synthetases [Thermoanaerobacter
           tengcongensis MB4]
          Length = 481

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 178/493 (36%), Positives = 277/493 (56%), Gaps = 22/493 (4%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M+S  +VRVR APSPTG  HIG A TALFN+L A+  GGKFILR++DTD +RST ES   
Sbjct: 1   MMS--EVRVRFAPSPTGSLHIGGARTALFNWLFARHHGGKFILRVDDTDLERSTEESMRG 58

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
           +++ L+W G++WDEG        P  QS+R + Y+ +   LLE+  A+ CFC+ E LEEM
Sbjct: 59  ILEGLQWLGIDWDEG--------PIYQSQRLDEYRKFANKLLEEGKAYYCFCTKEELEEM 110

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R+   +   P  Y G C  L+ ++IE   +E KK V+RL  P +G  V  D + G++E  
Sbjct: 111 RKQAEREGRPFMYTGKCRNLTKEQIENYLKEGKKPVIRLKTPREGKTVVHDIIRGDVEFD 170

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            + +D  +++KSDGMPTY+ A V+DD+ M ITH+ R EE +S+ PK IL+Y+    P+P+
Sbjct: 171 NSTIDDFIIMKSDGMPTYNFATVVDDYQMGITHIIRAEEHLSNTPKQILIYEALGVPLPQ 230

Query: 241 FIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           F H+ ++  PD++KLSKR   TS+  +   GYLPEA++N++ LL      D +E+ D+++
Sbjct: 231 FAHVSMVLAPDRTKLSKRHGATSVQEFRDQGYLPEAIVNYITLLG-WAPLDGEEIFDVRK 289

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKD 351
            I  F L  +SK  AV+D QKL W+NG +IR      +    +  +           + +
Sbjct: 290 SIREFSLERVSKNPAVYDVQKLTWINGHYIRS-YDLDKLTQAIIPFLQKKGLIGENYDYE 348

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
            + + +++ + R  TL  +     + FK       +  +      E ++DILK   E  +
Sbjct: 349 YIKKIVSVVREREKTLVDIADAMTYYFKEVESYEEKGVQK-YFTKEGVVDILKKAAETLK 407

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            ++ + +   E A R + +    S   +  P  LAI+G  +   LFD +E LG+     R
Sbjct: 408 NLEPFNKFTAEEAYRKLVEELGISSSALFHPTRLAISGRTFGPGLFDIMEFLGKEKTVAR 467

Query: 472 LRHAIALVSSLVQ 484
           +  AI  +   ++
Sbjct: 468 IERAIKFIEENIK 480


>gi|332799629|ref|YP_004461128.1| glutamyl-tRNA synthetase [Tepidanaerobacter sp. Re1]
 gi|332697364|gb|AEE91821.1| glutamyl-tRNA synthetase [Tepidanaerobacter sp. Re1]
          Length = 491

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 184/494 (37%), Positives = 269/494 (54%), Gaps = 15/494 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S  VRVR APSPTG  HIG A TALFN L A+   G F+LRIEDTD++RST ES   ++
Sbjct: 1   MSENVRVRFAPSPTGSLHIGGARTALFNLLFARHNNGTFVLRIEDTDTERSTEESTQQIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +SLKW GL+WDEGP+ GG +GPY QS+R  +Y+  V  LL +  A+ C+CS E L E R 
Sbjct: 61  RSLKWLGLDWDEGPEKGGNFGPYFQSQRLELYKKEVDRLLAEGKAYYCYCSPEELSERRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           A  K   P +YDG C  L+ ++ ++   E + + +RL +P +G  V +D + G +    +
Sbjct: 121 AALKAGKPPKYDGRCRNLTPEQRKKFEDEGRPYTIRLKMPEEGQTVVEDLIRGTVVFDNS 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +D  +++KS+G+PTY+ A V+DD+ MK+TH+ R EE +S+ PK I  Y    + IP+F 
Sbjct: 181 VLDDLIIVKSNGIPTYNFACVVDDNAMKMTHIIRAEEHLSNTPKQIQTYLALGYEIPKFA 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+P+I  PD+SKLSKR   TS+  +   GYL E++IN+L LL     E  +E+ DM + I
Sbjct: 241 HVPMILAPDRSKLSKRHGATSVEEFRDQGYLAESIINYLTLLGWS-PEGTEEIFDMDKAI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM------------KEK 350
             F L  ++K  A++D +KL W+NG ++RE L       +   +M               
Sbjct: 300 REFTLERVNKTAAIYDVKKLTWINGHYMRE-LDLEYITEQTIPFMIKKGIVTEEEARDNF 358

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
           D + + + +++ R  TL  L     F FK       +  K      E    +L    E  
Sbjct: 359 DYIKKVVEISRDRAKTLDELADTIAFFFKDVTEYEEKGVKKH-FSKENAAKLLTLGAEAL 417

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
           E ++ +  +  E   RN+          I+ P  LAITG      LFD I +LGR     
Sbjct: 418 EKLEDFTHDKTEETFRNITADMGLKAAEIIHPTRLAITGRTVGPGLFDIIVLLGREKTVE 477

Query: 471 RLRHAIALVSSLVQ 484
           R+R A   +S+   
Sbjct: 478 RMRKAAQWISNKSN 491


>gi|302388972|ref|YP_003824793.1| glutamyl-tRNA synthetase [Thermosediminibacter oceani DSM 16646]
 gi|302199600|gb|ADL07170.1| glutamyl-tRNA synthetase [Thermosediminibacter oceani DSM 16646]
          Length = 496

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 186/493 (37%), Positives = 275/493 (55%), Gaps = 16/493 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++  KVRVR APSPTG  HIG A TALFN L A+   G F+LRIEDTD++RST ES   +
Sbjct: 1   MTD-KVRVRFAPSPTGSLHIGGARTALFNLLFARHNNGVFVLRIEDTDTERSTEESVAQI 59

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           ++S+KW GL+WDEGP+ GG YGPY QS+R  +Y+   Q LL++  A+ C+C+ E L   R
Sbjct: 60  LRSMKWLGLDWDEGPEKGGDYGPYFQSQRLELYRKEAQRLLDEGKAYYCYCTPEELAARR 119

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            A  K     RY+G C  L  ++ +R   E +K V+RL VP +G  V +D + G +    
Sbjct: 120 EAMMKAGKAPRYEGLCRNLCDEDRKRYEAEGRKPVIRLKVPQEGQTVVEDIIRGTVVFEN 179

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +D  +++KS+GMPTY+ A V+DDH MKITHV R EE +S+ PK I +Y+   + +P F
Sbjct: 180 SVLDDFIIMKSNGMPTYNFACVVDDHAMKITHVIRAEEHLSNTPKQIQVYKALGYELPRF 239

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+P+I  PD+SKLSKR   TS+  +   GYL +A+IN+L LL     +  +E+ DM++ 
Sbjct: 240 AHVPMILAPDRSKLSKRHGATSVEEFRDQGYLSQAIINYLTLLGWSPLDS-EEIFDMEKA 298

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM------------KE 349
           I  F L  ++K  A++D +KL W+NG ++RE L       +V  +M            K 
Sbjct: 299 IREFTLERVNKTAAIYDIKKLTWINGHYLRE-LDLDYITDQVIPFMVKKGIIAEEDAGKR 357

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
            + + Q + +++ R  TL  L     F FK       +  K      E   ++L    E 
Sbjct: 358 YEYIKQVVAVSRDRAKTLDELADAIAFFFKDVAEYEEKGVKKHFF-KENAAELLIKGAEA 416

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E +  +  E+ E A R++          ++ P  LAITG      LF+ I +LG+    
Sbjct: 417 LERLDEFTHESTERAFRSLTDSIGLKAAELIHPTRLAITGRTVGPGLFEIIVLLGKEETV 476

Query: 470 FRLRHAIALVSSL 482
            R+R A   + + 
Sbjct: 477 KRMRKAADWIKNH 489


>gi|297528459|ref|YP_003669734.1| glutamyl-tRNA synthetase [Geobacillus sp. C56-T3]
 gi|297251711|gb|ADI25157.1| glutamyl-tRNA synthetase [Geobacillus sp. C56-T3]
          Length = 491

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 177/491 (36%), Positives = 278/491 (56%), Gaps = 20/491 (4%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           + + +VRVR APSPTG  HIG A TALFNYL A+  GGK I+RIEDTD +R+    E + 
Sbjct: 1   MMAKEVRVRYAPSPTGHLHIGGARTALFNYLFARHHGGKMIVRIEDTDIERNVEGGEKSQ 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++LKW G+++DE  D  G YGPYRQ+ER +IY+ YV  LLE+  A++CFC+ E LE  R
Sbjct: 61  LENLKWLGIDYDESIDQDGGYGPYRQTERLDIYRKYVNELLEQGHAYKCFCTPEELERER 120

Query: 122 RAQRKRNIPSRYD-GHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
            AQR   I +    G C  L+ +++  L  + K + +RL VP   +  F D V G++   
Sbjct: 121 EAQRAAGIAAPQYSGKCRHLTPEQVAELEAQGKPYTIRLKVPEGKTYEFYDLVRGKVVFE 180

Query: 181 WNAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIP 239
              V    V++K++G+PTY+ A VIDDHLM+I+HV RGEE +S+ PK +++Y+YF +  P
Sbjct: 181 SKDVGGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHLSNTPKQLMVYEYFGWDPP 240

Query: 240 EFIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMD 297
           +F HL LI N  + KLSKR       +S Y  +GYLPEA+ NF ALL      + +E+  
Sbjct: 241 QFAHLTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMFNFFALLGWSPEGE-EEIFT 299

Query: 298 MQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW----------- 346
             +LI  FD+  LSK+ ++FD +KL W+N ++I++ L     +                 
Sbjct: 300 KDELIRMFDVSRLSKSPSMFDTKKLTWMNNQYIKK-LDLDRLVELALPHLVKAGRLPADM 358

Query: 347 -MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
             +++      + L Q +++  + +  +++  FK    +  E      L  E++  +L T
Sbjct: 359 TDEQRQWARDLIALYQEQMSYGAEIVPLSELFFKE--EIDYEDEARQVLAEEQVPAVLST 416

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
             E    ++ +  + I+ A++ V +   +  K +  P+  A+TG  +   L  +I++LG+
Sbjct: 417 FLESVRELEPFTADEIKAAIKAVQKATGQKGKKLFMPIRAAVTGQTHGPELPFAIQLLGK 476

Query: 466 SVVYFRLRHAI 476
             V  RL  A+
Sbjct: 477 EKVIERLERAL 487


>gi|295702327|ref|YP_003595402.1| glutamyl-tRNA synthetase [Bacillus megaterium DSM 319]
 gi|294799986|gb|ADF37052.1| glutamyl-tRNA synthetase [Bacillus megaterium DSM 319]
          Length = 485

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 179/485 (36%), Positives = 273/485 (56%), Gaps = 18/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            SS+VRVR APSPTG  HIG A TALFNYL A+   GKFI+RIEDTD KR+    E + +
Sbjct: 1   MSSEVRVRYAPSPTGHLHIGNARTALFNYLFARNQNGKFIIRIEDTDQKRNIEGGEESQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           + LKW G+ WDE  D+GG YGPYRQSER  IYQ Y + LLEK LA+ C+C++E LE+ R 
Sbjct: 61  RYLKWLGIEWDESIDVGGEYGPYRQSERTEIYQKYTEELLEKGLAYYCYCTSEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q+  +   RY G C  L++++   L  E ++  +R  VP+     + D V  E+     
Sbjct: 121 EQQANSQMPRYSGKCRNLTAEQRAELEAEGREPSIRFRVPSNTEIKWNDIVKDEVSFESE 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  IDD+LMK+THV RG++ IS+ PK IL+Y+   +  P F 
Sbjct: 181 GIGDFVIVKKDGTPTYNYAVAIDDYLMKMTHVLRGDDHISNTPKQILVYEALGWTPPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ +L       ++E+   +Q
Sbjct: 241 HMTLIVNENRRKLSKRDESIIQFIEQYKELGYLPEALFNFITMLGWS-PVGEEEIFSKEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MK 348
            I  FD   LSK+ A+FD  KL W+N ++++ +L   E ++                  +
Sbjct: 300 FIEIFDPARLSKSPALFDTSKLRWMNNQYMK-QLDLDEVVALSVPHLVKAGKVEEARDAE 358

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
            +  +   + L Q +++  + + ++T+  FK ++  + E+     L  E++ ++LK   E
Sbjct: 359 TEQWVRDLVALYQEQMSFGAEIVELTEMFFKKEIDYSEEA--KAVLAEEQVPEVLKAFAE 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           E   ++ +  + I+ A + V +   +  K +  P+ +A TG  +   L  +I +LG+  V
Sbjct: 417 EISSLEEFSADEIKAATKAVQKATGQKGKKLFMPIRVATTGETHGPELPKAISLLGKETV 476

Query: 469 YFRLR 473
             RL 
Sbjct: 477 LARLE 481


>gi|261417584|ref|YP_003251266.1| glutamyl-tRNA synthetase [Geobacillus sp. Y412MC61]
 gi|319765242|ref|YP_004130743.1| glutamyl-tRNA synthetase [Geobacillus sp. Y412MC52]
 gi|261374041|gb|ACX76784.1| glutamyl-tRNA synthetase [Geobacillus sp. Y412MC61]
 gi|317110108|gb|ADU92600.1| glutamyl-tRNA synthetase [Geobacillus sp. Y412MC52]
          Length = 491

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 177/491 (36%), Positives = 278/491 (56%), Gaps = 20/491 (4%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           + + +VRVR APSPTG  HIG A TALFNYL A+  GGK I+RIEDTD +R+    E + 
Sbjct: 1   MMAKEVRVRYAPSPTGHLHIGGARTALFNYLFARHHGGKMIVRIEDTDIERNVEGGEKSQ 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++LKW G+++DE  D  G YGPYRQ+ER +IY+ YV  LLE+  A++CFC+ E LE  R
Sbjct: 61  LENLKWLGIDYDESIDQDGGYGPYRQTERLDIYRKYVNELLEQGHAYKCFCTPEELERER 120

Query: 122 RAQRKRNIPSRYD-GHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
            AQR   I +    G C  L+ +++  L  + K + +RL VP   +  F D V G++   
Sbjct: 121 EAQRAAGIAAPQYSGKCRHLTPEQVAELEAQGKPYTIRLKVPEGKTYEFYDLVRGKVVFE 180

Query: 181 WNAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIP 239
              V    V++K++G+PTY+ A VIDDHLM+I+HV RGEE +S+ PK +++Y+YF +  P
Sbjct: 181 SKDVGGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHLSNTPKQLMVYEYFGWEPP 240

Query: 240 EFIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMD 297
           +F HL LI N  + KLSKR       +S Y  +GYLPEA+ NF ALL      + +E+  
Sbjct: 241 QFAHLTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMFNFFALLGWSPEGE-EEIFT 299

Query: 298 MQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW----------- 346
             +LI  FD+  LSK+ ++FD +KL W+N ++I++ L     +                 
Sbjct: 300 KDELIRMFDVSRLSKSPSMFDTKKLTWMNNQYIKK-LDLDRLVELALPHLVKAGRLPADM 358

Query: 347 -MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
             +++      + L Q +++  + +  +++  FK    +  E      L  E++  +L T
Sbjct: 359 TDEQRQWARDLIALYQEQMSYGAEIVPLSELFFKE--EIDYEDEARQVLAEEQVPAVLST 416

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
             E    ++ +  + I+ A++ V +   +  K +  P+  A+TG  +   L  +I++LG+
Sbjct: 417 FLESVRELEPFTADEIKAAIKAVQKATGQKGKKLFMPIRAAVTGQTHGPELPFAIQLLGK 476

Query: 466 SVVYFRLRHAI 476
             V  RL  A+
Sbjct: 477 EKVIERLERAL 487


>gi|147669815|ref|YP_001214633.1| glutamyl-tRNA synthetase [Dehalococcoides sp. BAV1]
 gi|189082153|sp|A5FPX2|SYE_DEHSB RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|146270763|gb|ABQ17755.1| glutamyl-tRNA synthetase [Dehalococcoides sp. BAV1]
          Length = 487

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 189/496 (38%), Positives = 273/496 (55%), Gaps = 20/496 (4%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +++VRVR APSPTG PH+G   TA+FN+L A+  GGKFI+RIEDTD +R    +  +++
Sbjct: 1   MTNEVRVRYAPSPTGYPHLGNIRTAMFNWLFARHNGGKFIVRIEDTDRERYVEGAVESIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +SL W GL+WDEGPD GG YGPY QSER  +Y+   + L+ +  A+ C CS+E+L++MR 
Sbjct: 61  ESLNWLGLDWDEGPDKGGDYGPYYQSERLPLYRKAAEKLVAEGKAYYCHCSSEKLDKMRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R  P  YD           +R   +++  V+R  +P  G   F D + GE+     
Sbjct: 121 DQIARKEPPGYDR-------CCRDRGLGQKEGAVIRFKIPLDGQTAFTDLIRGEVTFDNA 173

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
             D  V+LKSDG PTYHLA+V+DDH M+I+HV R EEW+ S PKH++LY+   +  P + 
Sbjct: 174 KQDDFVILKSDGFPTYHLASVVDDHAMQISHVLRAEEWLPSTPKHLMLYKALGYTPPLYA 233

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           HLP+I  PD+SKLSKR   TS   Y   GYLPE ++NFL+LL     +D  EL   +QLI
Sbjct: 234 HLPMILGPDRSKLSKRHGATSTIEYKQAGYLPETMVNFLSLLG-WAYDDKTELFSREQLI 292

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-----------MKEKD 351
            +F L  +SK  A+F+ +KLDW+NG +IR  LS  +   R   +               D
Sbjct: 293 EYFCLEKVSKTAAIFNYEKLDWMNGMYIRT-LSAQDLACRAMPFLEKDARIAASGHLNLD 351

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
              + + L Q R   L+ L ++  F++  D+           L  E  +  LK      E
Sbjct: 352 YTVKVMPLIQERAKKLNELAELCWFIYSDDISYDPALLIDKKLTKETSLSALKAANARLE 411

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            +  +   ++E  +R +A   E     +   L  A TG + + PLF ++E+LGR     R
Sbjct: 412 ALPNFDAASMEEHIRPLAAELELKPGQLFGMLRTASTGQQVAPPLFQTMEVLGRQRCLGR 471

Query: 472 LRHAIALVSSLVQNHK 487
           +  AIA +S +     
Sbjct: 472 IAMAIARLSEMPSQRS 487


>gi|170720726|ref|YP_001748414.1| glutamyl-tRNA synthetase [Pseudomonas putida W619]
 gi|229470639|sp|B1J522|SYE_PSEPW RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|169758729|gb|ACA72045.1| glutamyl-tRNA synthetase [Pseudomonas putida W619]
          Length = 493

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 220/491 (44%), Positives = 325/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W+EGPD+GG +GPYRQSER  IY  Y + L++   AF CFC+ E LE+MR
Sbjct: 59  FDALRWLGIEWNEGPDVGGPHGPYRQSERGEIYARYAKQLVDAGHAFYCFCTAEELEQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDG  L LS +E++R     + HV+R+ VP++G CV  D + G++EIPW
Sbjct: 119 AEQMARGETPRYDGRALLLSDEEVQRRLAAGEPHVIRMKVPSEGICVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKNDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPKL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF +RV +W    D + +     Q
Sbjct: 298 VEHFDLSRISLGGPIFDIEKLSWLNGQWLRE-LPVEEFAARVQKWAFNSDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F+  L L A+ F+S  L  +++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQIAPLGGFFFEGALKLDAKLFESKKLSADQVRQVMQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVVEALELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRYRLRQALDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|194017561|ref|ZP_03056172.1| glutamyl-tRNA synthetase [Bacillus pumilus ATCC 7061]
 gi|194010833|gb|EDW20404.1| glutamyl-tRNA synthetase [Bacillus pumilus ATCC 7061]
          Length = 483

 Score =  392 bits (1007), Expect = e-107,   Method: Composition-based stats.
 Identities = 179/486 (36%), Positives = 279/486 (57%), Gaps = 18/486 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+RIEDTD KR+    E + +
Sbjct: 1   MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDQKRNVEGGEESQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           + L+W G++WDE  D  G YGPYRQSER +IY+ Y   LLEK LA++C+C+ E LEE R 
Sbjct: 61  RHLQWLGIDWDESIDKDGGYGPYRQSERNDIYKKYYDELLEKDLAYKCYCTAEELEEERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R+   RY G C  LS +E ++L  E ++  +R  VP      F D V G++    +
Sbjct: 121 AQIARSEMPRYSGKCSHLSKEEEDKLIAEGREPSIRFRVPKGEIIKFDDMVKGDISFETD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  +DD+LMK+TH+ RGE+ IS+ PK I+++  F + +P F 
Sbjct: 181 GIGDFVIVKKDGTPTYNFAVAVDDYLMKMTHILRGEDHISNTPKQIMIFNAFGWDVPLFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL       ++EL   +Q
Sbjct: 241 HMTLIVNENRKKLSKRDESIIQFIEQYKNLGYLPEALFNFIALLGWS-PVGEEELFTKEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MK 348
            I  FD++ LSK+ A+FD  KL W+N ++++  L   + ++                  +
Sbjct: 300 FIDIFDVNRLSKSPALFDMHKLKWVNNQYVKA-LDLDQVVALTLPHLQKAGKVSEQLSDE 358

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           E   + + + L   +++  + + ++T+  FK  +    E+     L  E++ +++ +   
Sbjct: 359 ENTWVRKLIALYHEQLSYGAEIVELTELFFKEQIEYNQEA--KEVLAEEQVPEVMASFAG 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E ++ +  + I+ A++ V +      K +  P+ +A+TG  +   L  SIE+LG+  V
Sbjct: 417 QLERLESFTPDEIKAAIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELLGKETV 476

Query: 469 YFRLRH 474
             R++ 
Sbjct: 477 LNRIKQ 482


>gi|268316848|ref|YP_003290567.1| glutamyl-tRNA synthetase [Rhodothermus marinus DSM 4252]
 gi|262334382|gb|ACY48179.1| glutamyl-tRNA synthetase [Rhodothermus marinus DSM 4252]
          Length = 500

 Score =  392 bits (1006), Expect = e-107,   Method: Composition-based stats.
 Identities = 192/496 (38%), Positives = 277/496 (55%), Gaps = 23/496 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
              VRVR APSPTG  HIG   TAL+N+L A++ GG+FILRIEDTD +R    +E  +++
Sbjct: 9   EGPVRVRFAPSPTGFLHIGGLRTALYNFLFARKHGGQFILRIEDTDQERYVPGAEEDIIE 68

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           SL+W GL +DEGPD+GG  GPYRQSERK +YQ Y + L+E   A+  F + E LEEMRR 
Sbjct: 69  SLRWAGLTYDEGPDVGGPCGPYRQSERKELYQQYAKQLVEAGHAYYAFDTPEELEEMRRR 128

Query: 124 QRKRNIPSRYDGHCLKLSSQE--------IERLSQEQKKHVVRLTVPNQGSCVFQDKVYG 175
            +K   PS       ++S +         +ERL  E   +V+RL VP + +  F D + G
Sbjct: 129 LQKSGNPSPKYDAITRMSMRNSLTLPAEEVERLLAEGVPYVIRLKVPRRETIRFYDLIRG 188

Query: 176 EMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN 235
            +    + +D QVL+KSDGMPTYH+ANV+DDHLM ITHV RGEEW+SS PKH+LLY+Y  
Sbjct: 189 WVSFESSEIDDQVLIKSDGMPTYHMANVVDDHLMGITHVIRGEEWLSSTPKHVLLYRYLG 248

Query: 236 FPIPEFIHLPLIKNPDKSKLSKRR-----NPTSISYYSAMGYLPEALINFLALLFVHKSE 290
           + +P+  HLPLI +P   KLSKR       P  +  Y  +GY PEAL+N+LA L      
Sbjct: 249 WEMPQMAHLPLILSPKGGKLSKRNAEELGIPVLVRQYRELGYEPEALVNYLAFLG-WNPG 307

Query: 291 DDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK 350
            + E+  +++LI  F L  +  A   F   KL W N ++IR  +S  E   +   ++K+ 
Sbjct: 308 TEQEVFTLEELIEAFSLDRVRPAAVQFSLDKLQWYNQQFIRR-MSVEELARKAMPYLKKH 366

Query: 351 ------DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILK 404
                   + +   L Q RIT +  L     F ++       +  +      E   ++++
Sbjct: 367 GIEADEAYVQKVAALMQERITFVEELATFCRFFYEDPTTYEEKGVQKR--WKENSAELVR 424

Query: 405 TTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILG 464
              +  E ++ +  E  E ALR +A+ R      I+ P  LAI+G  +   LF+ +E++G
Sbjct: 425 AYADRLEQLEEFTAETAEQALRELAEERGVKAAEIIHPTRLAISGLSFGPSLFEMMEVIG 484

Query: 465 RSVVYFRLRHAIALVS 480
           +     RLR A  ++ 
Sbjct: 485 KEACVRRLRRAAEVLG 500


>gi|157690875|ref|YP_001485337.1| glutamyl-tRNA synthetase [Bacillus pumilus SAFR-032]
 gi|166979998|sp|A8F960|SYE_BACP2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|157679633|gb|ABV60777.1| glutamate--tRNA ligase [Bacillus pumilus SAFR-032]
          Length = 483

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 180/486 (37%), Positives = 279/486 (57%), Gaps = 18/486 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+RIEDTD KR+    E + +
Sbjct: 1   MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDQKRNVEGGEESQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           + L+W G++WDE  D  G YGPYRQSER +IY+ Y   LLEK LA++C+C+ E LEE R 
Sbjct: 61  RHLQWLGIDWDESIDKDGGYGPYRQSERNDIYKKYYDELLEKDLAYKCYCTAEELEEERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R+   RY G C  LS +E ++L  E ++  +R  VP      F D V GE+    +
Sbjct: 121 AQIARSEMPRYSGKCSHLSKEEEDKLIAEGREPSIRFRVPKGEIIKFDDMVKGEISFETD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  +DDHLMK+TH+ RGE+ IS+ PK I+++  F + +P F 
Sbjct: 181 GIGDFVIVKKDGTPTYNFAVAVDDHLMKMTHILRGEDHISNTPKQIMIFNAFGWDVPLFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL       ++EL   +Q
Sbjct: 241 HMTLIVNENRKKLSKRDESIIQFIEQYKNLGYLPEALFNFIALLGWS-PVGEEELFTKEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MK 348
            I  FD++ LSK+ A+FD  KL W+N ++++  L   + ++                  +
Sbjct: 300 FIDIFDVNRLSKSPALFDMHKLKWVNNQYVKA-LDLDQVVALTLPHLQKAGKVSEQLSDE 358

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           +   + + + L   +++  + + ++T+  FK  +    E+     L  E++ +++ +   
Sbjct: 359 KNTWVRKLIALYHEQLSYGAEIVELTELFFKEQIEYNQEA--KEVLAEEQVPEVMASFAG 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E ++ +  + I+ A++ V +      K +  P+ +A+TG  +   L  SIE+LG+  V
Sbjct: 417 QLERLESFTPDEIKAAIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELLGKETV 476

Query: 469 YFRLRH 474
             R++ 
Sbjct: 477 LNRIKQ 482


>gi|256752158|ref|ZP_05493024.1| glutamyl-tRNA synthetase [Thermoanaerobacter ethanolicus CCSD1]
 gi|256748972|gb|EEU62010.1| glutamyl-tRNA synthetase [Thermoanaerobacter ethanolicus CCSD1]
          Length = 479

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 179/490 (36%), Positives = 273/490 (55%), Gaps = 20/490 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VRVR APSPTG  HIG A TALFN+L A+  GGKFILR++DTD +RST ES   +++
Sbjct: 1   MSEVRVRFAPSPTGSLHIGGARTALFNWLFARHNGGKFILRVDDTDLQRSTEESMKGILE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            LKW G++WDEG        P  QS+R   Y+ +   LL++  A+ CFC+ E LEEMR+ 
Sbjct: 61  GLKWLGIDWDEG--------PIYQSQRLEEYRKFANKLLKEGKAYYCFCTKEELEEMRKQ 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             K   P  Y G C  L+ ++IE   ++ KK V+RL VP QG  V  D + G++E   + 
Sbjct: 113 AEKEGRPPMYTGKCRNLTKEQIEEYLRQGKKPVIRLKVPQQGKTVVHDIIRGDVEFDNST 172

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
            D  +++KSD MPTY+ A V+DD+ M ITHV R EE +S+ PK IL+++     IP+F H
Sbjct: 173 FDDFIIMKSDNMPTYNFATVVDDYQMGITHVIRAEEHLSNTPKQILIFEALGLEIPQFAH 232

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + ++  PD+SKLSKR   TS+  +   GYLPEA++N++ LL     +D +E+ D+ + I 
Sbjct: 233 VSMVLAPDRSKLSKRHGATSVQEFRDQGYLPEAIVNYITLLG-WIPKDGEEIFDVSKSIK 291

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLT 354
            F L  +SK  A++D QKL W+NG +IR      +    V  +           + D + 
Sbjct: 292 EFTLERVSKNPAIYDVQKLTWINGHYIRN-YDLDKLTEVVIPFLKAKNFIGEDFDYDYIK 350

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + +++ + R  TL  +     + F        +  K      E+++DILK      + ++
Sbjct: 351 KIVSVVREREKTLVDVADAMSYYFTEVNEYEEKGVKK-YFTKEKVVDILKKAVVTLKEVE 409

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            + +   E A R + +  + S   +  P  LAI+G  +   LFD +E+LG+     R+  
Sbjct: 410 PFNKFTTEEAYRKLVEELQISSGELFHPTRLAISGRTFGPGLFDIMELLGKERTIKRIEK 469

Query: 475 AIALVSSLVQ 484
           AI  +  + +
Sbjct: 470 AIDFIQKMRK 479


>gi|323704236|ref|ZP_08115815.1| glutamyl-tRNA synthetase [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323536302|gb|EGB26074.1| glutamyl-tRNA synthetase [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 480

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 179/491 (36%), Positives = 269/491 (54%), Gaps = 20/491 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
              VRVR APSPTG  HIG A TALFN+L A+   GK ILR++DTD +RST +S  A++ 
Sbjct: 1   MKDVRVRFAPSPTGNLHIGGARTALFNWLFARHNNGKLILRVDDTDLERSTGDSMKAILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            LKW G++WDEGP          QS+R  +Y+ Y   L+ +  A+ CFC+ E L+ MR  
Sbjct: 61  GLKWLGIDWDEGPL--------YQSKRLEMYKKYADELVIQGKAYYCFCTKEELDIMRSE 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
            +K   PS Y G C  LS  E+++   E KK+VVRL VP +G  V  D + G++E   + 
Sbjct: 113 AQKAGKPSMYTGKCRNLSPDEVKKYMDEGKKYVVRLKVPKEGKTVVHDIIRGDVEFDNST 172

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
            D  +++KSD MPTY+ A VIDD+ M+I+H+ RGEE +S+ PK IL+Y+   F  PEF H
Sbjct: 173 FDDFIIMKSDNMPTYNFATVIDDYDMEISHIIRGEEHLSNTPKQILIYEALGFEKPEFAH 232

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + +I  PD+SKLSKR   TS+  +  +GYLPEA+IN++ LL      D +E+   ++ + 
Sbjct: 233 VSMILAPDRSKLSKRHGATSVQEFRDLGYLPEAIINYITLLG-WVPSDGEEVFTTEKSVR 291

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLT 354
            F L  +SK  A++D +KL WLNG +IR+          V  +           + D + 
Sbjct: 292 EFTLDRVSKNPAIYDTKKLTWLNGIYIRD-CDIDRLTKEVIPFLISKGLIGDEYDYDYIR 350

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + ++  + R  TLS +     + FK D     +  K      + + +IL+   +  + + 
Sbjct: 351 KIVSAVREREKTLSEIADAMSYYFKDDFLYDEKGVKK-YFEKDGVENILREAIKALKAVD 409

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            +     E A R++ +        +  P  LAI+G  +   LFD +E+LG+     R+  
Sbjct: 410 DFNLIETENAYRDLIERLNIKSGDLFHPTRLAISGRTFGPGLFDIMELLGKEKTVERIEK 469

Query: 475 AIALVSSLVQN 485
           AI  + S+ Q 
Sbjct: 470 AIKYIESIKQK 480


>gi|289433026|ref|YP_003462899.1| glutamyl-tRNA synthetase [Dehalococcoides sp. GT]
 gi|288946746|gb|ADC74443.1| glutamyl-tRNA synthetase [Dehalococcoides sp. GT]
          Length = 487

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 189/491 (38%), Positives = 273/491 (55%), Gaps = 20/491 (4%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +++VRVR APSPTG PH+G   TA+FN+L A+  GGKFI+RIEDTD +R    +  +++
Sbjct: 1   MTNEVRVRYAPSPTGYPHLGNIRTAMFNWLFARHNGGKFIVRIEDTDRERYVEGAVESIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +SL W GL+WDEGPD GG YGPY QSER  +Y+   + L+ +  A+ C CS+E+L++MR 
Sbjct: 61  ESLNWLGLDWDEGPDKGGDYGPYYQSERLPLYRKAAEKLVAEGKAYYCHCSSEKLDKMRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R  P  YD           +R   +++  V+R  +P  G   F D + GE+     
Sbjct: 121 DQIARKEPPGYDR-------CCRDRGLGQKEGAVIRFKIPLDGQTAFTDLIRGEVTFDNA 173

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
             D  V+LKSDG PTYHLA+V+DDH M+I+HV R EEW+ S PKH++LY+   +  P + 
Sbjct: 174 KQDDFVILKSDGFPTYHLASVVDDHAMQISHVLRAEEWLPSTPKHLMLYKALGYTPPLYA 233

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           HLP+I  PD+SKLSKR   TS   Y   GYLPE ++NFL+LL     +D  EL   +QLI
Sbjct: 234 HLPMILGPDRSKLSKRHGATSTIEYKQAGYLPETMVNFLSLLG-WAYDDKTELFSREQLI 292

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-----------MKEKD 351
            +F L  +SK  A+F+ +KLDW+NG +IR  LS  +   R   +               D
Sbjct: 293 EYFCLEKVSKTAAIFNYEKLDWMNGMYIRT-LSAQDLACRAMPFLEKDVRIAASGHLNLD 351

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
              + + L Q R   L+ L ++  F++  D+           L  E  +  LK      E
Sbjct: 352 YTVKVMPLIQERAKKLNELAELCWFIYSDDISYDPALLIDKKLTKETSLSALKAANARLE 411

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            +  +   ++E  +R +A   E     +   L  A TG + + PLF ++E+LGR     R
Sbjct: 412 ALPNFDAASMEEHIRPLAAELELKPGQLFGMLRTASTGQQVAPPLFQTMEVLGRQRCLGR 471

Query: 472 LRHAIALVSSL 482
           +  AIA +S +
Sbjct: 472 IAMAIARLSEM 482


>gi|104780803|ref|YP_607301.1| glutamyl-tRNA synthetase [Pseudomonas entomophila L48]
 gi|123380988|sp|Q1ICW8|SYE_PSEE4 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|95109790|emb|CAK14495.1| glutamyl-tRNA synthetase [Pseudomonas entomophila L48]
          Length = 493

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 220/491 (44%), Positives = 326/491 (66%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ W+EGPD+GG++GPYRQSER  IY  Y + L++   AF CFC+ E LE+MR
Sbjct: 59  FDALRWLGIEWNEGPDVGGSHGPYRQSERGEIYAKYAKELVDAGHAFYCFCTAEELEQMR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDG  L LS +E++R     + HV+R+ VP++G CV  D + G++EIPW
Sbjct: 119 AEQMARGETPRYDGRALLLSDEEVQRRLAAGEPHVIRMKVPSEGICVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKNDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPKL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           + HFDL  +S  G +FD +KL WLNG+W+RE L   EF +RV +W    D + +     Q
Sbjct: 298 VEHFDLSRISLGGPIFDIEKLSWLNGQWLRE-LPVEEFAARVQKWAFNSDYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F+  L L A+ F+S  L  +++  +++    + E ++ W+++ I
Sbjct: 357 GRVETFSQVAPLGGFFFEGALKLDAKLFESKKLSADQVRQVMQLILWKLESLRQWEKDRI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +  E  L+  +  +F AITG   S+ + D++EILG  +  +RLR AI L+  
Sbjct: 417 TGCIQAVVESLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRYRLRQAIDLLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|319789482|ref|YP_004151115.1| glutamyl-tRNA synthetase [Thermovibrio ammonificans HB-1]
 gi|317113984|gb|ADU96474.1| glutamyl-tRNA synthetase [Thermovibrio ammonificans HB-1]
          Length = 484

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 188/485 (38%), Positives = 279/485 (57%), Gaps = 14/485 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  H+G A TALFNYL A+   G FILRIEDTD++R + E+   + ++LK
Sbjct: 3   VRVRFAPSPTGFMHVGNARTALFNYLFARHNNGTFILRIEDTDTERHSEEAVKVIYEALK 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEGPD GG YGPYRQSER NIY+ +++ L EK L + C+C+ E LE+MR+ Q +
Sbjct: 63  WMGLDWDEGPDRGGPYGPYRQSERLNIYKEFIEKLKEKGLVYECYCTQEELEQMRKEQLE 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA-VD 185
           R  P RY G C  L+  E E+L  E +K V+R  VP      F+D V GE+EI       
Sbjct: 123 RGEPPRYTGKCRHLTEAEKEKLRAEGRKPVLRFKVPEDRVVKFKDLVKGEIEINSRQLGG 182

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V+++S+GMP Y+   V+DD LMKITHV RGE+ IS+ PK +LLY+   F  P+F HLP
Sbjct: 183 DFVIVRSNGMPVYNFVVVVDDALMKITHVIRGEDHISNTPKQLLLYEALGFEAPQFAHLP 242

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D+SKLSKR   TS+  +   GYLPEA  NFLALL     +D  E++ M++LI  F
Sbjct: 243 MILGSDRSKLSKRHGSTSVKEFREKGYLPEAFTNFLALLG-WYPKDGKEILSMEELIERF 301

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLTQA 356
           D+  ++ A AVFD  KL+W+N  +IR      +    V  +           +K  L + 
Sbjct: 302 DIKDVNSAPAVFDTTKLNWMNQVYIRN-YPIEKLTELVIPYLEKAGFNLSEFDKQWLQKV 360

Query: 357 LTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI-QI 415
           + + +   T L+  P+  +   K    +  E+ K     P+ +  +++   E+ + + + 
Sbjct: 361 VEVTREYFTVLADAPEYMEVFLKDQFEVEPEAKKFIEESPDRLR-VIELFYEKVKELQEE 419

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA 475
              E  +  ++ + +      K +  P+ + +TG    + L   +E+LG+  V  RL ++
Sbjct: 420 LTSETFKKLVKEIGKELGVKGKNLFMPVRIGLTGRTSGVELPVLVELLGKERVLRRLENS 479

Query: 476 IALVS 480
           ++ + 
Sbjct: 480 LSQLK 484


>gi|167037827|ref|YP_001665405.1| glutamyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320116244|ref|YP_004186403.1| glutamyl-tRNA synthetase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|238687670|sp|B0KAA6|SYE2_THEP3 RecName: Full=Glutamyl-tRNA synthetase 2; AltName:
           Full=Glutamate--tRNA ligase 2; Short=GluRS 2
 gi|166856661|gb|ABY95069.1| glutamyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319929335|gb|ADV80020.1| glutamyl-tRNA synthetase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 479

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 178/490 (36%), Positives = 272/490 (55%), Gaps = 20/490 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VRVR APSPTG  HIG A TALFN+L A+  GGKFILR++DTD +RST ES   +++
Sbjct: 1   MSEVRVRFAPSPTGSLHIGGARTALFNWLFARHNGGKFILRVDDTDLQRSTEESMKGILE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            LKW G++WDEG        P  QS+R   Y+ +   LL++  A+ CFC+ E LEEMR+ 
Sbjct: 61  GLKWLGIDWDEG--------PIYQSQRLEEYRKFANKLLKEGKAYYCFCTKEELEEMRKQ 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             K   P  Y G C  L+ ++IE   ++ KK V+RL VP QG  V  D + G++E   + 
Sbjct: 113 AEKEGRPPMYTGKCRNLTKEQIEEYLRQGKKPVIRLKVPQQGKTVVHDIIRGDVEFDNST 172

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
            D  +++KSD MPTY+ A V+DD+ M ITHV R EE +S+ PK IL+++     IP+F H
Sbjct: 173 FDDFIIMKSDNMPTYNFATVVDDYQMGITHVIRAEEHLSNTPKQILIFEALGLEIPQFAH 232

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + ++  PD+SKLSKR   TS+  +   GYLPEA++N++ LL     +D +E+ D+ +   
Sbjct: 233 VSMVLAPDRSKLSKRHGATSVQEFRDQGYLPEAIVNYITLLG-WIPKDGEEIFDVSKSKK 291

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLT 354
            F L  +SK  A++D QKL W+NG +IR      +    V  +           + D + 
Sbjct: 292 EFTLERVSKNPAIYDVQKLTWINGHYIRN-YDLDKLTEVVIPFLKAKNFIGEDFDYDYIK 350

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + +++ + R  TL  +     + F        +  K      E+++DILK      + ++
Sbjct: 351 KIVSVVREREKTLVDVADAMSYYFTEVYEYEEKGVKK-YFTKEKVVDILKKAVVTLKEVE 409

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            + +   E A R + +  + S   +  P  LAI+G  +   LFD +E+LG+     R+  
Sbjct: 410 PFNKFTTEEAYRKLVEELQISSGELFHPTRLAISGRTFGPGLFDIMELLGKERTIERIEK 469

Query: 475 AIALVSSLVQ 484
           AI  +  + +
Sbjct: 470 AIDFIQKMRK 479


>gi|16077160|ref|NP_387973.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221307903|ref|ZP_03589750.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221312224|ref|ZP_03594029.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221317158|ref|ZP_03598452.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221321421|ref|ZP_03602715.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|135106|sp|P22250|SYE_BACSU RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|143006|gb|AAA22495.1| transfer RNA-Gln synthetase [Bacillus subtilis]
 gi|289282|gb|AAA21796.1| glutamyl-tRNA synthetase [Bacillus subtilis]
 gi|467480|dbj|BAA05326.1| glutamyl-tRNA synthetase [Bacillus subtilis]
 gi|2632359|emb|CAB11868.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|2653659|gb|AAC31971.1| glutamyl-tRNA synthetase [Bacillus subtilis]
          Length = 483

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 182/486 (37%), Positives = 282/486 (58%), Gaps = 18/486 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+R+EDTD KR+    E + +
Sbjct: 1   MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDKKRNIEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW G++WDE  D+GG YGPYRQSER +IY+ Y + LLEK LA++C+C+ E LE+ R 
Sbjct: 61  NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCYCTEEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ +E E+   E +K  +R  VP      F D V GE+    +
Sbjct: 121 EQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGKVIAFNDIVKGEISFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  IDD+LMK+THV RGE+ IS+ PK I++YQ F + IP+F 
Sbjct: 181 GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIYQAFGWDIPQFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ LL       ++EL   +Q
Sbjct: 241 HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFIGLLGWS-PVGEEELFTKEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
            I  FD++ LSK+ A+FD  KL W+N +++++ L   + +      +++           
Sbjct: 300 FIEIFDVNRLSKSPALFDMHKLKWVNNQYVKK-LDLDQVVELTLPHLQKAGKVGTELSAE 358

Query: 350 -KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
            ++ + + ++L   +++  + + ++TD  F  ++    E+     L  E++ ++L T   
Sbjct: 359 EQEWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEA--KAVLEEEQVPEVLSTFAA 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E ++ +  +NI+ +++ V +      K +  P+ +A+TG  +   L  SIE++G+   
Sbjct: 417 KLEELEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGKETA 476

Query: 469 YFRLRH 474
             RL++
Sbjct: 477 IQRLKN 482


>gi|326389886|ref|ZP_08211450.1| glutamyl-tRNA synthetase [Thermoanaerobacter ethanolicus JW 200]
 gi|325994154|gb|EGD52582.1| glutamyl-tRNA synthetase [Thermoanaerobacter ethanolicus JW 200]
          Length = 479

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 181/490 (36%), Positives = 272/490 (55%), Gaps = 20/490 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VRVR APSPTG  HIG A TALFN+L A+  GGKFILR++DTD +RST ES   +++
Sbjct: 1   MSEVRVRFAPSPTGSLHIGGARTALFNWLFARHNGGKFILRVDDTDLQRSTEESMKGILE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            L+W G++WDEG        P  QS+R   Y+ +   LLE+  A+ CFC+ E LEEMR+ 
Sbjct: 61  GLRWLGIDWDEG--------PIYQSQRIEEYRKFANKLLEEGKAYYCFCTKEELEEMRKQ 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             K   P  Y G C  L+ ++IE   ++ +K V+RL VP QG  V  D + G++E   + 
Sbjct: 113 AEKEGRPPMYTGKCRNLTKEQIEEHLRQGRKPVIRLKVPQQGKTVVHDVIRGDVEFDNST 172

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
            D  +++KSD MPTY+ A V+DD+ M ITHV R EE +S+ PK IL+Y+     IP+F H
Sbjct: 173 FDDFIIMKSDNMPTYNFATVVDDYQMGITHVIRAEEHLSNTPKQILIYEALGVEIPQFAH 232

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + ++  PD+SKLSKR   TS+  +   GYLPEA++N++ LL     +D +E+ D+ + I 
Sbjct: 233 VSMVLAPDRSKLSKRHGATSVQEFRDQGYLPEAIVNYITLLG-WMPKDGEEIFDVSKSIK 291

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLT 354
            F L  +SK  AV+D QKL W+NG +IR      +    V  +           + D + 
Sbjct: 292 EFTLERVSKNPAVYDVQKLTWINGHYIRN-YDLDKLTEAVIPFLKAKNLIREDFDYDYIK 350

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + ++  + R  TL  +     + F        +  K      E+++DILK      + I+
Sbjct: 351 KIVSAVREREKTLVDIADAMSYYFTEVNEYEEKGVKK-YFTKEKVVDILKKAVVTLKEIE 409

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            + +   E A R + +  + S   +  P  LAI+G  +   LFD +E+LG+     R+  
Sbjct: 410 PFNKFTTEEAYRKLVEELQISSGELFHPTRLAISGRTFGPGLFDIMELLGKERTIERIEK 469

Query: 475 AIALVSSLVQ 484
           AI  +  + +
Sbjct: 470 AIDFIEKMRK 479


>gi|307266904|ref|ZP_07548423.1| glutamyl-tRNA synthetase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918061|gb|EFN48316.1| glutamyl-tRNA synthetase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 479

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 181/490 (36%), Positives = 272/490 (55%), Gaps = 20/490 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VRVR APSPTG  HIG A TALFN+L A+  GGKFILR++DTD +RST ES   +++
Sbjct: 1   MSEVRVRFAPSPTGSLHIGGARTALFNWLFARHNGGKFILRVDDTDLQRSTEESMKGILE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            L+W G++WDEG        P  QS+R   Y+ +   LLE+  A+ CFC+ E LEEMR+ 
Sbjct: 61  GLRWLGIDWDEG--------PIYQSQRIEEYRKFANKLLEEGKAYYCFCTKEELEEMRKQ 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             K   P  Y G C  L+ ++IE   ++ +K V+RL VP QG  V  D + G++E   + 
Sbjct: 113 AEKEGRPPMYTGKCRNLTKEQIEEHLRQGRKPVIRLKVPQQGKTVVHDVIRGDVEFDNST 172

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
            D  +++KSD MPTY+ A V+DD+ M ITHV R EE +S+ PK IL+Y+     IP+F H
Sbjct: 173 FDDFIIMKSDNMPTYNFATVVDDYQMGITHVIRAEEHLSNTPKQILIYEALGVEIPQFAH 232

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + ++  PD+SKLSKR   TS+  +   GYLPEA++N++ LL     +D +E+ D+ + I 
Sbjct: 233 VSMVLAPDRSKLSKRHGATSVQEFRDQGYLPEAIVNYITLLG-WMPKDGEEIFDVSKSIK 291

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLT 354
            F L  +SK  AV+D QKL W+NG +IR      +    V  +           + D + 
Sbjct: 292 EFTLERVSKNPAVYDVQKLTWINGHYIRN-YDLDKLTEAVIPFLKAKNLIREDFDYDYIK 350

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + ++  + R  TL  +     + F        +  K      E+++DILK      + I+
Sbjct: 351 KIVSAVREREKTLVDIAGAMSYYFTEVNEYEEKGVKK-YFTKEKVVDILKKAVVTLKEIE 409

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            + +   E A R + +  + S   +  P  LAI+G  +   LFD +E+LG+     R+  
Sbjct: 410 PFNKFTTEEAYRKLVEELQISSGELFHPTRLAISGRTFGPGLFDIMELLGKERTIERIEK 469

Query: 475 AIALVSSLVQ 484
           AI  +  + +
Sbjct: 470 AIDFIEKMRK 479


>gi|294496960|ref|YP_003560660.1| glutamyl-tRNA synthetase [Bacillus megaterium QM B1551]
 gi|294346897|gb|ADE67226.1| glutamyl-tRNA synthetase [Bacillus megaterium QM B1551]
          Length = 485

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 179/485 (36%), Positives = 273/485 (56%), Gaps = 18/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            SS+VRVR APSPTG  HIG A TALFNYL A+   GKFI+RIEDTD KR+    E + +
Sbjct: 1   MSSEVRVRYAPSPTGHLHIGNARTALFNYLFARNQNGKFIIRIEDTDQKRNIEGGEESQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           + LKW G+ WDE  D+GG YGPYRQSER  IYQ Y + LLEK LA+ C+C++E LE+ R 
Sbjct: 61  RYLKWLGIEWDESIDVGGEYGPYRQSERTEIYQKYTEELLEKGLAYHCYCTSEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q+  +   RY G C  L++++   L  E ++  +R  VP+     + D V  E+     
Sbjct: 121 EQQANSQMPRYSGKCRNLTAEQRAELEAEGREPSIRFRVPSNKEIKWNDIVKDEVSFESE 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  IDD+LMK+THV RG++ IS+ PK IL+Y+   +  P F 
Sbjct: 181 GIGDFVIVKKDGTPTYNYAVAIDDYLMKMTHVLRGDDHISNTPKQILVYEALGWTPPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ +L       ++E+   +Q
Sbjct: 241 HMTLIVNENRRKLSKRDESIIQFIEQYKELGYLPEALFNFITMLGWS-PVGEEEIFSKEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MK 348
            I  FD   LSK+ A+FD  KL W+N ++++ +L   E ++                  +
Sbjct: 300 FIEIFDPARLSKSPALFDTSKLRWMNNQYMK-QLDLDEVVALSVPHLVKAGKVEETRDAE 358

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
            +  +   + L Q +++  + + ++T+  FK ++  + E+     L  E++ ++LK   E
Sbjct: 359 TEQWVRDLVALYQEQMSFGAEIVELTEMFFKKEIDYSEEA--KAVLAEEQVPEVLKAFAE 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           E   ++ +  + I+ A + V +   +  K +  P+ +A TG  +   L  +I +LG+  V
Sbjct: 417 EISSLEEFSADEIKAATKAVQKATGQKGKKLFMPIRVATTGETHGPELPKAISLLGKETV 476

Query: 469 YFRLR 473
             RL 
Sbjct: 477 LARLE 481


>gi|78042984|ref|YP_361145.1| glutamyl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901]
 gi|115298497|sp|Q3A9N9|SYE_CARHZ RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|77995099|gb|ABB13998.1| glutamyl-tRNA synthetase [Carboxydothermus hydrogenoformans Z-2901]
          Length = 480

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 187/478 (39%), Positives = 272/478 (56%), Gaps = 16/478 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  HIG A +ALFNYL A++  G FI+RIEDTD +RS+ ESE  +++SLK
Sbjct: 2   VRVRFAPSPTGPLHIGGARSALFNYLFARKNNGVFIVRIEDTDLERSSRESEKNILESLK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEG ++GG  GPYRQ+ER ++YQ Y Q L+E+  A+ CFC+ E LEE R+    
Sbjct: 62  WLGITWDEGIEVGGENGPYRQTERLDLYQKYAQKLIEEGFAYYCFCTEEELEEERKNLLA 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           +    RY G C  L+ ++ E+   E +K  VR  VP   + V  D V G +    + +  
Sbjct: 122 KGEMPRYLGKCRNLTPEQKEKYLAEGRKPTVRFKVPAGRTIVINDLVRGVVSFETDGIGD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +++KSDG+PTY+ A VIDD  M ITHV RGEE +S+ P+ IL+Y+   F IPEF H+ L
Sbjct: 182 FIIVKSDGIPTYNFAVVIDDVTMGITHVLRGEEHLSNTPRQILIYEALGFKIPEFAHISL 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D++K+SKR   TS+  Y   GYLPEAL+NFLALL      + +E+  M+QLI  F 
Sbjct: 242 ILGKDRTKMSKRHGATSVENYREKGYLPEALVNFLALLGWSPGTE-EEIFTMEQLIERFS 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQA---------- 356
           L  ++K  A+FD  KL+W+NG +IR     +  +     + +    ++Q           
Sbjct: 301 LDRVAKNPAIFDLDKLNWINGYYIRN-SELSRIVELSLPFFQSCGYVSQNPTEEEMRKLT 359

Query: 357 --LTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
             +   +  + TLS LP+     ++ +L    E+   T L  EE  +IL+   ++   I 
Sbjct: 360 KVVEATREYVVTLSELPEHAAIFYQKELAFEEEA--KTLLADEEARNILRKVADKLREIP 417

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRL 472
             + E I+  L+ + +      K +  PL  A+TG  +   L+  I ILG +    R+
Sbjct: 418 GSEEEEIKGFLKKLPKELGVGGKKVYMPLRAALTGKTHGPELYQVIAILGPAEAERRI 475


>gi|167040725|ref|YP_001663710.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X514]
 gi|300914763|ref|ZP_07132079.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X561]
 gi|307724003|ref|YP_003903754.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X513]
 gi|238687628|sp|B0K403|SYE2_THEPX RecName: Full=Glutamyl-tRNA synthetase 2; AltName:
           Full=Glutamate--tRNA ligase 2; Short=GluRS 2
 gi|166854965|gb|ABY93374.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X514]
 gi|300889698|gb|EFK84844.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X561]
 gi|307581064|gb|ADN54463.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X513]
          Length = 479

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 178/490 (36%), Positives = 272/490 (55%), Gaps = 20/490 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VRVR APSPTG  HIG A TALFN+L A+  GGKFILR++DTD +RST ES   +++
Sbjct: 1   MSEVRVRFAPSPTGSLHIGGARTALFNWLFARHNGGKFILRVDDTDLQRSTEESMKGILE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            LKW G++WDEG        P  QS+R   Y+ +   LL++  A+ CFC+ E LEEMR+ 
Sbjct: 61  GLKWLGIDWDEG--------PIYQSQRLEEYRKFANKLLKEGKAYYCFCTKEELEEMRKQ 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             K   P  Y G C  L+ ++IE   ++ KK V+RL VP QG  V  D + G++E   + 
Sbjct: 113 AEKEGRPPMYTGKCRNLTKEQIEEYLRQGKKPVIRLKVPQQGKTVVHDIIRGDVEFDNST 172

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
            D  +++KSD MPTY+ A V+DD+ M ITHV R EE +S+ PK IL+++     IP+F H
Sbjct: 173 FDDFIIMKSDNMPTYNFATVVDDYQMGITHVIRAEEHLSNTPKQILIFEALGLEIPQFAH 232

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + ++  PD+SKLSKR   TS+  +   GYLPEA++N++ LL     +D +E+ D+ + I 
Sbjct: 233 VSMVLAPDRSKLSKRHGATSVQEFRDQGYLPEAIVNYITLLG-WIPKDGEEIFDVSKSIK 291

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLT 354
            F L  +SK  A++D QKL W+NG +IR      +    V  +           + D + 
Sbjct: 292 EFTLERVSKNPAIYDVQKLTWINGHYIRN-YDLDKLTEVVIPFLKAKNFIGEDFDYDYIK 350

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + +++ + R  TL  +     + F        +  K      E+++DILK      + ++
Sbjct: 351 KIVSVVREREKTLVDVADAMSYYFTEVNEYEEKGVKK-YFTKEKVVDILKKAVVTLKEVE 409

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            + +   E   R + +  + S   +  P  LAI+G  +   LFD +E+LG+     R+  
Sbjct: 410 PFNKFTTEETYRKLVEELQISSGELFHPTRLAISGRTFGPGLFDIMELLGKERTIKRIEK 469

Query: 475 AIALVSSLVQ 484
           AI  +  + +
Sbjct: 470 AIDFIQKMRK 479


>gi|212637931|ref|YP_002314451.1| glutamyl-tRNA synthetase [Anoxybacillus flavithermus WK1]
 gi|212559411|gb|ACJ32466.1| Glutamyl-tRNA synthetase [Anoxybacillus flavithermus WK1]
          Length = 486

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 183/489 (37%), Positives = 286/489 (58%), Gaps = 19/489 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + +VRVR APSPTG  HIG A TALFNYL A+   GKFI+RIEDTD +R+    E + +
Sbjct: 1   MTQEVRVRYAPSPTGHLHIGGARTALFNYLFARHHHGKFIVRIEDTDIERNVEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++LKW G+ +DE  D  G YGPYRQ+ER +IY+ Y   LLEK  A++CFC+ E LE+ R 
Sbjct: 61  ENLKWLGIEYDESVDKDGGYGPYRQTERLHIYRQYTNELLEKGYAYKCFCTPEELEQERE 120

Query: 123 AQRKRNIPSRYD-GHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           AQ+   I +    G C  L+ +++++L  E K + +RL VP      F+D V G +    
Sbjct: 121 AQKAAGIAAPQYSGKCRHLTPEQVQQLESEGKPYTIRLKVPEGKVYEFEDMVRGHVSFES 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             +   V++K++G+PTY+ A VIDDHLMKITHV RGEE +S+ PK +++Y+YF +  P++
Sbjct: 181 KDIGDWVIVKANGIPTYNFAVVIDDHLMKITHVFRGEEHLSNTPKQLMVYEYFGWEPPKY 240

Query: 242 IHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            HL LI N ++ KLSKR       +S Y  +GYLPEA+ NF ALL      + +E+   +
Sbjct: 241 AHLTLIVNENRKKLSKRDESIIQFVSQYKELGYLPEAMFNFFALLGWSPEGE-EEIFTKE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD+  LSK+ ++FDKQKL W+N ++I++ L     +                   
Sbjct: 300 ELIRIFDVSRLSKSPSMFDKQKLTWMNNQYIKK-LDLDRLVELSLPHLIRAGRLPEQMTD 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           ++K      + L Q +++  + + +++D  FK ++    E+     L  E++ ++LK   
Sbjct: 359 EQKQWARDLIALYQEQMSYGAEIVELSDLFFKQEIEYDEEA--KAVLAGEQVPNVLKAFY 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           E+ E +  +  E+I+ A++ V +   +  K +  P+ +A+TG  +   L ++I +LG+  
Sbjct: 417 EQMEQLATFDSEHIKAAIKAVQKETGQKGKNLFMPIRVAVTGQTHGPELPEAIRLLGKET 476

Query: 468 VYFRLRHAI 476
           V  RL   I
Sbjct: 477 VMSRLAQFI 485


>gi|296333089|ref|ZP_06875543.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672791|ref|YP_003864462.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296149705|gb|EFG90600.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411034|gb|ADM36152.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 483

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 181/486 (37%), Positives = 282/486 (58%), Gaps = 18/486 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+R+EDTD KR+    E + +
Sbjct: 1   MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDKKRNIEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW G++WDE  D+GG YGPYRQSER +IY+ Y + LLEK LA++C+C+ E LE+ R 
Sbjct: 61  NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCYCTEEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ +E E+   E +K  +R  VP      F D V GE+    +
Sbjct: 121 EQIARGEMPRYSGKHRNLTQEEQEKFIAEGRKPSIRFRVPEGKIIAFNDIVKGEISFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  IDD+LMK+THV RGE+ IS+ PK I+++Q F + IP+F 
Sbjct: 181 GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIFQAFGWDIPQFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ LL       ++EL   +Q
Sbjct: 241 HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFIGLLGWS-PVGEEELFTKEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
            I  FD++ LSK+ A+FD  KL W+N +++++ L   + +      +++           
Sbjct: 300 FIDIFDVNRLSKSPALFDMHKLKWVNNQYVKK-LDLDQVVELTLPHLQKAGKVGAELSAE 358

Query: 350 -KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
            ++ + + ++L   +++  + + ++TD  F  ++    E+     L  E++ ++L T   
Sbjct: 359 EQEWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEA--KAVLEEEQVPEVLSTFAA 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E ++ +  +NI+ +++ V +      K +  P+ +A+TG  +   L  SIE++G+   
Sbjct: 417 KLEELEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGKETA 476

Query: 469 YFRLRH 474
             RL++
Sbjct: 477 IQRLKN 482


>gi|159186179|ref|NP_356183.2| glutamyl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
 gi|30316175|sp|Q8U7H5|SYE_AGRT5 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|159141313|gb|AAK88968.2| glutamyl-tRNA synthetase [Agrobacterium tumefaciens str. C58]
          Length = 485

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 288/482 (59%), Positives = 367/482 (76%), Gaps = 1/482 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RSTLE E  V
Sbjct: 1   MTTSGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTLEYEQKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++L+W GL W EGPD+GG YGPYRQSERK +Y PY + LLEK  AFRCFC+ ERLE+MR
Sbjct: 61  LEALRWTGLTWSEGPDVGGPYGPYRQSERKPMYWPYAEELLEKGHAFRCFCTPERLEQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P +YDG CL L ++E+       + +VVR+ +P +GSC F D VYG++ IPW
Sbjct: 121 EAQRAAGKPPKYDGLCLHLKAEEVTTRVAAGEANVVRMKIPTEGSCDFHDGVYGDVSIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           ++VDMQVL+K+DGMPTYH+ANVIDDHLMKITHVARGEEW++SVPKHILLY+YF +  P F
Sbjct: 181 DSVDMQVLIKADGMPTYHMANVIDDHLMKITHVARGEEWLASVPKHILLYRYFGWDQPTF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYYSA+GYLPEAL+NFL L F+ +  + +EL+ M++L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYSALGYLPEALMNFLGLFFI-QIAEGEELLTMEEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
              FD   LSKAGA+FD QKLDWLNGRW+REKL+  +F++R  +W  E  RLT+ L LAQ
Sbjct: 300 AAKFDPEALSKAGAIFDIQKLDWLNGRWLREKLTPEDFIARTLEWAMENSRLTEGLKLAQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           SRI+ L  LP +  FL  SD+ LT  SF      PEEI +IL T   + E +  W  E I
Sbjct: 360 SRISKLGELPNLAGFLVSSDVGLTPASFAGLKSKPEEIHEILTTVAADLEKMPDWNVEAI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
           E  LR++A+   K L+++  PLF+A++GS  SLPLFDS+ +LGRSVV  RL+ AIA+V++
Sbjct: 420 EAELRDIAERTGKKLRVVTPPLFVAVSGSSRSLPLFDSMALLGRSVVRQRLKVAIAVVAT 479

Query: 482 LV 483
           +V
Sbjct: 480 MV 481


>gi|332717135|ref|YP_004444601.1| glutamyl-tRNA synthetase [Agrobacterium sp. H13-3]
 gi|325063820|gb|ADY67510.1| glutamyl-tRNA synthetase [Agrobacterium sp. H13-3]
          Length = 485

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 288/486 (59%), Positives = 368/486 (75%), Gaps = 1/486 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RSTLE E  V
Sbjct: 1   MTTSGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTLEYEQKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++L+W GL W EGPD+GG YGPYRQSERK +Y PY + LLEK  AFRCFC+ ERLE+MR
Sbjct: 61  LEALRWTGLTWSEGPDVGGPYGPYRQSERKPMYWPYAEELLEKGHAFRCFCTPERLEQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P +YDG CL L ++E+       + +VVR+ +P +GSC F D VYG++ IPW
Sbjct: 121 EAQRAAGKPPKYDGLCLHLKAEEVTTRVAAGEANVVRMKIPTEGSCDFHDGVYGDVSIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           ++VDMQVL+K+DGMPTYH+ANVIDDHLMKITHVARGEEW++SVPKHILLY+YF +  P F
Sbjct: 181 DSVDMQVLIKADGMPTYHMANVIDDHLMKITHVARGEEWLASVPKHILLYRYFGWDQPTF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYYSA+GYLPEAL+NFL L F+ +  + +EL+ M++L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYSALGYLPEALMNFLGLFFI-QIAEGEELLTMEEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
              FD   LSKAGA+FD QKLDWLNGRW+REKL+  +F++R  +W  E  RLT+ L LAQ
Sbjct: 300 AAKFDPEALSKAGAIFDIQKLDWLNGRWLREKLTPEDFIARTLEWAMENSRLTEGLKLAQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           SRI+ L  LP +  FL  SD+ LT  SF      PEEI +IL T   + E +  W  E I
Sbjct: 360 SRISKLGELPNLAGFLLSSDVGLTPASFAGLKSKPEEIHEILTTVATDLEKMPDWNVEAI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
           E  LR++A+   K L+++  PLF+A++GS  SLPLFDS+ +LGRSVV  RL+ AIA+V++
Sbjct: 420 EAELRDIAERTGKKLRVVTPPLFVAVSGSSRSLPLFDSMALLGRSVVRQRLKVAIAVVAT 479

Query: 482 LVQNHK 487
           +V +  
Sbjct: 480 MVGSGA 485


>gi|321313762|ref|YP_004206049.1| glutamyl-tRNA synthetase [Bacillus subtilis BSn5]
 gi|291482464|dbj|BAI83539.1| glutamyl-tRNA synthetase [Bacillus subtilis subsp. natto BEST195]
 gi|320020036|gb|ADV95022.1| glutamyl-tRNA synthetase [Bacillus subtilis BSn5]
          Length = 483

 Score =  389 bits (1000), Expect = e-106,   Method: Composition-based stats.
 Identities = 182/486 (37%), Positives = 282/486 (58%), Gaps = 18/486 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+R+EDTD KR+    E + +
Sbjct: 1   MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDKKRNIEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW G++WDE  D+GG YGPYRQSER +IY+ Y + LLEK LA++C+C+ E LE+ R 
Sbjct: 61  NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCYCTEEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ +E E+   E +K  +R  VP      F D V GE+    +
Sbjct: 121 EQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGKIIAFNDIVKGEISFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  IDD+LMK+THV RGE+ IS+ PK I++YQ F + IP+F 
Sbjct: 181 GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIYQAFGWDIPQFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ LL       ++EL   +Q
Sbjct: 241 HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFIGLLGWS-PVGEEELFTKEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
            I  FD++ LSK+ A+FD  KL W+N +++++ L   + +      +++           
Sbjct: 300 FIEIFDVNRLSKSPALFDMHKLKWVNNQYVKK-LDLDQVVELTLPHLQKAGKVGTELSAE 358

Query: 350 -KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
            ++ + + ++L   +++  + + ++TD  F  ++    E+     L  E++ ++L T   
Sbjct: 359 EQEWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEA--KAVLEEEQVPEVLSTFAA 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E ++ +  +NI+ +++ V +      K +  P+ +A+TG  +   L  SIE++G+   
Sbjct: 417 KLEELEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGKETA 476

Query: 469 YFRLRH 474
             RL++
Sbjct: 477 IQRLKN 482


>gi|169831684|ref|YP_001717666.1| glutamyl-tRNA synthetase [Candidatus Desulforudis audaxviator
           MP104C]
 gi|238688340|sp|B1I4Z1|SYE_DESAP RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|169638528|gb|ACA60034.1| glutamyl-tRNA synthetase [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 501

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 175/497 (35%), Positives = 272/497 (54%), Gaps = 15/497 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  HIG A TALFN+L A+  GG FILR+EDTD+ R+  E+   ++ SL+
Sbjct: 4   VRVRFAPSPTGSLHIGGARTALFNWLFARHHGGAFILRLEDTDTGRNIDEAAAQIVSSLR 63

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G++WDEG D GG +GPYRQSER  +Y+   + LL    A+ C+C+ E L   R   R+
Sbjct: 64  WLGIDWDEGYDRGGPFGPYRQSERFELYREEARRLLANGDAYWCYCTPEDLAAQREEARQ 123

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           R    RYDG C +L+            +  +R+ +P  G+ V +D++ GE+      +D 
Sbjct: 124 RGEVPRYDGRCRQLTDDARREKEAAGIRPALRVKMPKTGTTVVKDRIRGEIGFDNATLDD 183

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +++KS+G PTY+ A V+DD  M+I+HV R EE +S+ PK I+L+    + +PEF+H+P+
Sbjct: 184 IIVMKSNGGPTYNFACVVDDGAMRISHVIRAEEHLSNTPKQIVLFNLLGYALPEFVHVPM 243

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD+SKLSKR   T++  + A G+LPEALIN+LALL      + +    +++L+  F 
Sbjct: 244 ILAPDRSKLSKRHGATAVDEFRADGFLPEALINYLALLGWSPGSEQE-QFTVEELVASFS 302

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIR-----------EKLSTTEFLSRVSQWMKEKDRLTQ 355
           L  +SK  A++D +KL WLN +++                        +    E D L++
Sbjct: 303 LDAVSKHAAIYDVKKLTWLNAQYLNSLPQARVVEAVRPFMQEAGYLSATPNPAELDYLSR 362

Query: 356 ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
            +   +SR+ TL+ L   + + ++SD     +  +     P  + +IL   ++    +  
Sbjct: 363 VVEAVRSRVHTLAELRDASAYFYRSDFEYDDKGVRKHFTKP-GVTNILARGRDALSRLPA 421

Query: 416 --WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
             +  E  E A R V +    S   ++ P  LA++G      LFD I +LG+     RL 
Sbjct: 422 GRFTVEGTEEAFRQVIEELGVSGGTLIHPTRLALSGRTVGPGLFDIIAVLGKEECLLRLD 481

Query: 474 HAIALVSSLVQNHKKKE 490
            AIA + + V N  + +
Sbjct: 482 RAIAWIGANVNNANRTD 498


>gi|56418618|ref|YP_145936.1| glutamyl-tRNA synthetase [Geobacillus kaustophilus HTA426]
 gi|67461632|sp|Q5L431|SYE_GEOKA RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|56378460|dbj|BAD74368.1| glutamyl-tRNA synthetase (glutamate--tRNA ligase) [Geobacillus
           kaustophilus HTA426]
          Length = 490

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 177/490 (36%), Positives = 277/490 (56%), Gaps = 20/490 (4%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + +VRVR APSPTG  HIG A TALFNYL A+  GGK I+RIEDTD +R+    E + +
Sbjct: 1   MAKEVRVRYAPSPTGHLHIGGARTALFNYLFARHHGGKMIVRIEDTDIERNVEGGEKSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++LKW G+++DE  D  G YGPYRQ+ER +IY+ YV  LLE+  A++CFC+ E LE  R 
Sbjct: 61  ENLKWLGIDYDESIDQDGGYGPYRQTERLDIYRKYVNELLEQGHAYKCFCTPEELERERE 120

Query: 123 AQRKRNIPSRYD-GHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           AQR   I +    G C  L+ +++  L  + K + +RL VP   +  F D V G++    
Sbjct: 121 AQRAAGIAAPQYSGKCRHLTPEQVAELEAQGKPYTIRLKVPEGKTYEFYDLVRGKVVFES 180

Query: 182 NAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
             V    V++K++G+PTY+ A VIDDHLM+I+HV RGEE +S+ PK +++Y+YF +  P+
Sbjct: 181 KDVGGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHLSNTPKQLMVYEYFGWEPPQ 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F HL LI N  + KLSKR       +S Y  +GYLPEA+ NF ALL      + +E+   
Sbjct: 241 FAHLTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMFNFFALLGWSPEGE-EEIFTK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------ 346
            +LI  FD+  LSK+ ++FD +KL W+N ++I++ L     +                  
Sbjct: 300 DELIRMFDVSRLSKSPSMFDTKKLTWMNNQYIKK-LDLDRLVELALPHLVKAGRLPADMT 358

Query: 347 MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
            +++      + L Q +++  + +  +++  FK    +  E      L  E++  +L T 
Sbjct: 359 DEQRQWARDLIALYQEQMSYGAEIVPLSELFFKE--EIDYEDEARQVLAEEQVPAVLSTF 416

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
            E    ++ +  + I+ A++ V +   +  K +  P+  A+TG  +   L  +I++LG+ 
Sbjct: 417 LESVRELEPFTADEIKAAIKAVQKATGQKGKKLFMPIRAAVTGQTHGPELPFAIQLLGKE 476

Query: 467 VVYFRLRHAI 476
            V  RL  A+
Sbjct: 477 KVIERLERAL 486


>gi|55980407|ref|YP_143704.1| glutamyl-tRNA synthetase [Thermus thermophilus HB8]
 gi|62296638|sp|P27000|SYE_THET8 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|28948411|pdb|1J09|A Chain A, Crystal Structure Of Thermus Thermophilus Glutamyl-Trna
           Synthetase Complexed With Atp And Glu
 gi|28948740|pdb|1N75|A Chain A, Crystal Structure Of Thermus Thermophilus Glutamyl-Trna
           Synthetase Complexed With Atp.
 gi|28948742|pdb|1N77|A Chain A, Crystal Structure Of Thermus Thermophilus Glutamyl-Trna
           Synthetase Complexed With Trna(Glu) And Atp.
 gi|28948743|pdb|1N77|B Chain B, Crystal Structure Of Thermus Thermophilus Glutamyl-Trna
           Synthetase Complexed With Trna(Glu) And Atp.
 gi|28948746|pdb|1N78|A Chain A, Crystal Structure Of Thermus Thermophilus Glutamyl-Trna
           Synthetase Complexed With Trna(Glu) And Glutamol-Amp.
 gi|28948747|pdb|1N78|B Chain B, Crystal Structure Of Thermus Thermophilus Glutamyl-Trna
           Synthetase Complexed With Trna(Glu) And Glutamol-Amp.
 gi|114793637|pdb|2CUZ|A Chain A, Glutamyl-Trna Synthetase From Thermus Thermophilus In
           Complex With L-Glutamate
 gi|114793638|pdb|2CV0|A Chain A, Glutamyl-Trna Synthetase From Thermus Thermophilus In
           Complex With Trna(Glu) And L-Glutamate
 gi|114793639|pdb|2CV0|B Chain B, Glutamyl-Trna Synthetase From Thermus Thermophilus In
           Complex With Trna(Glu) And L-Glutamate
 gi|114793642|pdb|2CV1|A Chain A, Glutamyl-Trna Synthetase From Thermus Thermophilus In
           Complex With Trna(Glu), Atp, And An Analog Of
           L-Glutamate: A Quaternary Complex
 gi|114793643|pdb|2CV1|B Chain B, Glutamyl-Trna Synthetase From Thermus Thermophilus In
           Complex With Trna(Glu), Atp, And An Analog Of
           L-Glutamate: A Quaternary Complex
 gi|114793646|pdb|2CV2|A Chain A, Glutamyl-Trna Synthetase From Thermus Thermophilus In
           Complex With Trna(Glu) And An Enzyme Inhibitor, Glu-Ams
 gi|114793647|pdb|2CV2|B Chain B, Glutamyl-Trna Synthetase From Thermus Thermophilus In
           Complex With Trna(Glu) And An Enzyme Inhibitor, Glu-Ams
 gi|118137631|pdb|2DXI|A Chain A, 2.2 A Crystal Structure Of Glutamyl-Trna Synthetase From
           Thermus Thermophilus Complexed With Trna(Glu), Atp, And
           L- Glutamol
 gi|118137632|pdb|2DXI|B Chain B, 2.2 A Crystal Structure Of Glutamyl-Trna Synthetase From
           Thermus Thermophilus Complexed With Trna(Glu), Atp, And
           L- Glutamol
 gi|55771820|dbj|BAD70261.1| glutamyl-tRNA synthetase [Thermus thermophilus HB8]
          Length = 468

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 191/478 (39%), Positives = 283/478 (59%), Gaps = 18/478 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V  RIAPSPTG+PH+GTAY ALFNY  A+R GG+FI+RIEDTD  R    +E  ++ +LK
Sbjct: 2   VVTRIAPSPTGDPHVGTAYIALFNYAWARRNGGRFIVRIEDTDRARYVPGAEERILAALK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL++DEGPD+GG +GPYRQSER  +YQ Y + LL++  A+R F + E LE++R+ +  
Sbjct: 62  WLGLSYDEGPDVGGPHGPYRQSERLPLYQKYAEELLKRGWAYRAFETPEELEQIRKEKGG 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
            +      G    +  +E E  ++  + HV+RL VP  G+   +D++ G +      +  
Sbjct: 122 YD------GRARNIPPEEAEERARRGEPHVIRLKVPRPGTTEVKDELRGVVVYDNQEIPD 175

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            VLLKSDG PTYHLANV+DDHLM +T V R EEW+ S P H+LLY+ F +  P F H+PL
Sbjct: 176 VVLLKSDGYPTYHLANVVDDHLMGVTDVIRAEEWLVSTPIHVLLYRAFGWEAPRFYHMPL 235

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDK+K+SKR++ TS+ +Y A G+LPEAL N+L L+     +  + +  +++ I  F 
Sbjct: 236 LRNPDKTKISKRKSHTSLDWYKAEGFLPEALRNYLCLMGFSMPDGRE-IFTLEEFIQAFT 294

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-------MKEKDRLTQALTL 359
              +S  G VFD +KL W+NG++IRE LS  E   RV  +        + +  L +A+ L
Sbjct: 295 WERVSLGGPVFDLEKLRWMNGKYIREVLSLEEVAERVKPFLREAGLSWESEAYLRRAVEL 354

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            + R  TL   P+   +LF  D  ++ ++ +      EE + +LK         + W   
Sbjct: 355 MRPRFDTLKEFPEKARYLFTEDYPVSEKAQRKL----EEGLPLLKELYPRLRAQEEWTEA 410

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            +E  LR  A  +   L  + +PL  A+TGS  +  LF+ + +LG+     RL  A+A
Sbjct: 411 ALEALLRGFAAEKGVKLGQVAQPLRAALTGSLETPGLFEILALLGKERALRRLERALA 468


>gi|15966656|ref|NP_387009.1| glutamyl-tRNA synthetase [Sinorhizobium meliloti 1021]
 gi|307300309|ref|ZP_07580089.1| glutamyl-tRNA synthetase [Sinorhizobium meliloti BL225C]
 gi|307319592|ref|ZP_07599018.1| glutamyl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|17380509|sp|P15189|SYE_RHIME RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|15075928|emb|CAC47482.1| Glutamyl-tRNA synthetase [Sinorhizobium meliloti 1021]
 gi|306894714|gb|EFN25474.1| glutamyl-tRNA synthetase [Sinorhizobium meliloti AK83]
 gi|306904475|gb|EFN35059.1| glutamyl-tRNA synthetase [Sinorhizobium meliloti BL225C]
          Length = 485

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 292/486 (60%), Positives = 367/486 (75%), Gaps = 1/486 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GGKFILRIEDTD+ RST E E  V
Sbjct: 1   MADSAVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGKFILRIEDTDATRSTPEFEKKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +LKWCGL W EGPDIGG YGPYRQS+RK+IY+PYV+ ++     FRCFC+ ERLE+MR
Sbjct: 61  LDALKWCGLEWSEGPDIGGPYGPYRQSDRKDIYKPYVEKIVANGHGFRCFCTPERLEQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P +YDG CL LS++E+       + HVVR+ +P +GSC F+D VYG++EIPW
Sbjct: 121 EAQRAAGKPPKYDGLCLSLSAEEVTSRVDAGEPHVVRMKIPTEGSCKFRDGVYGDVEIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
            AVDMQVLLK+DGMPTYH+ANV+DDHLMKITHVARGEEW++SVPKHIL+YQY     P F
Sbjct: 181 EAVDMQVLLKADGMPTYHMANVVDDHLMKITHVARGEEWLASVPKHILIYQYLGLEPPVF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYY+A+GYLPEAL+NFL L F+ +  + +EL+ M++L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYTALGYLPEALMNFLGLFFI-QIAEGEELLTMEEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
              FD  +LSKAGA+FD QKLDWLN RWIREKLS  EF +RV  W  + +RL + L L+Q
Sbjct: 300 AEKFDPENLSKAGAIFDIQKLDWLNARWIREKLSEEEFAARVLAWAMDNERLKEGLKLSQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           +RI+ L  LP +  FLFKSDL L   +F      PEE++ IL T Q + E I  W +++I
Sbjct: 360 TRISKLGELPDLAAFLFKSDLGLQPAAFAGVKASPEEMLKILNTVQPDLEKILEWNKDSI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
           ET LR  A+   K LK +V PLF+A +GS+ SLPLFDS+E+LGRSVV  RL+ A  +V+S
Sbjct: 420 ETELRASAERMGKKLKAVVAPLFVACSGSQRSLPLFDSMELLGRSVVRQRLKVAAQVVAS 479

Query: 482 LVQNHK 487
           +  + K
Sbjct: 480 MAGSGK 485


>gi|227823481|ref|YP_002827454.1| glutamyl-tRNA synthetase [Sinorhizobium fredii NGR234]
 gi|227342483|gb|ACP26701.1| glutamyl-tRNA synthetase [Sinorhizobium fredii NGR234]
          Length = 485

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 289/486 (59%), Positives = 371/486 (76%), Gaps = 1/486 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RST E E  V
Sbjct: 1   MADSAVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTPEFEKKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +LKWCGL W EGPDIGG YGPYRQS+RK+IY+P+V+ ++     FRCFC+ ERLE+MR
Sbjct: 61  LDALKWCGLTWSEGPDIGGPYGPYRQSDRKDIYKPFVEKIVANGHGFRCFCTPERLEQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P +YDG CL L+++E+    +  + HVVR+ +P +GSC F D VYG++EIPW
Sbjct: 121 EAQRAAGKPPKYDGLCLGLAAEEVTSRVEAGEPHVVRMKIPTEGSCKFHDGVYGDVEIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           +AVDMQVLLK+DGMPTYH+ANV+DDHLMKITHVARGEEW++SVPKHIL+Y+Y     P F
Sbjct: 181 DAVDMQVLLKADGMPTYHMANVVDDHLMKITHVARGEEWLASVPKHILIYRYLGLEPPVF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYY+A+GYLPEAL+NFL L F+ +  + +EL+ +++L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYTALGYLPEALMNFLGLFFI-QIAEGEELLTIEEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
              FD  +LSKAGA+FD QKLDWLN RWIREKLS  EF +RV  W  E DRL + L L+Q
Sbjct: 300 AGKFDPENLSKAGAIFDIQKLDWLNARWIREKLSEEEFAARVFAWASENDRLKEGLKLSQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           SRI+ L  LP ++ FLFKSDL L   +F      PEE++++L T Q + E I  W +E+I
Sbjct: 360 SRISKLGELPDLSAFLFKSDLGLQPAAFAGAKASPEEMLEVLNTVQPDLEKILEWNKESI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
           E  LR  A+   K LK +V PLF+A++GS+ SLPLFDS+E+LGR+VV  RL+ A  +V+S
Sbjct: 420 EAELRASAERMGKKLKAVVAPLFVAVSGSQRSLPLFDSMELLGRAVVRQRLKVAAQVVAS 479

Query: 482 LVQNHK 487
           +V + K
Sbjct: 480 MVGSGK 485


>gi|312898319|ref|ZP_07757709.1| glutamyl-tRNA synthetase [Megasphaera micronuciformis F0359]
 gi|310620238|gb|EFQ03808.1| glutamyl-tRNA synthetase [Megasphaera micronuciformis F0359]
          Length = 487

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 171/483 (35%), Positives = 258/483 (53%), Gaps = 13/483 (2%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S +VRVR APSPTG  HIG A +ALFNYL+A    G F++R+EDTD KRST ESE  + 
Sbjct: 1   MSKQVRVRFAPSPTGPFHIGGARSALFNYLVAAHNDGTFVVRVEDTDQKRSTRESEENIK 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++L W G+NWDEG D+GG +GPYRQ ER ++Y+ Y + LL +  A+ CFC+ E LE  + 
Sbjct: 61  EALHWLGINWDEGIDVGGDHGPYRQMERLDLYRQYTEKLLAEGKAYYCFCTPEELEAEKD 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  +     Y G C  LS ++I++   E + HV+R+  P   +    D V G++    +
Sbjct: 121 AQMAKGETPVYGGTCSHLSEEQIKQYLAEGRPHVIRIRTPKHKTYEVDDIVRGKVPFDSD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++KSDG+P Y+   V+DD LM+ITHV R EE +S+ P+ ++LY+   F  P+F 
Sbjct: 181 KIGDFVIVKSDGVPVYNYCVVLDDALMEITHVIRAEEHLSNTPRQLVLYEALGFEPPKFA 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+ LI   DK K+SKR   TS+  Y  MGYLPEAL NFLALL     + D E+   ++L 
Sbjct: 241 HVSLILGADKKKMSKRHGATSVQQYRDMGYLPEALFNFLALLG-WTPDSDKEIFSKEELC 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKEKD 351
             F L  ++K  AVFD +KL+W+N ++++E    +     +           +       
Sbjct: 300 SMFTLDRVAKNPAVFDIEKLNWINFQYMKELDGPSLVTLCLPHLQKAGYVSENPDANTLT 359

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
            +   +T  +  I   + +       F  +     E   +  L  E    +L    +E E
Sbjct: 360 WVETMVTALREHIQYGAQVTDAAKVFFTDEYEPENEET-ADVLKEETAPAVLTAFLKELE 418

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            +     + ++   + V +      K +  P+ +A+TG  +   L   I ++GR  V  R
Sbjct: 419 ALDEVTADTVQPLFKKVQKGVGVKGKFVYMPIRVALTGVMHGPDLNVIIALMGREKVVQR 478

Query: 472 LRH 474
           LR 
Sbjct: 479 LRR 481


>gi|150397997|ref|YP_001328464.1| glutamyl-tRNA synthetase [Sinorhizobium medicae WSM419]
 gi|187645693|sp|A6UD99|SYE_SINMW RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|150029512|gb|ABR61629.1| glutamyl-tRNA synthetase [Sinorhizobium medicae WSM419]
          Length = 485

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 290/486 (59%), Positives = 367/486 (75%), Gaps = 1/486 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RST E E  V
Sbjct: 1   MADSAVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTPEFEKKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +LKWCGL W EGPDIGG  GPYRQS+RK+IY+PYV+ ++     FRCFC+ ERLE+MR
Sbjct: 61  LDALKWCGLEWSEGPDIGGPCGPYRQSDRKDIYKPYVEQIVANGHGFRCFCTPERLEQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P +YDG CL LS++E+       + HVVR+ +P +GSC F+D VYG++EIPW
Sbjct: 121 EAQRAAGKPPKYDGLCLSLSAEEVTSRVAAGEPHVVRMKIPTEGSCKFRDGVYGDVEIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
            AVDMQVLLK+DGMPTYH+ANV+DDHLMKITHVARGEEW++SVPKHIL+YQY     P F
Sbjct: 181 EAVDMQVLLKADGMPTYHMANVVDDHLMKITHVARGEEWLASVPKHILIYQYLGLEPPVF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYY+A+GYLPEAL+NFL L F+ +  + +EL+ M +L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYTALGYLPEALMNFLGLFFI-QIAEGEELLTMAEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
              FD  +LSKAGA+FD QKLDWLN RWIREKLS  +F ++V  W  + DRL + L L+Q
Sbjct: 300 AEKFDPENLSKAGAIFDIQKLDWLNARWIREKLSEEQFAAKVLSWAMDNDRLREGLKLSQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           +RI+ L  LP +  FLFKSDL L   +F      PEE+++IL T Q + E I  W +E+I
Sbjct: 360 TRISKLGELPDLAAFLFKSDLGLQPAAFAGVKASPEEMLEILNTVQPDLEKILEWNKESI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
           ET LR  A+   K LK +V PLF+A++GS+ SLPLFDS+E+LGRSVV  RL+ A  +V+S
Sbjct: 420 ETELRACAERMGKKLKAVVAPLFVAVSGSQRSLPLFDSMELLGRSVVRQRLKVAAQVVAS 479

Query: 482 LVQNHK 487
           +  + K
Sbjct: 480 MAGSGK 485


>gi|312794407|ref|YP_004027330.1| glutamyl-tRNA synthetase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181547|gb|ADQ41717.1| glutamyl-tRNA synthetase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 485

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 184/480 (38%), Positives = 269/480 (56%), Gaps = 15/480 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           +VR R APSPTG  HIG A TALFNYL AKR GGKFILRIEDTD +RS++ESE  +++SL
Sbjct: 2   EVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIESL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W G+ WDEG ++GG YGPYR +ER +IY+ YV  L EK  A+ C+C+ E LE  R+   
Sbjct: 62  RWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAYYCYCTEEELEGQRQELL 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RY G C  L+ ++  R  QE +K  VR  VP     V  D V G++E   + + 
Sbjct: 122 SKGQMPRYLGKCRNLTEEQKRRFEQEGRKPTVRFKVPEGVKIVVHDLVRGDVEFMSDDIG 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V++KSDG+PTY+ A VIDDHLMKI+HV RGEE +S+ P+ IL+Y    F +P+F H+ 
Sbjct: 182 DFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALGFELPQFAHVS 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           LI   D++K+SKR   T +  Y   GYL E LINFLALL     ED + + DM+ LI +F
Sbjct: 242 LILGKDRTKMSKRHGSTWVEQYKEQGYLKEGLINFLALLGWSPPEDKE-IFDMEYLIKNF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------EKDRL 353
            L  +SK  A+FD  KL+++N + I+   S  E       +              + + L
Sbjct: 301 SLDRVSKNPAIFDIDKLNYINSQHIKL-KSLDELTQMCIPYFVEAGYIKEDEAQSKFEWL 359

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
            + +      +  LS +    D  F +++ +  +      L  E + D++   + +   +
Sbjct: 360 KKIVKSVYEGLDYLSQIKDRVDIFFNNEVKI-EDDEAKEVLKWEHVKDLINVFENKITQL 418

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
                ENI+   + + +      K +  P+ + +TG  +   L + IEI+G+  +  RL 
Sbjct: 419 NDLSSENIKALFKEIQKETGYKGKNLFMPIRVVLTGKTHGPELVEIIEIVGKENILKRLE 478


>gi|289578081|ref|YP_003476708.1| glutamyl-tRNA synthetase [Thermoanaerobacter italicus Ab9]
 gi|289527794|gb|ADD02146.1| glutamyl-tRNA synthetase [Thermoanaerobacter italicus Ab9]
          Length = 483

 Score =  388 bits (997), Expect = e-105,   Method: Composition-based stats.
 Identities = 174/493 (35%), Positives = 270/493 (54%), Gaps = 20/493 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
             +VRVR APSPTG  HIG A TALFN+L A+  GGKFILR++DTD +RST ES   ++ 
Sbjct: 1   MGEVRVRFAPSPTGSLHIGGARTALFNWLFARHYGGKFILRVDDTDLQRSTKESMKGILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            LKW G++WDEG        P  QS+R + Y+ +   LL++  A+ CFC+ E LEEMRR 
Sbjct: 61  GLKWLGIDWDEG--------PIYQSQRLDEYRKFANKLLDEGKAYYCFCTKEELEEMRRR 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
                 P  Y G C  L+ ++IE   ++ K+ V+RL VP++G  +  D + G++E   + 
Sbjct: 113 AENEGRPFMYTGKCRNLTREQIEEYLKKGKRPVIRLKVPSEGKTIVHDIIRGDVEFDNST 172

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  +++KSD MPTY+ A V+DD+ M ITHV R EE +S+ PK IL+Y+      P+F H
Sbjct: 173 IDDFIIMKSDNMPTYNFATVVDDYQMGITHVIRAEEHLSNTPKQILIYESLGLETPQFAH 232

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + ++  PD+SKLSKR   TS+  +   GYLPEA++N++ LL     +D +E+ D+ + I 
Sbjct: 233 VSMVLAPDRSKLSKRHGATSVQEFEEQGYLPEAIVNYITLLG-WMPKDGEEIFDVSKSIK 291

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLT 354
            F L  +SK  AV+D QKL W+NG +IR      +    V  +           + + + 
Sbjct: 292 EFTLERVSKNPAVYDVQKLTWINGHYIRN-YDLDKLTEAVIPFLKAKNFIVEDFDYEYIK 350

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + ++  + R  TL  +     + F        +  K      E++ +ILK   E  + ++
Sbjct: 351 KIVSTVREREKTLVDIADAMSYYFTEVNEYEEKGVKK-YFTKEKVAEILKKAAETLKEVE 409

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            + +   E   R + +  + S   +  P  LAI+G  +   LFD +E+LG+     R+  
Sbjct: 410 PFDKFTTEKVYRTLVEELQISSGELFHPTRLAISGRTFGPGLFDIMELLGKERTIQRIEK 469

Query: 475 AIALVSSLVQNHK 487
           A+  +  +    K
Sbjct: 470 ALDFIEKMKNPQK 482


>gi|46198378|ref|YP_004045.1| glutamyl-tRNA synthetase [Thermus thermophilus HB27]
 gi|67461809|sp|Q72LI9|SYE_THET2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|46196000|gb|AAS80418.1| glutamyl-tRNA synthetase [Thermus thermophilus HB27]
          Length = 468

 Score =  388 bits (997), Expect = e-105,   Method: Composition-based stats.
 Identities = 191/478 (39%), Positives = 283/478 (59%), Gaps = 18/478 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V  RIAPSPTG+PH+GTAY ALFNY  A+R GG+FI+RIEDTD  R    +E  ++ +LK
Sbjct: 2   VVTRIAPSPTGDPHVGTAYIALFNYAWARRNGGRFIVRIEDTDRARYVPGAEERILAALK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL++DEGPD+GG +GPYRQSER  +YQ Y + LL++  A+R F + E LE++R+ +  
Sbjct: 62  WLGLSYDEGPDVGGPHGPYRQSERLPLYQKYAEELLKRGWAYRAFETPEELEQIRKEKGG 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
            +      G    +  +E E  ++  + HV+RL VP  G+   +D++ G +      +  
Sbjct: 122 YD------GRARNIPPEEAEERARRGEPHVIRLKVPRPGTTEVKDELRGVVVYDNQEIPD 175

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            VLLKSDG PTYHLANV+DDHLM +T V R EEW+ S P H+LLY+ F +  P F H+PL
Sbjct: 176 VVLLKSDGYPTYHLANVVDDHLMGVTDVIRAEEWLVSTPIHVLLYRAFGWEAPRFYHMPL 235

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDK+K+SKR++ TS+ +Y A G+LPEAL N+L L+     +  + +  +++ I  F 
Sbjct: 236 LRNPDKTKISKRKSHTSLDWYKAEGFLPEALRNYLCLMGFSMPDGRE-IFTLEEFIQAFT 294

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-------MKEKDRLTQALTL 359
              +S  G VFD +KL W+NG++IRE LS  E   RV  +        + +  L +A+ L
Sbjct: 295 WERVSLGGPVFDLEKLRWMNGKYIREVLSLEEVAERVKPFLREAGLSWESEAYLRRAVEL 354

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            + R  TL   P+   +LF  D  ++ ++ +      EE + +LK         + W   
Sbjct: 355 MRPRFDTLKEFPEKARYLFTEDYPVSEKAQRKL----EEGLPLLKELYPRLRTQEEWTEA 410

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            +E  LR  A  +   L  + +PL  A+TGS  +  LF+ + +LG+     RL  A+A
Sbjct: 411 ALEALLRGFAAEKGVKLGQVAQPLRAALTGSLETPGLFEILALLGKERALRRLERALA 468


>gi|328551793|gb|AEB22285.1| glutamyl-tRNA synthetase [Bacillus amyloliquefaciens TA208]
 gi|328910053|gb|AEB61649.1| glutamyl-tRNA synthetase [Bacillus amyloliquefaciens LL3]
          Length = 483

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 182/485 (37%), Positives = 278/485 (57%), Gaps = 18/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+RIEDTD KR+    E + +
Sbjct: 1   MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDKKRNIEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW G++WDE  D+GG YGPYRQSER +IY+ Y + LLEK LA++CFC+ E LE+ R 
Sbjct: 61  NYLKWLGMDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCFCTEEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ +E E+   E ++  +R  VP      F D V GE+    +
Sbjct: 121 EQIARGEMPRYSGKHRNLTQEEQEQFLAEGRQPSIRFRVPEGKIIAFNDIVKGEISFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  IDD+LMK+THV RGE+ IS+ PK I+++Q F + IP F 
Sbjct: 181 GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIFQAFGWDIPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ LL       ++EL   +Q
Sbjct: 241 HMTLIVNESRKKLSKRDESIIQFIEQYEELGYLPEALFNFIGLLGWS-PVGEEELFTREQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
            I  FD++ LSK+ A+FD  KL W+N ++++  L   + +      +++           
Sbjct: 300 FIEIFDVNRLSKSPALFDMHKLKWVNNQYVKA-LDLDQVVELTLPHLQKAGKVGTELSAE 358

Query: 350 -KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
            ++ + + ++L   +++  + + ++TD  FK ++    E+     L  E++ ++L     
Sbjct: 359 EQEWVHKLISLYHEQLSYGAEIVELTDLFFKDEIEYNQEA--KAVLEEEQVPEVLSAFAA 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E ++ +  E I+ +++ V +      K +  P+ +A+TG  +   L  +IE++GR   
Sbjct: 417 KLEELEEFTPEQIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQAIELIGRETA 476

Query: 469 YFRLR 473
             RL+
Sbjct: 477 VKRLK 481


>gi|229550660|ref|ZP_04439385.1| glutamyl-tRNA synthetase [Enterococcus faecalis ATCC 29200]
 gi|229304226|gb|EEN70222.1| glutamyl-tRNA synthetase [Enterococcus faecalis ATCC 29200]
          Length = 491

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 169/491 (34%), Positives = 268/491 (54%), Gaps = 20/491 (4%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + 
Sbjct: 5   MNMTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQ 64

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++L W G+ WDE P   G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R
Sbjct: 65  LENLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAER 124

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQ+ R     Y G C  L+  E         + V+R  VP      F D V GE+    
Sbjct: 125 EAQQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFES 184

Query: 182 NAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
           + +    V+ K DGMPTY+ A  +DDHLMKI+HV RG++ I++ PK +++Y+ F +  P 
Sbjct: 185 DNIGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPV 244

Query: 241 FIHLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMD 297
           F H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+  
Sbjct: 245 FGHMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFS 303

Query: 298 MQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW----------- 346
            + LI  FD   LSK+ A FD +KL+W+N ++++ ++  +E       +           
Sbjct: 304 QEDLIKLFDEQRLSKSPAAFDAKKLEWINNQYMK-QMDLSELTDMCLPYLVADGRVEENP 362

Query: 347 -MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
             ++ + L Q ++L Q +++  + + ++++  F     L         L  E +  +L+ 
Sbjct: 363 SPEKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLD--DAAKEFLQGETVPTVLQA 420

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
            +E+ E + ++   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+
Sbjct: 421 FKEQLEALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGK 480

Query: 466 SVVYFRLRHAI 476
                 L   +
Sbjct: 481 EKALDHLNKVL 491


>gi|172056117|ref|YP_001812577.1| glutamyl-tRNA synthetase [Exiguobacterium sibiricum 255-15]
 gi|229470616|sp|B1YGS7|SYE_EXIS2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|171988638|gb|ACB59560.1| glutamyl-tRNA synthetase [Exiguobacterium sibiricum 255-15]
          Length = 481

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 173/484 (35%), Positives = 266/484 (54%), Gaps = 16/484 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            ++VRVR APSPTG  HIG A TALFNYL A+  GGK ILRIEDTD KR+      + M+
Sbjct: 1   MAEVRVRYAPSPTGHLHIGNARTALFNYLFARHAGGKMILRIEDTDQKRNIDGGVESQMK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            L+W G++WDEGP  GG YGPY Q ER ++Y+ Y   LLEK LA+RC+ ++E LE  R A
Sbjct: 61  YLEWLGIDWDEGPGRGGEYGPYFQMERLDLYKKYTDELLEKGLAYRCYMTSEELEAEREA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q  R    RY G    L+ ++ E    E +   +R+ VP   +  + D V  ++      
Sbjct: 121 QIARGEAPRYSGAHRNLTQEQEEAFVAEGRTPSIRIRVPESVTYTWNDIVKEDVSFESKD 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
               V++K DG+PTY+ A V+DDHLM I+HV RG++ IS+ PK +++Y  F +  P F H
Sbjct: 181 FGDWVIVKKDGIPTYNFAVVVDDHLMAISHVLRGDDHISNTPKQMMIYDAFGWEYPTFGH 240

Query: 244 LPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           + LI N +  KLSKR       I  Y  +GYLPEAL+NF+ LL      + + +   ++ 
Sbjct: 241 MTLIVNEEHKKLSKRDQSIIQYIEQYKDLGYLPEALLNFVTLLGWSPVGEQE-IFTKEEF 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKEK 350
           I  FD   LSK+ AVFD+QKL W+NG++++ +     F + +               +E 
Sbjct: 300 IEIFDASRLSKSPAVFDQQKLAWINGQYMKHQSFEEVFEASLPFLQDAGRVSSEPTEEEL 359

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
                 + L + ++T  + + ++++  F+ +L    E+  +T L  E +  +L     + 
Sbjct: 360 VWAQNLVGLYREQMTHGAEIVELSEMFFEDELVYDEEA--NTVLAGETVPAVLSEFASQL 417

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
             ++ W  E I+ A++   +   +  K +  P+ +A TG  +   L ++I++LG+  V  
Sbjct: 418 RTLEEWTPEAIKGAIKATQKATGQKGKNLFMPIRVATTGQTHGPELPNTIQLLGKDRVLA 477

Query: 471 RLRH 474
           RL  
Sbjct: 478 RLDA 481


>gi|256960774|ref|ZP_05564945.1| glutamyl-tRNA synthetase [Enterococcus faecalis Merz96]
 gi|293382258|ref|ZP_06628198.1| glutamate--tRNA ligase [Enterococcus faecalis R712]
 gi|293386693|ref|ZP_06631266.1| glutamate--tRNA ligase [Enterococcus faecalis S613]
 gi|312908764|ref|ZP_07767703.1| glutamyl-tRNA synthetase [Enterococcus faecalis DAPTO 512]
 gi|312979224|ref|ZP_07790928.1| glutamyl-tRNA synthetase [Enterococcus faecalis DAPTO 516]
 gi|256951270|gb|EEU67902.1| glutamyl-tRNA synthetase [Enterococcus faecalis Merz96]
 gi|291080372|gb|EFE17736.1| glutamate--tRNA ligase [Enterococcus faecalis R712]
 gi|291083862|gb|EFE20825.1| glutamate--tRNA ligase [Enterococcus faecalis S613]
 gi|310625202|gb|EFQ08485.1| glutamyl-tRNA synthetase [Enterococcus faecalis DAPTO 512]
 gi|311287989|gb|EFQ66545.1| glutamyl-tRNA synthetase [Enterococcus faecalis DAPTO 516]
 gi|315174141|gb|EFU18158.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX1346]
          Length = 491

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 169/491 (34%), Positives = 268/491 (54%), Gaps = 20/491 (4%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + 
Sbjct: 5   MNMTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQ 64

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++L W G+ WDE P   G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R
Sbjct: 65  LENLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAER 124

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQ+ R     Y G C  L+  E         + V+R  VP      F D V GE+    
Sbjct: 125 EAQQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFES 184

Query: 182 NAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
           + +    V+ K DGMPTY+ A  +DDHLMKI+HV RG++ I++ PK +++Y+ F +  P 
Sbjct: 185 DNIGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPV 244

Query: 241 FIHLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMD 297
           F H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+  
Sbjct: 245 FGHMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFS 303

Query: 298 MQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW----------- 346
            + LI  FD   LSK+ A FD +KL+W+N ++++ ++  +E       +           
Sbjct: 304 QEDLIKLFDEQRLSKSPAAFDAKKLEWINNQYMK-QMDLSELTDMCIPYLVADGRVEENP 362

Query: 347 -MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
             ++ + L Q ++L Q +++  + + ++++  F     L         L  E +  +L+ 
Sbjct: 363 SPEKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLD--DAAKEFLQGETVPTVLQA 420

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
            +E+ E + ++   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+
Sbjct: 421 FKEQLEALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGK 480

Query: 466 SVVYFRLRHAI 476
                 L   +
Sbjct: 481 EKALDHLNKVL 491


>gi|226944119|ref|YP_002799192.1| glutamyl-tRNA synthetase [Azotobacter vinelandii DJ]
 gi|226719046|gb|ACO78217.1| glutamyl-tRNA synthetase [Azotobacter vinelandii DJ]
          Length = 493

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 221/491 (45%), Positives = 321/491 (65%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER  IY+ Y   L+ K  AF CFCS ERL+E+R
Sbjct: 59  YDALRWLGIEWDEGPDVGGPHGPYRQSERGEIYKKYSDELVAKGHAFPCFCSAERLDEVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q       RYDGHC+ ++++E +R     + HVVR+ VP++G C   D + G++EIPW
Sbjct: 119 ARQMANKETPRYDGHCVHIAAEEAQRRIAAGESHVVRMKVPSEGVCTVPDLLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P  
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPRL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +++PL++NPDKSKLSKR+NPTSI++Y  MG+LPEA++N+L  +     ++ ++   + ++
Sbjct: 239 VYMPLLRNPDKSKLSKRKNPTSITFYQRMGFLPEAMLNYLGRMGWSMPDEREK-FTLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFD+  +S  G +FD +KL WLNG+W+RE L    F + V +W    + L +     Q
Sbjct: 298 IEHFDIQRVSLGGPIFDMEKLSWLNGQWLRE-LPVEAFAAEVRKWAFNPEYLMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           SR+ T S +  +  F F   + L A  F+   L  E++  +L+    + E ++ W ++NI
Sbjct: 357 SRVETFSQIAPLASFFFAGGVPLDARLFEHKKLSAEQVRQLLQLILWKLEALRQWNKDNI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++  ++H    L+  +  +F AITG   S+ + D++EILG  +  FRLR AI L+  
Sbjct: 417 TAIIQKTSEHLGYKLRDAMPLIFPAITGQASSVSVLDAMEILGADLTRFRLRQAIELLGG 476

Query: 482 LVQNHKKKELK 492
           + +   K+  K
Sbjct: 477 VSKKENKEWEK 487


>gi|154684610|ref|YP_001419771.1| glutamyl-tRNA synthetase [Bacillus amyloliquefaciens FZB42]
 gi|166200159|sp|A7Z0L4|SYE_BACA2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|154350461|gb|ABS72540.1| GltX [Bacillus amyloliquefaciens FZB42]
          Length = 483

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 183/485 (37%), Positives = 278/485 (57%), Gaps = 18/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+RIEDTD KR+    E + +
Sbjct: 1   MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDKKRNIEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW G++WDE  DIGG YGPYRQSER +IY+ Y + LLEK LA++CFC+ E LE+ R 
Sbjct: 61  NYLKWLGMDWDESVDIGGEYGPYRQSERNDIYKKYYEELLEKGLAYKCFCTEEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ +E ER   E ++  +R  VP      F D V GE+    +
Sbjct: 121 EQIARGEMPRYSGKHRNLTQEEQERFLAEGRQPSIRFRVPEGKIIAFNDIVKGEISFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  IDD+LMK+THV RGE+ IS+ PK I+++Q F + +P F 
Sbjct: 181 GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIFQAFGWDVPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ LL       ++EL   +Q
Sbjct: 241 HMTLIVNESRKKLSKRDESIIQFIEQYDELGYLPEALFNFIGLLGWS-PVGEEELFTREQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
            I  FD++ LSK+ A+FD  KL W+N ++++  L   + +      +++           
Sbjct: 300 FIEIFDVNRLSKSPALFDMHKLKWVNNQYVKA-LDLDQVVELTLPHLQKAGKVGTELSAE 358

Query: 350 -KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
            ++ + + ++L   +++  + + ++TD  FK ++    E+     L  E++ ++L     
Sbjct: 359 EQEWVRKLISLYHEQLSYGAEIVELTDLFFKDEIEYNQEA--KAVLEEEQVPEVLSVFAA 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E ++ +  E I+ +++ V +      K +  P+ +A+TG  +   L  +IE++GR   
Sbjct: 417 KLEELEEFTPELIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQAIELIGRETA 476

Query: 469 YFRLR 473
             RL+
Sbjct: 477 VRRLK 481


>gi|308171982|ref|YP_003918687.1| glutamyl-tRNA synthetase [Bacillus amyloliquefaciens DSM 7]
 gi|307604846|emb|CBI41217.1| glutamyl-tRNA synthetase [Bacillus amyloliquefaciens DSM 7]
          Length = 483

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 182/485 (37%), Positives = 278/485 (57%), Gaps = 18/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+RIEDTD KR+    E + +
Sbjct: 1   MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDKKRNIEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW G++WDE  D+GG YGPYRQSER +IY+ Y + LLEK LA++CFC+ E LE+ R 
Sbjct: 61  NYLKWLGMDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCFCTEEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ +E E+   E ++  +R  VP      F D V GE+    +
Sbjct: 121 EQIARGEMPRYSGQHRNLTQEEQEQFLAEGRQPSIRFRVPEGKIIAFNDIVKGEISFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG PTY+ A  IDD+LMK+THV RGE+ IS+ PK I+++Q F + IP F 
Sbjct: 181 GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIFQAFGWDIPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ LL       ++EL   +Q
Sbjct: 241 HMTLIVNESRKKLSKRDESIIQFIEQYEELGYLPEALFNFIGLLGWS-PVGEEELFTREQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
            I  FD++ LSK+ A+FD  KL W+N ++++  L   + +      +++           
Sbjct: 300 FIEIFDVNRLSKSPALFDMHKLKWVNNQYVKA-LDLDQVVELTLPHLQKAGKVGTELSAE 358

Query: 350 -KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
            ++ + + ++L   +++  + + ++TD  FK ++    E+     L  E++ ++L     
Sbjct: 359 EQEWVHKLISLYHEQLSYGAEIVELTDLFFKDEIEYNQEA--KAVLEEEQVPEVLSAFAA 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E ++ +  E I+ +++ V +      K +  P+ +A+TG  +   L  +IE++GR   
Sbjct: 417 KLEELEEFTPEQIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQAIELIGRETA 476

Query: 469 YFRLR 473
             RL+
Sbjct: 477 VKRLK 481


>gi|138893762|ref|YP_001124215.1| glutamyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2]
 gi|166200178|sp|A4IJG6|SYE_GEOTN RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|134265275|gb|ABO65470.1| Transfer RNA-Gln synthetase [Geobacillus thermodenitrificans
           NG80-2]
          Length = 489

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 171/489 (34%), Positives = 275/489 (56%), Gaps = 19/489 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +  VRVR APSPTG  HIG A TALFNYL A+  GGK ++RIEDTD +R+    E + +
Sbjct: 1   MAKNVRVRYAPSPTGHLHIGGARTALFNYLFARHYGGKMVVRIEDTDIERNVEGGEESQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++LKW G+++DE  D  G YGPYRQ+ER +IY+ YV  LLE+  A++CFC+ E LE  R 
Sbjct: 61  ENLKWLGIDYDESIDKDGGYGPYRQTERLDIYRKYVNELLEQGHAYKCFCTPEELERERE 120

Query: 123 AQRKRNIPSRYD-GHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            QR   I +    G C  L+ +++  L  + K + +RL VP   +    D V G++    
Sbjct: 121 EQRAAGIAAPQYSGKCRHLTPEQVAELEAQGKPYTIRLKVPEGKTYEVDDLVRGKVTFES 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             +   V++K++G+PTY+ A VIDDHLM+I+HV RGEE +S+ PK +++Y+YF +  P+F
Sbjct: 181 KDIGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHLSNTPKQLMVYEYFGWEPPQF 240

Query: 242 IHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            H+ LI N  + KLSKR       +S Y  +GYLPEA+ NF ALL      + +E+    
Sbjct: 241 AHMTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMFNFFALLGWSPEGE-EEIFTKD 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD+  LSK+ ++FD +KL W+N ++I++ L     +                   
Sbjct: 300 ELIRIFDVARLSKSPSMFDTKKLTWMNNQYIKK-LDLDRLVELALPHLVKAGRLPADMSD 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           +++      + L Q +++  + +  +++  FK ++    E+     L  E++ D+L    
Sbjct: 359 EQRQWARDLIALYQEQMSYGAEIVSLSELFFKEEVEYEDEA--RQVLAEEQVPDVLSAFL 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
                ++ +  + I+ A++ V +   +  K +  P+  A+TG  +   L  +I++LG+  
Sbjct: 417 ANVRELEPFTADEIKAAIKAVQKSTGQKGKKLFMPIRAAVTGQTHGPELPFAIQLLGKQK 476

Query: 468 VYFRLRHAI 476
           V  RL  A+
Sbjct: 477 VIERLERAL 485


>gi|297544354|ref|YP_003676656.1| glutamyl-tRNA synthetase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842129|gb|ADH60645.1| glutamyl-tRNA synthetase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 480

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 174/490 (35%), Positives = 270/490 (55%), Gaps = 20/490 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
             +VRVR APSPTG  HIG A TALFN+L A+  GGKFILR++DTD +RST ES   ++ 
Sbjct: 1   MGEVRVRFAPSPTGSLHIGGARTALFNWLFARHYGGKFILRVDDTDLQRSTKESMKGILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            LKW G++WDEG        P  QS+R + Y+ +   LL++  A+ CFC+ E LEEMRR 
Sbjct: 61  GLKWLGIDWDEG--------PIYQSQRLDEYRKFANKLLDEGKAYYCFCTKEELEEMRRR 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
                 P  Y G C  L+ ++IE   ++ K+ V+RL VP++G  +  D + G++E   + 
Sbjct: 113 AENEGRPFMYTGKCRNLTREQIEEYLKKGKRPVIRLKVPSEGKTIVHDIIRGDVEFDNST 172

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  +++KSD MPTY+ A V+DD+ M ITHV R EE +S+ PK IL+Y+      P+F H
Sbjct: 173 IDDFIIMKSDNMPTYNFATVVDDYQMGITHVIRAEEHLSNTPKQILIYEALGLETPQFAH 232

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + ++  PD+SKLSKR   TS+  +   GYLPEA++N++ LL     +D +E+ D+ + I 
Sbjct: 233 VSMVLAPDRSKLSKRHGATSVQEFEEQGYLPEAIVNYITLLG-WMPKDGEEIFDVSKSIK 291

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLT 354
            F L  +SK  AV+D QKL W+NG +IR      +    V  +           + D + 
Sbjct: 292 EFTLERVSKNPAVYDVQKLTWINGHYIRN-YDLDKLTEAVIPFLKDKNLIREEFDYDYIK 350

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + +++ + R  TL  +     + F        +  K      E++ +ILK   E  + ++
Sbjct: 351 KIVSIVREREKTLVDIADAMSYYFTEVNEYEEKGVKK-YFTKEKVAEILKKAAETLKEVE 409

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            + +   E   R + +  + S   +  P  LAI+G  +   LFD +E+LG+     R+  
Sbjct: 410 PFDKFTTEKVYRKLVEELQISSGELFHPTRLAISGRTFGPGLFDIMELLGKERTIQRIEK 469

Query: 475 AIALVSSLVQ 484
           A+  +  +  
Sbjct: 470 ALDFIEKMKN 479


>gi|229542227|ref|ZP_04431287.1| glutamyl-tRNA synthetase [Bacillus coagulans 36D1]
 gi|229326647|gb|EEN92322.1| glutamyl-tRNA synthetase [Bacillus coagulans 36D1]
          Length = 486

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 181/487 (37%), Positives = 285/487 (58%), Gaps = 19/487 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            ++++RVR APSPTG  HIG A TALFNYL A+  GGKFI+RIEDTD KR+      + +
Sbjct: 1   MANEIRVRYAPSPTGFLHIGNARTALFNYLFARSKGGKFIIRIEDTDQKRNVEGGVESQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           + LKW G++WDE  D+GG YGPYRQSER +IY+ Y ++LL++ LA++C+C+ E LE  R 
Sbjct: 61  KYLKWLGIDWDESIDVGGEYGPYRQSERLDIYKKYYEDLLDRGLAYKCYCTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R +  RY G C  L+ ++ +RL  E +K  +R  VP      F D V GE+    +
Sbjct: 121 AQLARGVMPRYSGKCRHLTEEDRKRLEAEGRKPSLRFHVPEGKVYTFNDIVKGEVSFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DGMPTY+ A  IDDHLMKI+HV RG++ IS+ PK +++Y+ F F  P F 
Sbjct: 181 GIGDFVIVKKDGMPTYNFAVTIDDHLMKISHVLRGDDHISNTPKQLMIYEAFGFEPPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y+ +GYLPEAL NF+A+L     + ++E+   ++
Sbjct: 241 HMTLIVNEHRKKLSKRDGSIIQFIEQYAELGYLPEALFNFIAMLGWS-PKGEEEIFSREE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MK 348
            I  FD   LSK+ A+FD+QKL W+N +++++ L   + +                   +
Sbjct: 300 FIQIFDPERLSKSPALFDRQKLAWMNNQYMKK-LDLDKVVELALPHLVKAGLVPENRTPE 358

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDF-LFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           E+  + + ++L Q +++  + + +++    F  ++    E+     L  E + ++L+   
Sbjct: 359 EEQWVRKLISLYQEQMSYGAEIVELSKPLFFTDEITYDEEA--KEILSGEHVPEVLRAFL 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           EE + I+ ++   I+ A++ V +   +  K +  P+ +A++G  +   L   IE+LGR  
Sbjct: 417 EELDRIEPFEAGEIKKAIKAVQKATGQKGKKLFMPIRVAVSGQTHGPELQSLIELLGREK 476

Query: 468 VYFRLRH 474
           V  RL  
Sbjct: 477 VKKRLER 483


>gi|313679650|ref|YP_004057389.1| glutamyl-tRNA synthetase [Oceanithermus profundus DSM 14977]
 gi|313152365|gb|ADR36216.1| glutamyl-tRNA synthetase [Oceanithermus profundus DSM 14977]
          Length = 483

 Score =  387 bits (994), Expect = e-105,   Method: Composition-based stats.
 Identities = 189/487 (38%), Positives = 281/487 (57%), Gaps = 12/487 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ RIAPSPTG PH+GTAY  +F+Y+ A++ GGKFI+RIEDTD  R    +E  ++++LK
Sbjct: 2   VKTRIAPSPTGYPHVGTAYIGIFSYVWARKNGGKFIVRIEDTDQNRYVEGAEEGILRALK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL++DEGPD+GG  GPYRQSER  +Y+ Y Q LL++ LA+R F + E L  +R   ++
Sbjct: 62  WLGLDYDEGPDVGGPNGPYRQSERLELYRRYAQQLLDEGLAYRAFETPEELAAIREELQR 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + +   YDG   K+  +E E  +   + HV+RL  P  G  V  D + G +E     +  
Sbjct: 122 KGLGYGYDGRARKIPREEAEARATAGEPHVIRLKTPETGVTVVHDVLRGNIEFDNREIPD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            VLLKSDG PTYHLA V+DDHLM++T V RGE+W+ S P   LLYQ F +  P++ HLPL
Sbjct: 182 VVLLKSDGFPTYHLAVVVDDHLMEVTDVIRGEDWLVSTPIQKLLYQAFGWDEPKWYHLPL 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++ P  +KLSKR   TSI YY   GYLPEAL N+L+ +     +  + +  M+++I  F 
Sbjct: 242 LRAPGGAKLSKRTGHTSIDYYREAGYLPEALRNYLSTMGFSMPDGRE-IFTMEEMIEAFS 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-------MKEKDRLTQALTL 359
              +S  G VFD++KL W+NG++IRE LS  E   R+  +        +    L Q +  
Sbjct: 301 WDRVSLGGPVFDEEKLRWMNGKYIREVLSLEEVCERLKPFLEAAGLSWESDAYLCQVVEA 360

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            + R  TL+   +   + F  D     ++ K         ++IL+  +E    +  +  E
Sbjct: 361 MRPRFETLAEFVEKARYFFTEDYPFEPKAEKELKK----GLEILRELKEVLAGLSDFAPE 416

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
             E AL   A+ +E  L+ +++PL  AITG+  +  +++ +EILG+  V  R+  A+A  
Sbjct: 417 RTEPALVGYAEAKELKLRKVMQPLRAAITGTLATPGMYELLEILGKERVLARIERALAHA 476

Query: 480 SSLVQNH 486
                N 
Sbjct: 477 EEREGNA 483


>gi|90417134|ref|ZP_01225062.1| glutamyl-tRNA synthetase [marine gamma proteobacterium HTCC2207]
 gi|90331150|gb|EAS46406.1| glutamyl-tRNA synthetase [marine gamma proteobacterium HTCC2207]
          Length = 493

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 236/471 (50%), Positives = 319/471 (67%), Gaps = 1/471 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR RIAPSPTG+PH+GTAY ALFN   A+  GG+F+LRIEDTD  RST ESE +++ +L 
Sbjct: 3   VRTRIAPSPTGDPHVGTAYVALFNMAFARSQGGQFLLRIEDTDQVRSTPESEKSILDALH 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEGPD GG +GPYRQSER +IY+ +   LL+   AFRCFC++ERL+++R+ Q +
Sbjct: 63  WLGLEWDEGPDNGGPHGPYRQSERSDIYRQHADQLLDSGHAFRCFCTSERLDQLRKTQME 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
              P  YDGHC  L   EI++     + HVVR+ VP +G CVF D + GE+ I W  +D+
Sbjct: 123 EKQPIGYDGHCQHLEQAEIDQRLANNESHVVRMNVPREGQCVFNDMLRGEISIDWTQIDL 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVLLK+DGMPTYHLANV+DDHLMKI+HV RGEEWI+S PKHILLYQYF +  P F HLPL
Sbjct: 183 QVLLKADGMPTYHLANVVDDHLMKISHVIRGEEWINSAPKHILLYQYFGWDTPVFCHLPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++N DKSKLSKR+NPTSI +Y  MGYLPEAL+N+L  +     ++ ++   + +++  FD
Sbjct: 243 LRNIDKSKLSKRKNPTSILFYQRMGYLPEALLNYLGRMGWSMPDEREK-FTLAEMLEVFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD +KL WLNG WIRE+L+  +   R+ +W   +D L   L  A+ R+ T
Sbjct: 302 IQRVSLGGPVFDVEKLSWLNGMWIREELTDDQLADRLQEWALNRDTLKAFLPFAKQRMET 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS +  +  +L    L ++AE  +S  +  E +I++L+      E +Q W R+NI  AL+
Sbjct: 362 LSDIAPLGSYLVSGMLPISAEDLRSAGIEDERLIEVLQFALWRLESVQQWNRDNIFNALK 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            VA   +  LK  + PLF+AI GS  S+ + DS+ +LG  +   RLRHAI 
Sbjct: 422 AVADGMDIKLKPFLAPLFIAIAGSSASISVMDSMNLLGADMSRARLRHAIE 472


>gi|254482086|ref|ZP_05095328.1| glutamyl-tRNA synthetase [marine gamma proteobacterium HTCC2148]
 gi|214037776|gb|EEB78441.1| glutamyl-tRNA synthetase [marine gamma proteobacterium HTCC2148]
          Length = 493

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 225/487 (46%), Positives = 311/487 (63%), Gaps = 2/487 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R+APSPTG+PH+GTAY ALFN   A+  GG+F+LRIEDTD  RST ESE A++ SL 
Sbjct: 3   VRTRVAPSPTGDPHVGTAYIALFNMCFARAHGGQFVLRIEDTDQTRSTPESEQAILDSLN 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEGPD+GG  GPYRQSER +IY  Y + L+++  AF C+ + E L E+R AQR 
Sbjct: 63  WLGLSWDEGPDVGGDCGPYRQSERMDIYGDYARQLVDEGKAFVCYRTAEELNELREAQRA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQG-SCVFQDKVYGEMEIPWNAVD 185
               S      LKL  +E+ +     + +V+R+ VP +  +C   D + G +E+ W+ VD
Sbjct: 123 AGSSSALKPSDLKLPEEEVAKREAAGEPYVIRMIVPEEEGACAVDDMLRGTIELDWSMVD 182

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
            Q+LLKSDGMPTYHLANV+DDHLM ITHV RGEEWI+S PKH+LLYQYF + +P+  HLP
Sbjct: 183 AQILLKSDGMPTYHLANVVDDHLMGITHVLRGEEWINSAPKHVLLYQYFGWDMPKLCHLP 242

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI YY  MG+LPEAL+N+L  +     ++ ++   +QQ+  +F
Sbjct: 243 LLRNPDKSKLSKRKNPTSILYYQRMGFLPEALLNYLGRMGWSMPDESEK-FSLQQMQDNF 301

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL WLNG WIRE L   +   R+  W   +  L + L  AQ R+ 
Sbjct: 302 DIQRVSLGGPIFDVEKLSWLNGMWIREDLDEQQLAKRLVDWAYNEANLMKVLPHAQKRME 361

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
           TLS    +  FL    L L  +SF       E+++  L+      E +Q W R+NI   L
Sbjct: 362 TLSDFAPLAGFLVSGTLPLDEDSFAGVKGEKEDVVKGLQFALWRMEALQQWNRDNIWNEL 421

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
           + +A      +K  + P+F+AI G+  S  + DS+E+LG  +   RLRHAI+++  + + 
Sbjct: 422 KALADASGVKVKDFLAPIFVAIAGTSASFSVVDSMEMLGPDMSRSRLRHAISILGGVSKK 481

Query: 486 HKKKELK 492
             K+  K
Sbjct: 482 AMKRLEK 488


>gi|73749049|ref|YP_308288.1| glutamyl-tRNA synthetase [Dehalococcoides sp. CBDB1]
 gi|115305765|sp|Q3ZYP4|SYE_DEHSC RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|73660765|emb|CAI83372.1| glutamyl-tRNA synthetase [Dehalococcoides sp. CBDB1]
          Length = 487

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 189/491 (38%), Positives = 274/491 (55%), Gaps = 20/491 (4%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +++VRVR APSPTG PH+G   TA+FN+L A+  GGKFI+RIEDTD +R    +  +++
Sbjct: 1   MTNEVRVRYAPSPTGYPHLGNIRTAMFNWLFARHNGGKFIVRIEDTDRERYVEGAVESIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +SL W GL+WDEGPD GG YGPY QSER  +Y+   + L+ +  A+ C CS+E+L++MR 
Sbjct: 61  ESLNWLGLDWDEGPDKGGDYGPYYQSERLPLYRKAAEKLVAEGKAYYCHCSSEKLDKMRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R  P  YD  C  +          +++  V+R  +P  G   F D + GE+     
Sbjct: 121 DQIARKEPPGYDRCCRDM-------GLGQKEGAVIRFKIPLDGQTAFTDLIRGEVTFDNA 173

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
             D  V+LKSDG PTYHLA+V+DDH M+I+HV R EEW+ S PKH++LY+   +  P + 
Sbjct: 174 KQDDFVILKSDGFPTYHLASVVDDHAMQISHVLRAEEWLPSTPKHLMLYKALGYTPPLYA 233

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           HLP+I  PD+SKLSKR   TS   Y   GYLPE ++NFL+LL     +D  EL   +QLI
Sbjct: 234 HLPMILGPDRSKLSKRHGATSTIEYKQAGYLPETMVNFLSLLG-WAYDDKTELFSREQLI 292

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-----------MKEKD 351
            +F L  +SK  A+F+ +KLDW+NG +IR  LS  +   R   +               D
Sbjct: 293 EYFCLEKVSKTAAIFNYEKLDWMNGMYIRT-LSAQDLACRAMPFLEKDVRIAASGHLNLD 351

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
              + + L Q R   L+ L ++  F++  D+           L  E  +  LK      E
Sbjct: 352 YTVKVMPLIQERAKKLNELAELCWFIYSDDISYDPALLIDKKLTKETSLSALKAANARLE 411

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            +  +   ++E  +R +A   E     +   L  A TG + + PLF ++E+LGR    +R
Sbjct: 412 ALPNFDAASMEEHIRPLAAELELKPGQLFGMLRTASTGQQVAPPLFQTMEVLGRQRCLWR 471

Query: 472 LRHAIALVSSL 482
           +  AIA +S +
Sbjct: 472 IAMAIARLSEM 482


>gi|284048088|ref|YP_003398427.1| glutamyl-tRNA synthetase [Acidaminococcus fermentans DSM 20731]
 gi|283952309|gb|ADB47112.1| glutamyl-tRNA synthetase [Acidaminococcus fermentans DSM 20731]
          Length = 490

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 166/487 (34%), Positives = 253/487 (51%), Gaps = 13/487 (2%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
              K++VR APSPTG  HIG A +ALFN+L+A++  G  +LRIEDTD  RS  E E  + 
Sbjct: 1   MEKKLKVRFAPSPTGPFHIGGARSALFNWLLARKENGVMLLRIEDTDRDRSKPEWEANIK 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW G++WDEG D+GG  GPYRQ ER +IY+ Y   LL +  A+ C+C+ E LE  R 
Sbjct: 61  AALKWLGIDWDEGVDVGGPNGPYRQMERLDIYKKYTDKLLAEGKAYYCYCTPEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           A   +    RY G C  L+ ++      E +K  +R  VP     V  D+V G++    N
Sbjct: 121 ALTAQGKMPRYMGKCRNLTPEQRAAYEAEGRKPTIRFRVPENEDIVVHDEVRGDVHFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++KSDG+PTY+ A VIDD LM +  V R EE +S+ P+ +LLY    F  P F 
Sbjct: 181 GIGDFVIVKSDGIPTYNYAVVIDDALMGVNCVIRAEEHLSNTPRQLLLYDALGFEKPTFG 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+ LI  PD  K+SKR   TS+  Y  MGYLP+A++NFLALL    + D + +   ++LI
Sbjct: 241 HISLILGPDHKKMSKRHGATSVDQYRQMGYLPDAIVNFLALLGWSPNSDQE-IFSREELI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKD----------- 351
             F L H++K  AVFD +KL+WLN  ++R+          V    +              
Sbjct: 300 QQFSLDHVAKNPAVFDIKKLNWLNAHYMRQLSDEDYVAFAVPFMKEAGYMTGEETGEKLE 359

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
            L + +  A+ +      +P+     F  +            L  E +  ++    ++  
Sbjct: 360 WLKKVILTARDQAEFGKEIPEKVALYFTDEFDF-ETPEAEAVLKEETVPQVMGLFLDKLA 418

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
             +       +   + V +  +   K +  P+ +A+TG+++   L + I +LG+  V  R
Sbjct: 419 AAEGLDHAATKALFKAVQKETKLGGKKVFMPVRVALTGNQHGPELAEMIPLLGKERVASR 478

Query: 472 LRHAIAL 478
           +R ++A 
Sbjct: 479 IRGSLAK 485


>gi|257081386|ref|ZP_05575747.1| glutamyl-tRNA synthetase [Enterococcus faecalis E1Sol]
 gi|256989416|gb|EEU76718.1| glutamyl-tRNA synthetase [Enterococcus faecalis E1Sol]
          Length = 491

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 169/491 (34%), Positives = 267/491 (54%), Gaps = 20/491 (4%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + 
Sbjct: 5   MNMTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQ 64

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++L W G+ WDE P   G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R
Sbjct: 65  LENLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAER 124

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQ+ R     Y G C  L+  E         + V+R  VP      F D V GE+    
Sbjct: 125 EAQQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFES 184

Query: 182 NAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
           + +    V+ K DGMPTY+ A  +DDHLMKI+HV RG++ I++ PK +++Y+ F +  P 
Sbjct: 185 DNIGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPV 244

Query: 241 FIHLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMD 297
           F H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+  
Sbjct: 245 FGHMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFS 303

Query: 298 MQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW----------- 346
            + LI  FD   LSK+ A FD +KL+W+N ++++ ++   E       +           
Sbjct: 304 QEDLIKLFDEQRLSKSPAAFDAKKLEWINNQYMK-QMDLGELTDMCIPYLVADGRVEENP 362

Query: 347 -MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
             ++ + L Q ++L Q +++  + + ++++  F     L         L  E +  +L+ 
Sbjct: 363 SPEKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLD--DAAKEFLQGETVPTVLQA 420

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
            +E+ E + ++   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+
Sbjct: 421 FKEQLEALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGK 480

Query: 466 SVVYFRLRHAI 476
                 L   +
Sbjct: 481 EKALDHLNKVL 491


>gi|146283327|ref|YP_001173480.1| glutamyl-tRNA synthetase [Pseudomonas stutzeri A1501]
 gi|166226848|sp|A4VNT7|SYE_PSEU5 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|145571532|gb|ABP80638.1| glutamyl-tRNA synthetase [Pseudomonas stutzeri A1501]
          Length = 493

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 216/491 (43%), Positives = 316/491 (64%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER  IY+ Y   L+ K  AF CFCS ERL+++R
Sbjct: 59  YDALRWLGIEWDEGPDVGGPHGPYRQSERGEIYKKYSDELVAKGHAFPCFCSAERLDQVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q       RYDGHC+ L   E ER     + HV+R+ VP++G C  QD + G +EI W
Sbjct: 119 AEQMANKETPRYDGHCMHLDPAEAERRITAGESHVIRMKVPSEGVCQVQDMLRGTVEIGW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG+LP+A++N+L  +     ++ ++   ++++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFLPQAMLNYLGRMGWSMPDEREK-FTLEEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFD+  +S  G +FD +KL WLNG+W+RE L   +F + V +W    + + +     Q
Sbjct: 298 IEHFDIQRVSLGGPIFDLEKLSWLNGQWLRE-LPVEQFAAEVRKWAFNPEYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   L L    F    L   ++  +++    + E ++ W++E I
Sbjct: 357 QRVETFSQIAPLAGFFFSGPLQLDPALFAHKKLDATQVRQVMQLILWKLEALRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              +  VA+H    L+ ++  +F AITG   S+ + D++EILG  +  FRLR+A+ L+  
Sbjct: 417 TACITQVAEHLGFKLRDVMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRNALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 ASKKEAKEWEK 487


>gi|57233878|ref|YP_182076.1| glutamyl-tRNA synthetase [Dehalococcoides ethenogenes 195]
 gi|115305764|sp|Q3Z6S3|SYE_DEHE1 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|57224326|gb|AAW39383.1| glutamyl-tRNA synthetase [Dehalococcoides ethenogenes 195]
          Length = 484

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 193/491 (39%), Positives = 279/491 (56%), Gaps = 20/491 (4%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +++VRVR APSPTG PH+G   TA+FN+L A+  GGKFI+RIEDTD +R    +  +++
Sbjct: 1   MTNEVRVRYAPSPTGYPHLGNIRTAMFNWLFARHNGGKFIVRIEDTDRERYVEGAVESIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +SL W GL+WDEGPD GG YGPY QSER  +Y+   + L+ +  A+ C CS+ERL++MR 
Sbjct: 61  ESLNWLGLDWDEGPDKGGDYGPYYQSERLFLYRQAAERLVTEGKAYYCHCSSERLDKMRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R  P  YD           +    +++  V+R  +P +G   F D + GE+     
Sbjct: 121 EQIARKEPPGYDR-------CCRDLCLGQKEGAVIRFKIPLEGQTTFIDLIRGEVTFDNA 173

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
             D  V+LKSDG PTYHLA+V+DDH M+I+HV R EEW+ S PKH++LY+   +  P++ 
Sbjct: 174 KQDDFVILKSDGFPTYHLASVVDDHAMQISHVLRAEEWLPSTPKHLMLYKALGYTPPQYA 233

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           HLP+I  PD+SKLSKR   TS   Y   GYLPE ++NFL+LL     +D  EL   +QLI
Sbjct: 234 HLPMILGPDRSKLSKRHGATSTIEYKQAGYLPETMVNFLSLLG-WAYDDKTELFSRKQLI 292

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-----------MKEKD 351
            +F L  +SK  A+F+ +KLDW+NG +IR  LS  +  SR   +               D
Sbjct: 293 EYFCLEKVSKTAAIFNYEKLDWMNGMYIRT-LSAPDLASRAIPFLEKDERIAASGRLNFD 351

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
             T+ + L Q R+  LS L ++  F++  ++     S     L  +E +  LK      E
Sbjct: 352 YTTKVMPLIQERVKKLSELAELCWFIYSDNISYDPASLIDKKLTKDESLCALKAAFARLE 411

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            +  +   ++E  +R +A   E     +   L  A TG + + PLF ++E+LGR     R
Sbjct: 412 ALANFDAVSMEEHIRPLAAELELKPGQLFGMLRTASTGQQVAPPLFQTMEVLGRERCLGR 471

Query: 472 LRHAIALVSSL 482
           +  AIA +S L
Sbjct: 472 IAMAIARLSEL 482


>gi|227824942|ref|ZP_03989774.1| glutamyl-tRNA synthetase [Acidaminococcus sp. D21]
 gi|226905441|gb|EEH91359.1| glutamyl-tRNA synthetase [Acidaminococcus sp. D21]
          Length = 486

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 180/483 (37%), Positives = 272/483 (56%), Gaps = 13/483 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           +RVR APSPTG  HIG A +ALFN+L+AKR GGKF+LRIEDTD KRST ESE  +  +LK
Sbjct: 1   MRVRFAPSPTGPFHIGGARSALFNWLLAKRMGGKFVLRIEDTDRKRSTPESEENIKAALK 60

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEG D+GG YGPY Q ER +IY+ Y   LL++  A+ C+C+ E LEE R+A  K
Sbjct: 61  WLGITWDEGADVGGPYGPYHQMERLDIYKKYTDQLLKEGKAYYCYCTPEELEEERQALLK 120

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RY G C  L+ ++  +  +E +K  +RL VP   + V  D V G++E   N +  
Sbjct: 121 DCKMPRYMGKCRHLTEEQKAQYEKEGRKPSIRLKVPENETIVVHDMVRGDVEFDSNGIGD 180

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            V++KSDG+PTY+ A VIDD+LM ITHV R EE +S+ P+ +L+Y+   F  P F H+ L
Sbjct: 181 FVIVKSDGIPTYNYAVVIDDYLMHITHVIRAEEHLSNTPRQLLVYEALGFEKPVFAHISL 240

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +K+SKR   TS+  Y   GYLPE + NFLALL     + ++E+  M++    F 
Sbjct: 241 ILGTDHTKMSKRHGATSVDAYRQQGYLPEGIDNFLALLG-WAPQGEEEIFSMEEACKVFS 299

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEF-----------LSRVSQWMKEKDRLTQ 355
           +  ++K  AVFD +KL+W+N + IR+      F                +  ++ D L +
Sbjct: 300 MDRVAKNPAVFDIKKLNWINSQHIRKLTPDAFFELAKPFMVKAGYMTGDETGEKLDWLKR 359

Query: 356 ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
            +  AQ+++   + +P+     F  D     E   S  L  E +  ++K   E F  +  
Sbjct: 360 VVATAQTQVDYGAQVPEKVALYFTDDFDFENEEAVS-VLKEETVPLVMKALIEGFHSLDE 418

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA 475
              ++++   + V +  +   + +  P  +A+TG+++   L + I +LG   V  R+  +
Sbjct: 419 LNHDSVKGVFKAVQKGNKLKGQQVYMPFRVALTGNQHGPELAEMIPLLGADRVEKRIMKS 478

Query: 476 IAL 478
           +  
Sbjct: 479 LEK 481


>gi|315143641|gb|EFT87657.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX2141]
 gi|327533895|gb|AEA92729.1| glutamate--tRNA ligase [Enterococcus faecalis OG1RF]
          Length = 491

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 169/491 (34%), Positives = 267/491 (54%), Gaps = 20/491 (4%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + 
Sbjct: 5   MNMTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQ 64

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++L W G+ WDE P   G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R
Sbjct: 65  LENLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAER 124

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQ+ R     Y G C  L+  E         + V+R  VP      F D V GE+    
Sbjct: 125 EAQQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFES 184

Query: 182 NAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
           + +    V+ K DGMPTY+ A  +DDHLMKI+HV RG++ I++ PK +++Y+ F +  P 
Sbjct: 185 DNIGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPV 244

Query: 241 FIHLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMD 297
           F H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+  
Sbjct: 245 FGHMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFS 303

Query: 298 MQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW----------- 346
            + LI  FD   LSK+ A FD +KL+W+N ++++ ++  +E       +           
Sbjct: 304 QEDLIKLFDEQRLSKSPAAFDAKKLEWINNQYMK-QMDLSELTDMCLPYLVADGRVEENP 362

Query: 347 -MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
             ++ + L Q ++L Q +++  + + ++++  F     L         L  E +  +L  
Sbjct: 363 SPEKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLD--DAAKEFLQGETVPTVLHA 420

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
            +E+ E + ++   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+
Sbjct: 421 FKEQLEALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGK 480

Query: 466 SVVYFRLRHAI 476
                 L   +
Sbjct: 481 EKALDHLNKVL 491


>gi|153873412|ref|ZP_02002004.1| Glutamyl-tRNA synthetase 2 [Beggiatoa sp. PS]
 gi|152070121|gb|EDN67995.1| Glutamyl-tRNA synthetase 2 [Beggiatoa sp. PS]
          Length = 467

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 159/480 (33%), Positives = 253/480 (52%), Gaps = 23/480 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R APSPTG  HIG   TALF++L A++ GG+FILRIEDTD +RST ES NA+++ + 
Sbjct: 3   VRTRFAPSPTGYLHIGGVRTALFSWLYARKHGGQFILRIEDTDRERSTEESVNAILEGMA 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL  DEG        P+ Q++R + Y+  ++ LL +  A+ C+CS ER+E++R  Q  
Sbjct: 63  WLGLQPDEG--------PFYQTQRFDRYRQIIEQLLAEGKAYYCYCSKERIEKVRAGQLA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYDGHC  L+     +      K V+R   P+ G  V +D + G +    N +D 
Sbjct: 115 HKQKPRYDGHCRHLT-----KSPSPDIKPVIRFKNPSVGEVVVRDLIKGTVIFNNNELDD 169

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ +SDG PTY+   V+DD  M+IT V RG++ +++ P+ I + +     IP++ H+P+
Sbjct: 170 LIIARSDGTPTYNFTVVVDDWDMQITDVIRGDDHLNNTPRQINILEALGAKIPQYAHVPM 229

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D  +LSKR    S++ Y   GYLP AL+N+LA L       D E+  + ++I  FD
Sbjct: 230 ILGSDGQRLSKRHGAVSVTSYKEEGYLPHALLNYLARLGWS--YGDQEIFSLSEMIDLFD 287

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTT---EFLSRVSQWMKEKDRLTQALTLAQ-- 361
           +  +  + A FD +KL WLN  +I+            S  SQ   +  +      + +  
Sbjct: 288 ISTVHSSAASFDPEKLLWLNQHYIKTGNPDELAKHLQSHCSQLKIDTTQGPPLSDIVKIQ 347

Query: 362 -SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  TL  + Q + + F   L    ++ +        I + L    E  E ++ W  E+
Sbjct: 348 AERAKTLIEMAQKSRYFFGDTLDFDDKAVRKN--LKPSIREPLANLCERLEQLEQWNAES 405

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           I   +  VA+  E  L  I +PL +A+TG   S P+  +++++G+     R++ A+ L+ 
Sbjct: 406 IHQIIHTVAEQYELKLGKIAQPLRVAVTGGTVSPPIDVTVDLIGKKRSIDRIKQALTLMG 465


>gi|315127488|ref|YP_004069491.1| glutamyl-tRNA synthetase [Pseudoalteromonas sp. SM9913]
 gi|315016002|gb|ADT69340.1| glutamyl-tRNA synthetase [Pseudoalteromonas sp. SM9913]
          Length = 494

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 217/483 (44%), Positives = 304/483 (62%), Gaps = 2/483 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           +R R+APSPTG+PH+GTAY ALFNY  AK+ GG+F+LRIEDTD  RST ESE A+M SL+
Sbjct: 3   IRTRVAPSPTGDPHLGTAYIALFNYCFAKQQGGEFVLRIEDTDQVRSTPESEQAIMDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WD GPD+GG +GPYRQSER ++Y+ Y   L+E   AF CF ++E L++MR  Q  
Sbjct: 63  WLGLEWDHGPDVGGEFGPYRQSERSDLYKKYAHQLVEDGKAFYCFATSEELDQMREEQMA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
             +  +YDG  L  S  EI+      K +V+R+ +P++G+  F D + GE+EIPW  VDM
Sbjct: 123 EGLRPKYDGRGLNHSEDEIKANLAAGKPYVIRMKIPSEGTFKFNDYLRGEIEIPWENVDM 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVLLK+DG PTY LANV+DDH M+I+H+ RGEEWI+S PK + LY+ F +  P   HLPL
Sbjct: 183 QVLLKADGFPTYFLANVVDDHHMQISHIFRGEEWINSAPKLLKLYEDFGWEAPVLGHLPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  MGYLPEA++N+L  +     ++ ++   + ++I HFD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYKEMGYLPEAVLNYLGRMGWSMPDEREK-FTLNEMIEHFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD  KL WLNG WIRE L+  E + R   W    D L + L  A++RI T
Sbjct: 302 MKRVSLGGPVFDVDKLSWLNGMWIRENLTDAELMQRFVDWKFNGDMLAKVLPEAKTRINT 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS +  +                 +     + I   L+    + E ++ +++  I    +
Sbjct: 362 LSDMVDLAGHFVGGIPTYDPALLTAGKADEDVIRQALQFFVWQLEGLRSFEKPAIFAIAK 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            VA   E  +K  ++P+F+AITG   S  + D++EILG  +   RLR A+A +  + +  
Sbjct: 422 EVATFHELKIKDFLEPIFVAITGKTSSTSVLDAMEILGSDLSRARLRVALAHLG-ISKKQ 480

Query: 487 KKK 489
            KK
Sbjct: 481 AKK 483


>gi|227518067|ref|ZP_03948116.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0104]
 gi|227555725|ref|ZP_03985772.1| glutamyl-tRNA synthetase [Enterococcus faecalis HH22]
 gi|256618487|ref|ZP_05475333.1| glutamyl-tRNA synthetase [Enterococcus faecalis ATCC 4200]
 gi|257417466|ref|ZP_05594460.1| glutamyl-tRNA synthetase [Enterococcus faecalis AR01/DG]
 gi|257418804|ref|ZP_05595798.1| glutamyl-tRNA synthetase [Enterococcus faecalis T11]
 gi|227074503|gb|EEI12466.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0104]
 gi|227175130|gb|EEI56102.1| glutamyl-tRNA synthetase [Enterococcus faecalis HH22]
 gi|256598014|gb|EEU17190.1| glutamyl-tRNA synthetase [Enterococcus faecalis ATCC 4200]
 gi|257159294|gb|EEU89254.1| glutamyl-tRNA synthetase [Enterococcus faecalis ARO1/DG]
 gi|257160632|gb|EEU90592.1| glutamyl-tRNA synthetase [Enterococcus faecalis T11]
 gi|315151332|gb|EFT95348.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0012]
 gi|315573951|gb|EFU86142.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0309B]
 gi|315581902|gb|EFU94093.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0309A]
          Length = 491

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 169/491 (34%), Positives = 267/491 (54%), Gaps = 20/491 (4%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + 
Sbjct: 5   MNMTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQ 64

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++L W G+ WDE P   G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R
Sbjct: 65  LENLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAER 124

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQ+ R     Y G C  L+  E         + V+R  VP      F D V GE+    
Sbjct: 125 EAQQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFES 184

Query: 182 NAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
           + +    V+ K DGMPTY+ A  +DDHLMKI+HV RG++ I++ PK +++Y+ F +  P 
Sbjct: 185 DNIGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPV 244

Query: 241 FIHLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMD 297
           F H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+  
Sbjct: 245 FGHMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFS 303

Query: 298 MQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW----------- 346
            + LI  FD   LSK+ A FD +KL+W+N ++++ ++  +E       +           
Sbjct: 304 QEDLIKLFDEQRLSKSPAAFDAKKLEWINNQYMK-QMDLSELTDMCIPYLVADGRVEENP 362

Query: 347 -MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
             ++ + L Q ++L Q +++  + + ++++  F     L         L  E +  +L  
Sbjct: 363 SPEKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLD--DAAKEFLQGETVPTVLHA 420

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
            +E+ E + ++   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+
Sbjct: 421 FKEQLEALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGK 480

Query: 466 SVVYFRLRHAI 476
                 L   +
Sbjct: 481 EKALDHLNKVL 491


>gi|315301164|ref|ZP_07872433.1| glutamyl-tRNA synthetase [Listeria ivanovii FSL F6-596]
 gi|313630467|gb|EFR98331.1| glutamyl-tRNA synthetase [Listeria ivanovii FSL F6-596]
          Length = 491

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 166/487 (34%), Positives = 273/487 (56%), Gaps = 16/487 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSKTKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNVEDGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M++LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL++ LA++C+C+ + L+  
Sbjct: 61  QMKNLKWLGIDWDEGVDVPGKYGPYRQSERQSIYEPLIQKLLDEGLAYKCYCTEDELDAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANQTITFNDMVKDDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK +L+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQLLIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK-------- 350
           ++ I  FD   LSK+ A+FD  KL W+N +++++ L   + +      +++         
Sbjct: 300 EEFIQMFDPKRLSKSPALFDNVKLTWVNNQYVKK-LPLNDVVELSLPHLQKAGVVSEELD 358

Query: 351 ----DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
               + + + ++L   +++  + +  +++  F     +T +  +   L  E +  ++   
Sbjct: 359 QAELNWVHKLVSLYHEQMSYGAEIVPLSEMFFADADSITFDEEEKAVLAEETVPTVILAF 418

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
           ++E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LG+ 
Sbjct: 419 KKELEALEVLEATEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGKE 478

Query: 467 VVYFRLR 473
            V  RL 
Sbjct: 479 KVINRLD 485


>gi|331006636|ref|ZP_08329920.1| Glutamyl-tRNA synthetase [gamma proteobacterium IMCC1989]
 gi|330419551|gb|EGG93933.1| Glutamyl-tRNA synthetase [gamma proteobacterium IMCC1989]
          Length = 494

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 229/488 (46%), Positives = 314/488 (64%), Gaps = 3/488 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE A+  SL+
Sbjct: 3   VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGEFILRIEDTDQVRSTPESEQAIFDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+W EGPD+GG YGPYRQSER +IY  Y Q L++   AF C+ +TE L+E+R A+R+
Sbjct: 63  WLGLDWAEGPDVGGEYGPYRQSERGDIYAKYAQQLVDAGHAFHCYRTTEELDELRNARRE 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPN-QGSCVFQDKVYGEMEIPWNAVD 185
           +   +      LKLS  E+ +       +VVR+ VP  +G C   D + G +E+ W  VD
Sbjct: 123 QGGFAALKPSELKLSDDEVAKRQAADMPYVVRMNVPEGEGPCPVDDMLRGTIELDWGQVD 182

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
            Q+LLKSDGMPTYHLANV+DDHLMKITHV RGEEWI+S PKH LLYQYF + +P   HLP
Sbjct: 183 AQILLKSDGMPTYHLANVVDDHLMKITHVLRGEEWINSAPKHKLLYQYFGWEMPVLCHLP 242

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++N DKSKLSKR+NPTSI +Y  MGYLPE LIN+L  +     ++ ++   + +++  F
Sbjct: 243 LLRNADKSKLSKRKNPTSILHYKKMGYLPEGLINYLGRMGWSMPDEREK-FTLDEMVAAF 301

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D++ +S  G +FD +KL WLNG WIRE+L+T +   R+  W    D +   L  AQ R+ 
Sbjct: 302 DINRVSLGGPIFDVEKLSWLNGLWIREELNTEQLAQRLKDWALNMDSIRAVLPHAQPRME 361

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
           TLS    +T F+F   L L  E + +  L  E+   +L+      E ++ W +E I  +L
Sbjct: 362 TLSDFVPLTAFMFSGMLPLNKEQYAALKLDEEQQKLVLQFALWRLEGLREWNKEAIFASL 421

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA-LVSSLVQ 484
           + +A   E  LK  + PLF+AI+G+  S  + +S+ +LG  +   R+RHA+  L   + +
Sbjct: 422 KALADSMEIKLKDFLAPLFIAISGTTSSFSVMESMTLLGPDMSRARVRHALNGLFGEIGK 481

Query: 485 NHKKKELK 492
             +KK  K
Sbjct: 482 KQQKKLEK 489


>gi|312876618|ref|ZP_07736599.1| glutamyl-tRNA synthetase [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796571|gb|EFR12919.1| glutamyl-tRNA synthetase [Caldicellulosiruptor lactoaceticus 6A]
          Length = 485

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 183/480 (38%), Positives = 268/480 (55%), Gaps = 15/480 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           +VR R APSPTG  HIG A TALFNYL AKR GGKFILRIEDTD +RS++ESE  +++SL
Sbjct: 2   EVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIESL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W G+ WDEG ++GG +GPYR +ER +IY+ YV  L EK  A+ C+C+ E LE  R+   
Sbjct: 62  RWLGIEWDEGVEVGGPHGPYRSTERVDIYKKYVDVLFEKGYAYYCYCTEEDLESQRQELL 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RY G C  L+ ++  R  QE +K  VR  VP     V  D V G++E   + + 
Sbjct: 122 SKGQMPRYLGKCRNLTEEQKRRFEQEGRKPTVRFKVPEGVKIVVHDLVRGDVEFMSDDIG 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V++KSDG+PTY+ A VIDDHLMKI+HV RGEE +S+ P+ IL+Y    F +P+F H+ 
Sbjct: 182 DFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALGFELPQFAHVS 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           LI   D++K+SKR   T +  Y   GYL E LINFLALL     ED + + DM+ LI +F
Sbjct: 242 LILGKDRTKMSKRHGSTWVEQYKEQGYLKEGLINFLALLGWSPPEDKE-IFDMEYLIKNF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE------------KDRL 353
            L  +SK  A+FD  KL+++N + I+   S  E       +  +             + L
Sbjct: 301 SLERVSKNPAIFDIDKLNYINSQHIKL-KSLDELTKMCIPYFVDAGYIKEDEAQSKFEWL 359

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
            + +      +  LS +    D  F +++ +  E      L  E + D++   + +   +
Sbjct: 360 KKIVKSVYEGLDYLSQIKDRVDIFFNNEVKI-EEDEAKEVLKWEHVKDLINVFENKITQL 418

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
                E I+   + + +      K +  P+ + +TG  +   L + IEI+G+  +  RL 
Sbjct: 419 NDLSPEAIKLLFKEIQKETGYKGKNLFMPIRVVLTGKTHGPELVEIIEIVGKENILKRLE 478


>gi|304312836|ref|YP_003812434.1| Glutamyl-tRNA synthetase [gamma proteobacterium HdN1]
 gi|301798569|emb|CBL46799.1| Glutamyl-tRNA synthetase [gamma proteobacterium HdN1]
          Length = 501

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 229/486 (47%), Positives = 320/486 (65%), Gaps = 1/486 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           +R RIAPSPTG+PH+GTAY ALFN + A++ GG+FILRIEDTD  RST  SE  +++SL+
Sbjct: 3   IRTRIAPSPTGDPHVGTAYIALFNLVFARQHGGQFILRIEDTDQVRSTRASEEQILESLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEGPD+GG +GPYRQSER +IYQ + + L+E   AF CF + + L+EMRR Q+ 
Sbjct: 63  WLGLGWDEGPDVGGPHGPYRQSERMSIYQQHARQLIESGHAFYCFATPDELDEMRREQQA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           R    RYDG  L+LS  E++R     + HV+R+ +P +G CV  D + G++EIPW+ VDM
Sbjct: 123 RGETPRYDGRGLELSPSEVQRRLGAGEPHVIRMKIPAEGVCVIDDMLRGKIEIPWSQVDM 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVL+K+DGMPTYHLANV+DDHLM+ITHV RGEEWISS PKH LLY+YF +  P F H+PL
Sbjct: 183 QVLVKADGMPTYHLANVVDDHLMEITHVIRGEEWISSAPKHQLLYRYFGWNQPLFCHMPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  MGYLPEAL+N+L  +     ++ ++   + +++  FD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYRRMGYLPEALLNYLGRMGWSMPDEREK-FSLAEMLTSFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           L  +S  G VFD  KL+WLNG+W+RE LS    + R   W    D L Q +   Q RI T
Sbjct: 302 LQRVSLGGPVFDVDKLNWLNGQWLREDLSADALVQRFRDWAFNVDYLGQIIPHVQKRIHT 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS +  +  F     L + A+ F++  L  +++  IL+ +    +  + W  EN+   L 
Sbjct: 362 LSDVVPLAGFFLAGMLDVKAQDFENAKLSADQVRQILQFSSWYLDGERAWNIENLSAGLT 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            +AQ  +  ++  + P+F+AI G   +  + D++ ILG  +   R+RHA+ +V    +  
Sbjct: 422 TIAQAMDIKMRDFMIPIFVAIAGKPQAPSITDAMGILGADISRARVRHALGVVGGPSKKE 481

Query: 487 KKKELK 492
            K   K
Sbjct: 482 VKAWEK 487


>gi|320449649|ref|YP_004201745.1| glutamyl-tRNA synthetase [Thermus scotoductus SA-01]
 gi|320149818|gb|ADW21196.1| glutamyl-tRNA synthetase [Thermus scotoductus SA-01]
          Length = 472

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 190/478 (39%), Positives = 284/478 (59%), Gaps = 18/478 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V  RIAPSPTG+PH+GTAY ALFNY+ A++ GG+F++RIEDTD  R    +E  ++ +LK
Sbjct: 2   VVTRIAPSPTGDPHVGTAYIALFNYVWARKNGGRFLVRIEDTDRTRYVPGAEERILAALK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+++DEGPDIGG + PYRQSER  +YQ + + LL +  A+R F + E LE +R+ +  
Sbjct: 62  WLGISYDEGPDIGGPHAPYRQSERLPLYQKHAEELLRRGWAYRAFETPEELERIRKEKGG 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
            +      G    +  +E E  ++  + HV+RL VP  G+   +D++ G +      +  
Sbjct: 122 YD------GRARNIPPEEAEERAKRGEPHVIRLKVPRPGTTEVRDELRGVVVYDNQEIPD 175

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            VLLKSDG PTYHLANV+DDHLM +T V R EEW+ S P H+LLY+ F + +P+F H+PL
Sbjct: 176 VVLLKSDGYPTYHLANVVDDHLMGVTDVIRAEEWLVSTPIHVLLYRAFGWEVPKFYHMPL 235

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDK+K+SKR++ TS+ +Y A G+LPEAL N+LAL+     +  + +  +++LI  F 
Sbjct: 236 LRNPDKTKISKRKSHTSLEWYRAEGFLPEALRNYLALMGFSMPDGRE-IFTLEELIEAFT 294

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-------MKEKDRLTQALTL 359
              +S  G VFD +KL WLNG++IRE L   E   R   +          +  L +A+ L
Sbjct: 295 WERVSLGGPVFDLEKLRWLNGKYIREVLPLEEVAERAKPFLQAAGLSWPSEAYLRRAVEL 354

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            + R  TL  LP+   +LF  D   T ++ +       E + +L+  +      + W   
Sbjct: 355 MRPRFDTLKELPEKAPYLFSEDYPFTEKALEKMR----EGLPVLREVEPLLRAQEDWSEA 410

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            ++  LR  AQ R   L  + +PL  A+TGS  +  LF+ + +LG+  V  RL  A+A
Sbjct: 411 ALDALLRGFAQERGLKLGQVAQPLRAALTGSLETPGLFEIMALLGKERVLARLARALA 468


>gi|291286934|ref|YP_003503750.1| glutamyl-tRNA synthetase [Denitrovibrio acetiphilus DSM 12809]
 gi|290884094|gb|ADD67794.1| glutamyl-tRNA synthetase [Denitrovibrio acetiphilus DSM 12809]
          Length = 483

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 192/486 (39%), Positives = 278/486 (57%), Gaps = 10/486 (2%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++++ +RVR APSPTG  H+G A TALFNYL AK TGGKF+LRIEDTD  R   +S   +
Sbjct: 1   MNNADIRVRFAPSPTGYLHVGGARTALFNYLFAKATGGKFLLRIEDTDRTRFQEDSLKEI 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
            +SL+W GL WDEGP+  G +GPY QSER  +YQ + + L+ +  A++CFC+ ERL+++R
Sbjct: 61  FESLRWMGLEWDEGPEKDGDFGPYIQSERLELYQKHAEQLIAEGHAYKCFCTPERLDQVR 120

Query: 122 RAQRKRNIPSRYDGHCLKL-SSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           + +  R           +  S+ EI+    + K +VVRL  P +G+  F+D V G +E P
Sbjct: 121 KEKEARKEQHGGYDRTCRNLSADEIQENIDDGKPYVVRLKAPLEGAISFEDMVRGIIETP 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N VD  VLLK+DG PTYHLA+V+DDH MKI+HV RG+EWI+S P+H+LLY+ F +  P 
Sbjct: 181 VNMVDDTVLLKTDGFPTYHLASVVDDHFMKISHVMRGDEWIASTPRHVLLYKAFGWEAPV 240

Query: 241 FIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           F HLP+I +P   KLSKR+   S+  Y   GYLPEAL NFLALL      DD E+M +++
Sbjct: 241 FAHLPVILSPTGGKLSKRKGAASVMDYKRGGYLPEALFNFLALLG-WNPGDDREIMTVEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM------KEKDRLT 354
           ++  F    +S   AVFD+QKL+W+NG ++    S       +  W        ++D   
Sbjct: 300 IVEAFTAKKISSKPAVFDEQKLEWMNGHYMETYPSDKLADEVIPMWQERGLVVDDRDYAE 359

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
             + L Q R   ++ L +  D+ FK       +         E +   L+    E   + 
Sbjct: 360 GVVKLLQIRSKKVTELAETADYFFKDPEEYNEKQAAKQF--KEAVKPALEKLVAELPGVA 417

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
           +W R+++ET   +VA   E S   I   + LA+TG      LFD +  +G+     R++ 
Sbjct: 418 VWNRDSLETTFHSVADSLEMSPGKINPAVRLAVTGVGGGPDLFDMLSHMGKDRTVRRIKK 477

Query: 475 AIALVS 480
           A   + 
Sbjct: 478 ASETIG 483


>gi|717082|gb|AAC35209.1| glutamyl-tRNA synthetase [Sinorhizobium meliloti]
          Length = 484

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 291/486 (59%), Positives = 367/486 (75%), Gaps = 2/486 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GGKFILRIEDTD+ RST E E  V
Sbjct: 1   MADSAVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGKFILRIEDTDATRSTPEFEKKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +LKWCGL W EGPDIGG YGPYRQS+RK+IY+PYV+ ++     FRCFC+ ERLE+MR
Sbjct: 61  LDALKWCGLEWSEGPDIGGPYGPYRQSDRKDIYKPYVEKIVANGHGFRCFCTPERLEQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P +YDG CL LS++E+       + HVVR+ +P +GSC F+D VYG++EIPW
Sbjct: 121 EAQRAAGKPPKYDGLCLSLSAEEVTSRVDAGEPHVVRMKIPTEGSCKFRDGVYGDVEIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
            AVDMQVLLK+DGMPTYH+ANV+DDHLMKITHVARGEEW++SVPKHIL+YQY     P F
Sbjct: 181 EAVDMQVLLKADGMPTYHMANVVDDHLMKITHVARGEEWLASVPKHILIYQYLGLEPPVF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYY+A+GYLPEAL+NFL L F+ +  + +EL+ M++L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYTALGYLPEALMNFLGLFFI-QIAEGEELLTMEEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
              FD  +LSKAGA+FD QKLDWLN RWIREKLS  EF +RV  W  + +RL + L L+Q
Sbjct: 300 AEKFDPENLSKAGAIFDIQKLDWLNARWIREKLSEEEFAARVLAWAMDNERLKEGLKLSQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           +RI+ L  LP +  FLFKSDL L   +F      PEE++ IL T Q + E I  W +++I
Sbjct: 360 TRISKLGELPDLAAFLFKSDLGLQPAAFAGVKASPEEMLKILNTVQPDLEKILEWNKDSI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
           ET LR  ++   K LK +V PLF+A +GS+ SLPLFDS+E+LGRSVV  RL+ A  +V+S
Sbjct: 420 ETELRA-SERMGKKLKAVVAPLFVACSGSQRSLPLFDSMELLGRSVVRQRLKVAAQVVAS 478

Query: 482 LVQNHK 487
           +  + K
Sbjct: 479 MAGSGK 484


>gi|229547088|ref|ZP_04435813.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX1322]
 gi|255971589|ref|ZP_05422175.1| glutamyl-tRNA synthetase [Enterococcus faecalis T1]
 gi|255974561|ref|ZP_05425147.1| glutamyl-tRNA synthetase [Enterococcus faecalis T2]
 gi|256761893|ref|ZP_05502473.1| glutamyl-tRNA synthetase [Enterococcus faecalis T3]
 gi|256956974|ref|ZP_05561145.1| glutamyl-tRNA synthetase [Enterococcus faecalis DS5]
 gi|256964022|ref|ZP_05568193.1| glutamyl-tRNA synthetase [Enterococcus faecalis HIP11704]
 gi|257078650|ref|ZP_05573011.1| glutamyl-tRNA synthetase [Enterococcus faecalis JH1]
 gi|257084046|ref|ZP_05578407.1| glutamyl-tRNA synthetase [Enterococcus faecalis Fly1]
 gi|257087875|ref|ZP_05582236.1| glutamyl-tRNA synthetase [Enterococcus faecalis D6]
 gi|257088528|ref|ZP_05582889.1| glutamyl-tRNA synthetase [Enterococcus faecalis CH188]
 gi|307268959|ref|ZP_07550323.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX4248]
 gi|307274054|ref|ZP_07555264.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0855]
 gi|307276288|ref|ZP_07557415.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX2134]
 gi|307284101|ref|ZP_07564271.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0860]
 gi|307287139|ref|ZP_07567210.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0109]
 gi|307296633|ref|ZP_07576453.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0411]
 gi|312901254|ref|ZP_07760537.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0470]
 gi|312903152|ref|ZP_07762333.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0635]
 gi|312952477|ref|ZP_07771345.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0102]
 gi|229307817|gb|EEN73804.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX1322]
 gi|255962607|gb|EET95083.1| glutamyl-tRNA synthetase [Enterococcus faecalis T1]
 gi|255967433|gb|EET98055.1| glutamyl-tRNA synthetase [Enterococcus faecalis T2]
 gi|256683144|gb|EEU22839.1| glutamyl-tRNA synthetase [Enterococcus faecalis T3]
 gi|256947470|gb|EEU64102.1| glutamyl-tRNA synthetase [Enterococcus faecalis DS5]
 gi|256954518|gb|EEU71150.1| glutamyl-tRNA synthetase [Enterococcus faecalis HIP11704]
 gi|256986680|gb|EEU73982.1| glutamyl-tRNA synthetase [Enterococcus faecalis JH1]
 gi|256992076|gb|EEU79378.1| glutamyl-tRNA synthetase [Enterococcus faecalis Fly1]
 gi|256995905|gb|EEU83207.1| glutamyl-tRNA synthetase [Enterococcus faecalis D6]
 gi|256997340|gb|EEU83860.1| glutamyl-tRNA synthetase [Enterococcus faecalis CH188]
 gi|306495969|gb|EFM65557.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0411]
 gi|306501737|gb|EFM71028.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0109]
 gi|306503472|gb|EFM72721.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0860]
 gi|306507031|gb|EFM76174.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX2134]
 gi|306509362|gb|EFM78422.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0855]
 gi|306514767|gb|EFM83318.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX4248]
 gi|310629573|gb|EFQ12856.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0102]
 gi|310633543|gb|EFQ16826.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0635]
 gi|311291631|gb|EFQ70187.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0470]
 gi|315026630|gb|EFT38562.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX2137]
 gi|315029629|gb|EFT41561.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX4000]
 gi|315033515|gb|EFT45447.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0017]
 gi|315036338|gb|EFT48270.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0027]
 gi|315149014|gb|EFT93030.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX4244]
 gi|315153509|gb|EFT97525.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0031]
 gi|315155080|gb|EFT99096.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0043]
 gi|315158523|gb|EFU02540.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0312]
 gi|315163376|gb|EFU07393.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0645]
 gi|315165685|gb|EFU09702.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX1302]
 gi|315168263|gb|EFU12280.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX1341]
 gi|315578633|gb|EFU90824.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX0630]
 gi|329576206|gb|EGG57724.1| glutamate--tRNA ligase [Enterococcus faecalis TX1467]
          Length = 491

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 169/491 (34%), Positives = 266/491 (54%), Gaps = 20/491 (4%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + 
Sbjct: 5   MNMTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQ 64

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++L W G+ WDE P   G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R
Sbjct: 65  LENLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAER 124

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQ+ R     Y G C  L+  E         + V+R  VP      F D V GE+    
Sbjct: 125 EAQQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFES 184

Query: 182 NAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
           + +    V+ K DGMPTY+ A  +DDHLMKI+HV RG++ I++ PK +++Y+ F +  P 
Sbjct: 185 DNIGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPV 244

Query: 241 FIHLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMD 297
           F H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+  
Sbjct: 245 FGHMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFS 303

Query: 298 MQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW----------- 346
            + LI  FD   LSK+ A FD +KL+W+N ++++ ++   E       +           
Sbjct: 304 QEDLIKLFDEQRLSKSPAAFDAKKLEWINNQYMK-QMDLGELTDMCIPYLVADGRVEENP 362

Query: 347 -MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
             ++ + L Q ++L Q +++  + + ++++  F     L         L  E +  +L  
Sbjct: 363 SPEKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLD--DAAKEFLQGETVPTVLHA 420

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
            +E+ E + ++   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+
Sbjct: 421 FKEQLEALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGK 480

Query: 466 SVVYFRLRHAI 476
                 L   +
Sbjct: 481 EKALDHLNKVL 491


>gi|94711|pir||S21172 glutamate-tRNA ligase (EC 6.1.1.17) - Thermus aquaticus
 gi|15826583|pdb|1G59|A Chain A, Glutamyl-Trna Synthetase Complexed With Trna(Glu).
 gi|15826584|pdb|1G59|C Chain C, Glutamyl-Trna Synthetase Complexed With Trna(Glu).
 gi|157831204|pdb|1GLN|A Chain A, Architectures Of Class-Defining And Specific Domains Of
           Glutamyl-Trna Synthetase
 gi|48242|emb|CAA45854.1| glutamate--tRNA ligase [Thermus thermophilus]
          Length = 468

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 189/478 (39%), Positives = 280/478 (58%), Gaps = 18/478 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V  RIAPSPTG+PH+GTAY ALFNY  A+R GG+FI+RIEDTD  R    +E  ++ +LK
Sbjct: 2   VVTRIAPSPTGDPHVGTAYIALFNYAWARRNGGRFIVRIEDTDRARYVPGAEERILAALK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL++DEGPD+    GPYRQSER  +YQ Y + LL++  A+R F + E LE++R+ +  
Sbjct: 62  WLGLSYDEGPDVAAPTGPYRQSERLPLYQKYAEELLKRGWAYRAFETPEELEQIRKEKGG 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
            +      G    +  +E E  ++  + HV+RL VP  G+   +D++ G +      +  
Sbjct: 122 YD------GRARNIPPEEAEERARRGEPHVIRLKVPRPGTTEVKDELRGVVVYDNQEIPD 175

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            VLLKSDG PTYHLANV+DDHLM +T V R EEW+ S P H+LLY+ F +  P F H+PL
Sbjct: 176 VVLLKSDGYPTYHLANVVDDHLMGVTDVIRAEEWLVSTPIHVLLYRAFGWEAPRFYHMPL 235

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDK+K+SKR++ TS+ +Y A G+LPEAL N+L L+     +  + +  +++ I  F 
Sbjct: 236 LRNPDKTKISKRKSHTSLDWYKAEGFLPEALRNYLCLMGFSMPDGRE-IFTLEEFIQAFT 294

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-------MKEKDRLTQALTL 359
              +S  G VFD +KL W+NG++IRE LS  E   RV  +        + +  L +A+ L
Sbjct: 295 WERVSLGGPVFDLEKLRWMNGKYIREVLSLEEVAERVKPFLREAGLSWESEAYLRRAVEL 354

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            + R  TL   P+   +LF  D  ++ ++ +      EE + +LK         + W   
Sbjct: 355 MRPRFDTLKEFPEKARYLFTEDYPVSEKAQRKL----EEGLPLLKELYPRLRAQEEWTEA 410

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            +E  LR  A  +   L  + +PL  A+TGS  +  LF+ + +LG+     RL  A+A
Sbjct: 411 ALEALLRGFAAEKGVKLGQVAQPLRAALTGSLETPGLFEILALLGKERALRRLERALA 468


>gi|146295745|ref|YP_001179516.1| glutamyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|238685555|sp|A4XHE0|SYE1_CALS8 RecName: Full=Glutamyl-tRNA synthetase 1; AltName:
           Full=Glutamate--tRNA ligase 1; Short=GluRS 1
 gi|145409321|gb|ABP66325.1| glutamate--tRNA(Gln) ligase / glutamyl-tRNA synthetase
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 485

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 184/480 (38%), Positives = 268/480 (55%), Gaps = 15/480 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           +VR R APSPTG  HIG A TALFNYL AKR GGKFILRIEDTD +RS++ESE  +++SL
Sbjct: 2   EVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIESL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W G+ WDEG ++GG YGPYR +ER +IY+ YV  L EK  A+ C+C+ E LE  R+   
Sbjct: 62  RWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAYYCYCTEEELEAQRQELL 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RY G C  L+  +  R  QE +K  VR  VP     V  D V G++E   + + 
Sbjct: 122 SKGQMPRYLGKCRNLTEDQKRRFEQEGRKPTVRFKVPEGVKIVVHDLVRGDVEFLSDDIG 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V++KSDG+PTY+ A VIDDHLMKI+HV RGEE +S+ P+ IL+Y    F +P+F H+ 
Sbjct: 182 DFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALGFELPQFAHVS 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           LI   D++K+SKR   T +  Y   GYL E LINFLALL     ED + + DM+ LI +F
Sbjct: 242 LILGKDRTKMSKRHGSTWVEQYRDQGYLKEGLINFLALLGWSPPEDRE-IFDMEYLIENF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------EKDRL 353
            L  +SK  A+FD  KL+++N + I+   S  E       +              + + L
Sbjct: 301 SLERVSKNPAIFDIDKLNYINSQHIKL-KSLDELTQMCIPYFVEAGYIKEDEAKSKFEWL 359

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
            + +      +  LS +    D  F +++ +  E      L  + + D++   + +   +
Sbjct: 360 KKIVKSVYEGLDYLSQIKDRVDIFFNNEVKI-EEDEAKEVLKWDHVKDLINVFENKIRQM 418

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
                E I+   + + +      K +  P+ +A+TG  +   L + IEI+G+  +  RL 
Sbjct: 419 NELTPEAIKLLFKEIQKETGYKGKNLFMPIRVALTGKTHGPELVEIIEIVGKENILKRLE 478


>gi|315171287|gb|EFU15304.1| glutamyl-tRNA synthetase [Enterococcus faecalis TX1342]
          Length = 491

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 169/491 (34%), Positives = 267/491 (54%), Gaps = 20/491 (4%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + 
Sbjct: 5   MNMTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQ 64

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           +++L W G+ WDE P   G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R
Sbjct: 65  LENLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAER 124

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQ+ R     Y G C  L+  E         + V+R  VP      F D V GE+    
Sbjct: 125 EAQQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFES 184

Query: 182 NAV-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
           + +    V+ K DGMPTY+ A  +DDHLMKI+HV RG++ I++ PK +++Y+ F +  P 
Sbjct: 185 DNIGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPV 244

Query: 241 FIHLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMD 297
           F H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+  
Sbjct: 245 FGHMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFS 303

Query: 298 MQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW----------- 346
            + LI  FD   LSK+ A FD +KL+W+N ++++ ++   E       +           
Sbjct: 304 QEDLIKLFDEQRLSKSPAAFDAKKLEWINNQYMK-QMDLGELTDMCIPYLVADGRVEENP 362

Query: 347 -MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
             ++ + L Q ++L Q +++  + + ++++  F     L         L  E +  +L  
Sbjct: 363 SPEKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLD--DAAKEFLQGETVPTVLHA 420

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
            +E+ E ++++   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+
Sbjct: 421 FKEQLEALEVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGK 480

Query: 466 SVVYFRLRHAI 476
                 L   +
Sbjct: 481 EKALDHLNKVL 491


>gi|289207999|ref|YP_003460065.1| glutamyl-tRNA synthetase [Thioalkalivibrio sp. K90mix]
 gi|288943630|gb|ADC71329.1| glutamyl-tRNA synthetase [Thioalkalivibrio sp. K90mix]
          Length = 468

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 152/480 (31%), Positives = 255/480 (53%), Gaps = 24/480 (5%)

Query: 8   RVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKW 67
           R R APSPTG  HIG A TALF++L A+  GG+F+LRIEDTD +RST ES NA+++ + W
Sbjct: 4   RTRFAPSPTGYLHIGGARTALFSWLYARHHGGEFVLRIEDTDLERSTAESVNAILEGMNW 63

Query: 68  CGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKR 127
            GL +D        +GP+ Q+ER + Y+  +  L+    A+RC+C+ E L+ MR  Q+ R
Sbjct: 64  LGLTYD--------HGPFYQTERFDRYKEVIDQLMATGHAYRCYCTKEELDAMREEQKAR 115

Query: 128 NIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQ 187
               RYDG C   +        +E  + V+R   P++G  V  D V G++      +D  
Sbjct: 116 KEKPRYDGRCRTRTE------PREGVEPVIRFRTPDEGVTVVDDMVRGKVAFQNRELDDL 169

Query: 188 VLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLI 247
           ++ +SDG PTY+L  V+DD  M ITHV RG++ +++ P+ I + +      P + HLP+I
Sbjct: 170 IIARSDGSPTYNLTVVVDDMDMGITHVVRGDDHLNNTPRQINILKALGVEPPRYGHLPMI 229

Query: 248 KNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDL 307
             PD +KLSKR    S+  Y   GYLPEAL+N+L  L    +  D E+  + +L+  FD+
Sbjct: 230 MGPDGAKLSKRHGAVSVMQYRHEGYLPEALLNYLVRLG--WAHGDQEIFSVDELVRLFDI 287

Query: 308 HHLSKAGAVFDKQKLDWLNGRWIREKLSTT---EFLSRVSQ---WMKEKDRLTQALTLAQ 361
             ++++ +  +  KL WLN  +I+         EF   + Q          +   +   +
Sbjct: 288 EDVNQSASAINPDKLLWLNQHYIKTLDPDHVALEFGWHLGQLGIDPANGPAMRDVVIAQR 347

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R  TL  + + + + ++       ++ +       E + +L+T  + F  +  W++E +
Sbjct: 348 ERARTLREMAENSVYFYREFEDYDEKAARKQ--LTAEALPVLQTLHDGFSALGAWEKEPL 405

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              + +  +  +  L  + +PL +A+TGS  S P+ D++ ++GR     R+  A+  +S+
Sbjct: 406 HEVVVHTGERLDLKLGKVAQPLRVALTGSTVSPPIDDTLVLIGRERSLARIERALKKISA 465


>gi|299541905|ref|ZP_07052228.1| glutamyl-tRNA synthetase [Lysinibacillus fusiformis ZC1]
 gi|298725643|gb|EFI66284.1| glutamyl-tRNA synthetase [Lysinibacillus fusiformis ZC1]
          Length = 486

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 165/488 (33%), Positives = 275/488 (56%), Gaps = 19/488 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + +VRVR APSPTG  HIG A TALFNYL AK   GKFI+RIEDTD +R+    E + +
Sbjct: 1   MTKEVRVRYAPSPTGYLHIGGARTALFNYLYAKHHNGKFIVRIEDTDIERNVEGGEASQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW G+ +DE  DIGG Y PYRQ ER +IY+ + + LLE+ +A++CFCS+E+LE  R 
Sbjct: 61  DNLKWLGIEYDESIDIGGPYAPYRQMERLDIYKEHAEKLLEQGVAYKCFCSSEKLEASRE 120

Query: 123 AQRKRNI-PSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            Q+ R +    YDG C  LS+ E+       + + +R+ VP   +  F+D V G++    
Sbjct: 121 EQKARGVAAPTYDGTCRHLSADEVAAKEAAGEPYTIRMRVPENVTYEFEDLVRGQVTFES 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             +   VL+K++G+PTY+ A V+DDH M+I+HV RGEE +S+ PK ++++  F +  P F
Sbjct: 181 KDIGDWVLVKANGIPTYNYAVVLDDHFMEISHVFRGEEHLSNTPKQMMIFDAFGWEYPRF 240

Query: 242 IHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            H+ LI N ++ KLSKR       ++ Y  +GYLPEA+ NF ALL      + +E+   +
Sbjct: 241 GHMTLIINENRKKLSKRDESIIQFVTQYKDLGYLPEAMFNFFALLGWSPEGE-EEIFSKE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK----------- 348
           + I  FD   LSK+ ++FDKQKL W+N ++I++ LS  E ++     ++           
Sbjct: 300 EFIKIFDEKRLSKSPSMFDKQKLTWMNNQYIKK-LSLEEVVALSLPHLQKAGLLPEELTA 358

Query: 349 -EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
            +    T  + L   +++  + + +++   F   +    E+     L  E++ +++   +
Sbjct: 359 EQHAWATDLIALYHDQMSFGAEIVELSSLFFNDHIEYDEEA--KEVLAGEQVPEVMAAFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
            + E ++ +  + ++ A++ V +      K +  P+ +  TG  +   L ++I ++G+  
Sbjct: 417 AQLEELEEFTPDAVKAAIKAVQKTTGHKGKNLFMPIRVVTTGETHGPELPNAICLIGKEK 476

Query: 468 VYFRLRHA 475
              R+   
Sbjct: 477 AIDRVEKF 484


>gi|269838115|ref|YP_003320343.1| glutamyl-tRNA synthetase [Sphaerobacter thermophilus DSM 20745]
 gi|269787378|gb|ACZ39521.1| glutamyl-tRNA synthetase [Sphaerobacter thermophilus DSM 20745]
          Length = 497

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 175/503 (34%), Positives = 258/503 (51%), Gaps = 27/503 (5%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ ++VRVR APSPTG+ H+G A +ALF +L A+  GG FILRIEDTD +R    S   +
Sbjct: 1   MTGTRVRVRFAPSPTGDLHVGGARSALFTWLFARHHGGDFILRIEDTDRRRYVEGSVEGI 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           ++SLKW GL WDEG        P  QS+R  IY+ + + L+ +  A+ C+C+ ERLE++R
Sbjct: 61  VESLKWLGLEWDEG--------PIFQSQRLEIYREHAERLVAQGDAYPCYCTPERLEQVR 112

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             QR R  P  YD  C  L+  E      +     +R  +P  G+ V  D + G +    
Sbjct: 113 AEQRARGEPPGYDRRCRNLTPDERAEFEAQGITPAIRFKMPEAGTTVVPDLLRGNITFEN 172

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             ++  V+LKSDG PTYHLA ++DDHLM ITHV RGEEW+ S P H+ + Q F + +P F
Sbjct: 173 RLLEDAVILKSDGFPTYHLAAMVDDHLMGITHVTRGEEWLPSAPLHVRIIQAFGWDLPTF 232

Query: 242 IHLPLIKNPD-KSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           +HLP+I  PD K KLSKR     +  Y   GYLPEA++N+LALL       D E+   ++
Sbjct: 233 VHLPVILRPDGKGKLSKRDGAVGVLEYQRAGYLPEAVVNYLALLGWS--YGDQEIFTREE 290

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-------------- 346
           LI  FDL  ++ + A F   KL W+N  +I   +S  +   R   +              
Sbjct: 291 LIQLFDLKEINPSPARFSFDKLAWMNQYYINHIISLEDLTVRCIPYLREAGLVPAAAEDP 350

Query: 347 -MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKS-DLHLTAESFKSTALCPEEIIDILK 404
              E   +   + L + R+ TL+ + ++T F F        A+        P  +++ L 
Sbjct: 351 TTPEHAYVRSVVALLKDRLKTLAEVVELTSFFFTEGTEEYPADLLVPRKTEPASVLEGLD 410

Query: 405 TTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILG 464
            T+E            +E ALR +A         +  P+ +A TG   S  LF+++ +LG
Sbjct: 411 RTREILADADFEDEAGMEAALRALADEIGLKAGQLFMPIRVAATGRTVSPGLFETLRVLG 470

Query: 465 RSVVYFRLRHAIALVSSLVQNHK 487
           +     RL  A   + + V    
Sbjct: 471 KERTLARLDVARDKLRAYVTEQS 493


>gi|169830060|ref|YP_001700218.1| glutamyl-tRNA synthetase [Lysinibacillus sphaericus C3-41]
 gi|238688166|sp|B1HNM5|SYE_LYSSC RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|168994548|gb|ACA42088.1| Glutamyl-tRNA synthetase [Lysinibacillus sphaericus C3-41]
          Length = 486

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 164/488 (33%), Positives = 275/488 (56%), Gaps = 19/488 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + +VRVR APSPTG  HIG A TALFNYL AK   GKFI+RIEDTD +R+    E + +
Sbjct: 1   MTKEVRVRYAPSPTGFLHIGGARTALFNYLYAKHHNGKFIVRIEDTDIERNVEGGEASQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW G+ +DE  DIGG Y PYRQ ER +IY+ + + LL +  A++CFCS+E+LE  R 
Sbjct: 61  DNLKWLGIEYDESIDIGGPYAPYRQMERLDIYKEHAEKLLAQGAAYKCFCSSEKLEASRE 120

Query: 123 AQRKRNI-PSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            Q+ R +    YDG C  LS++E+       + + +R+ VP   +  F+D V G++    
Sbjct: 121 EQKARGVAAPTYDGTCRHLSAEEVAAKEAAGEPYTIRMRVPENVTYDFEDLVRGQVTFES 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             +   V++K++G+PTY+ A V+DDH M+I+HV RGEE +S+ PK ++++  F +  P F
Sbjct: 181 KDIGDWVIVKANGIPTYNYAVVLDDHFMEISHVFRGEEHLSNTPKQMMIFDAFGWEYPRF 240

Query: 242 IHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            H+ LI N ++ KLSKR       ++ Y  +GYLPEA+ NF ALL      + +E+   +
Sbjct: 241 GHMTLIINENRKKLSKRDESIIQFVTQYKDLGYLPEAMFNFFALLGWSPEGE-EEIFSKE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK----------- 348
           + I  FD   LSK+ ++FDKQKL W+N ++I++ LS  E ++     ++           
Sbjct: 300 EFIKIFDEKRLSKSPSMFDKQKLTWMNNQYIKK-LSLEEVVALSLPHLQKAGLLPDELSA 358

Query: 349 -EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
            +    T  + L   +++  + + +++   FK  +    E+     L  E++ +++   +
Sbjct: 359 VQHAWATDLIGLYHDQMSFGAEIVELSSLFFKDHIEYDEEA--KAVLAGEQVPEVMAAFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
            + E ++ +  + ++ A++ V +      K +  P+ +  TG  +   L ++I ++G+  
Sbjct: 417 AQLEELEEFTPDAVKAAIKAVQKATGHKGKNLFMPIRVVTTGETHGPELPNAICLIGKEK 476

Query: 468 VYFRLRHA 475
              R+   
Sbjct: 477 AIDRVEKF 484


>gi|90021143|ref|YP_526970.1| glutamyl-tRNA synthetase [Saccharophagus degradans 2-40]
 gi|123277228|sp|Q21KM1|SYE_SACD2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|89950743|gb|ABD80758.1| glutamyl-tRNA synthetase [Saccharophagus degradans 2-40]
          Length = 503

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 229/487 (47%), Positives = 315/487 (64%), Gaps = 2/487 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R+APSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE A++ SL+
Sbjct: 3   VRTRVAPSPTGDPHVGTAYIALFNLCFARKHGGQFILRIEDTDQSRSTPESEQAILDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEGPD+GGA GPYRQSERK IY  YVQ LL+   AF+C+ +TE L+ +R A+++
Sbjct: 63  WLGLEWDEGPDVGGAAGPYRQSERKEIYAQYVQQLLDAGHAFKCYRTTEELDMLRAARKE 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQG-SCVFQDKVYGEMEIPWNAVD 185
             I S      L L+ QE          +VVR+ VP +  +C   D + G +++ W+ VD
Sbjct: 123 AGIHSALKQSDLMLTEQEQAEREAAGIPYVVRMKVPEEEGACQVTDLLRGNIDLDWSMVD 182

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
            Q+L+KSDGMPTYHLANV+DDHLMKITHV RGEEWI+S PKHILLYQYF + +P F HLP
Sbjct: 183 AQILMKSDGMPTYHLANVVDDHLMKITHVIRGEEWINSAPKHILLYQYFGWDVPVFCHLP 242

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDK+KLSKR+NPTSI YY   GYLPEAL N+L  +     ++ ++   +Q++++HF
Sbjct: 243 LLRNPDKTKLSKRKNPTSILYYKQAGYLPEALTNYLGRMGWSMPDESEK-FSIQEMLNHF 301

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G VFD +KL+WLNG WIRE L       R+  W   +D L   +   + R+ 
Sbjct: 302 DIARVSLGGPVFDIEKLNWLNGLWIREDLDDAALAQRLVDWKFNQDNLLAVIPHVKQRME 361

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
           TL     M  FL  + L +T ESFK   L  E+   +L+    + + ++ W+R++I   L
Sbjct: 362 TLGDFLPMVSFLAANTLGITEESFKGNKLDLEDQKKVLQFALWQLDTMRTWERDDIFATL 421

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
           + +A      LK  + PLF+AI+GS  S  + D++ +LG  +   RLR A+ ++    + 
Sbjct: 422 KGLADGMGIKLKDFLAPLFVAISGSTASFSVMDAMVLLGSDLSRARLRVAVEVLGGAGKK 481

Query: 486 HKKKELK 492
             K+  K
Sbjct: 482 VLKRYEK 488


>gi|229917381|ref|YP_002886027.1| glutamyl-tRNA synthetase [Exiguobacterium sp. AT1b]
 gi|229468810|gb|ACQ70582.1| glutamyl-tRNA synthetase [Exiguobacterium sp. AT1b]
          Length = 484

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 178/487 (36%), Positives = 266/487 (54%), Gaps = 16/487 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VRVR APSPTG  HIG A TALFNYL A+  GGK ILRIEDTD KR+ L    + M+
Sbjct: 1   MSEVRVRYAPSPTGHLHIGNARTALFNYLFARHAGGKMILRIEDTDQKRNVLNGVESQMK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            L+W G++WDEGP   G YGPY Q ER  IY+ YV  L+ K LA++C+ ++E LE  R A
Sbjct: 61  YLEWLGIDWDEGPGRDGDYGPYYQMERLAIYEKYVNELMSKGLAYKCYMTSEELEAEREA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q  R    RY G    L+ +E E    E +K  +R+ VP   +  + D V G++      
Sbjct: 121 QIARGEAPRYSGAHRNLTVEEREAFEAEGRKPSIRIRVPEGVTYKWTDVVKGDVSFESKD 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
               V++K DG+PTY+ A V+DDHLMKI+HV RG++ I++ PK +++Y    +  PEF H
Sbjct: 181 FGDWVIVKQDGIPTYNFAVVVDDHLMKISHVLRGDDHIANTPKQMMVYDALGWDYPEFGH 240

Query: 244 LPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           + LI N    KLSKR       I  Y+ +GYLP AL NF++LL       ++E+   ++ 
Sbjct: 241 MTLIYNDQHKKLSKRDESIIQFIEQYADLGYLPAALFNFISLLGWS-PVGEEEIFSKEEF 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM-----------KEK 350
           I  FD   LSK+ AVFD+QKL W+N  ++++          +               +E 
Sbjct: 300 IEMFDAKRLSKSPAVFDQQKLSWINSVYMKKATLDEVVALSLPFLQEAGRLPEAVSVEEA 359

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
           D  T  + L + ++T  + +  +TD  FK ++    E+     L  E +  +L   +++ 
Sbjct: 360 DWATNLIALYKEQMTHGAEIVALTDLFFKDEIEYDEEANA--VLSGETVPAVLAEFKQQL 417

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
           E I+ +  E I+ A +   +   +  K +  P+ +A TG  +   L ++I ++G+  V  
Sbjct: 418 EAIEDFTPEAIKAATKATQKATGQKGKNLFMPIRVATTGQTHGPELPNAISLIGKERVLK 477

Query: 471 RLRHAIA 477
           RL   +A
Sbjct: 478 RLTTLLA 484


>gi|116253921|ref|YP_769759.1| glutamyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841]
 gi|122988370|sp|Q1MBL0|SYE_RHIL3 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|115258569|emb|CAK09673.1| putative glutamyl-tRNA synthetase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 488

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 293/484 (60%), Positives = 362/484 (74%), Gaps = 1/484 (0%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
           +++ VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RST E E  V+
Sbjct: 6   TATGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTPEFETKVL 65

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKWCGL W EGPDIGG YGPYRQS+RK++YQPY Q LLEK  AFRCFC+  RLE+MR 
Sbjct: 66  DALKWCGLEWKEGPDIGGPYGPYRQSDRKDMYQPYAQELLEKGHAFRCFCTPARLEQMRE 125

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            QR    P +YDG CL L+++E+       +  V+R+ +P +GSC F D VYGE+ IPW+
Sbjct: 126 TQRAAGKPPKYDGLCLNLAAEEVTSRMAAGETTVIRMKIPTEGSCDFTDGVYGEVSIPWD 185

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +VDMQVL+K+DGMPTYH+ANVIDDHLMKITHVARGEEW++SVPKHILLY+YF +  P F+
Sbjct: 186 SVDMQVLVKADGMPTYHMANVIDDHLMKITHVARGEEWLASVPKHILLYRYFGWDQPVFM 245

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           HL L++N DKSKLSKR+NPTSISYYSA+GY+PEAL+NFL L F+ +  + +EL+ M +L 
Sbjct: 246 HLSLMRNADKSKLSKRKNPTSISYYSALGYIPEALMNFLGLFFI-QIAEGEELLTMDELS 304

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQS 362
             FD  +LSKAGA+FD QKLDWLNGRWIREKLS  EF +RV  W  E DRL + L L+Q+
Sbjct: 305 EKFDPENLSKAGAIFDIQKLDWLNGRWIREKLSEEEFQARVLTWAMENDRLKEGLRLSQT 364

Query: 363 RITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIE 422
           RI+ L  LP +  FL KSDL L    F      PEEI++IL T Q + E I  W  E IE
Sbjct: 365 RISKLGELPDLAGFLLKSDLGLQPSDFAKIKSPPEEILEILNTVQPDLEKILEWNVETIE 424

Query: 423 TALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSL 482
             LR +A    K LK++V PLF+A++GS  SLPLFDS+ ILGRSVV  RL+ A   V++L
Sbjct: 425 AELRAIADRMGKKLKVVVSPLFVAVSGSSRSLPLFDSMAILGRSVVRQRLKLASQAVAAL 484

Query: 483 VQNH 486
           V + 
Sbjct: 485 VGSK 488


>gi|83589980|ref|YP_429989.1| glutamyl-tRNA synthetase [Moorella thermoacetica ATCC 39073]
 gi|115305773|sp|Q2RJE3|SYE_MOOTA RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|83572894|gb|ABC19446.1| glutamyl-tRNA synthetase [Moorella thermoacetica ATCC 39073]
          Length = 490

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 178/488 (36%), Positives = 273/488 (55%), Gaps = 15/488 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFN+L A+   G F+LRI+DTD++RST  S   ++ 
Sbjct: 1   MNKVRVRFAPSPTGSLHIGGARTALFNWLFARHHNGTFVLRIDDTDTERSTEASYKEILA 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           ++ W GL+WDEGP+ GG +GPY QS+R  +Y+     LL +  A+ C+C+ E L E RR 
Sbjct: 61  AMGWLGLDWDEGPEKGGQFGPYLQSQRLELYRREAARLLNEGKAYLCYCTVEELAERRRQ 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
            +    P  YD  C  L+  +  RL QE ++ V+RL VP  G+ V +D + G++      
Sbjct: 121 AQAEGRPPMYDRRCRYLTPADRTRLEQEGRQPVIRLAVPETGTTVVKDLIRGDVAFENAT 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  ++ KS+GMPTY+ A VIDDHLM+I+H+ R EE +S+ PK IL+YQ   + +P F H
Sbjct: 181 IDDFIIFKSNGMPTYNFATVIDDHLMQISHIIRAEEHLSNTPKQILVYQALAYELPAFAH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +P+I  PD+SKLSKR   TS+  Y   GYLPEA+IN+LALL      + +E++ ++++I 
Sbjct: 241 VPMILAPDRSKLSKRHGATSVEEYRDEGYLPEAIINYLALLGWSPEGE-EEIIPLEKIIE 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKD 351
            F L  +SK  A++D +KL W+NG ++RE  +          +             K+ +
Sbjct: 300 QFSLERVSKNAAIYDTKKLTWINGHYLRE-GNLDRITRLALPFLQAKGLLPDPLPEKDYN 358

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
            +   +   + R+ TL+ +     + F    +   +  +     P     +L   +E   
Sbjct: 359 YVRSVIAAVRDRVKTLAEVADAASYFFTDVTNYEEKGIRKHFTRP-GAAALLDEARERLA 417

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            +  +  +  E A R++A+ +  S   +  P  LAI+G      LF+ +E+LGR  V  R
Sbjct: 418 TLPEFNAQAAEEAYRSLAEGKGISTGQLFHPTRLAISGRTMGPGLFEIMELLGRETVLAR 477

Query: 472 LRHAIALV 479
           L  A   +
Sbjct: 478 LDRAARWI 485


>gi|254786566|ref|YP_003073995.1| glutamyl-tRNA synthetase [Teredinibacter turnerae T7901]
 gi|237687518|gb|ACR14782.1| glutamate--tRNA ligase [Teredinibacter turnerae T7901]
          Length = 500

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 220/487 (45%), Positives = 311/487 (63%), Gaps = 2/487 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR RIAPSPTG+PH+GTAY ALFN   A++  GKF+LRIEDTD  RST ESE A++ SL+
Sbjct: 3   VRTRIAPSPTGDPHVGTAYIALFNLCFARKHNGKFVLRIEDTDQTRSTPESEQAILDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEGPD+GG +GPYRQSERK+IY  YV  LL K LAF+C+ +TE LE +R  +++
Sbjct: 63  WLGLDWDEGPDVGGEFGPYRQSERKDIYGQYVDELLAKGLAFKCYRTTEELETLRAERKE 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQ-GSCVFQDKVYGEMEIPWNAVD 185
             I S      L+LS +E      +   +VVR+ VP + G+C   D + G M++ W+ VD
Sbjct: 123 AGIHSALKPSDLRLSEEEQHAREAQGMPYVVRMVVPEEAGTCAVNDMLRGTMDLDWSLVD 182

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
            Q+LLKSDGMPTYHLANV+DDHLM ITHV RGEEWI+S PKH LLY+YF + +P   HLP
Sbjct: 183 AQILLKSDGMPTYHLANVVDDHLMGITHVIRGEEWINSAPKHQLLYEYFGWDMPVLCHLP 242

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDK+KLSKR+NPTSI YY  MG+L EAL+N+L  +     ++ ++   +  ++  F
Sbjct: 243 LLRNPDKTKLSKRKNPTSILYYKRMGFLAEALLNYLGRMGWSMPDEREK-FSLNDMLEQF 301

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD  KL WLNG WIRE     +   R++QW+  ++ L   +   + R+ 
Sbjct: 302 DISRVSLGGPIFDVAKLKWLNGLWIREDHDDAQLAERLTQWLLNEENLLAVIPHVKQRME 361

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
           TLS    +  FL    L L+ +SF    L  E    +L+      E ++ W+R+ I  AL
Sbjct: 362 TLSDFAPLVSFLASGQLPLSEDSFSPNKLDLETQKKVLQFALWRMEALRAWERDTIFVAL 421

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
           +++A      +K  + P+F+A++GS  S  + D++ +LG  +   RLR A+ ++    + 
Sbjct: 422 KSLADGLSIKMKDFLAPVFIAVSGSTASFSVMDAMVLLGPDMSRARLREAVEVLGGAGKK 481

Query: 486 HKKKELK 492
             K+  K
Sbjct: 482 VLKRYEK 488


>gi|300087234|ref|YP_003757756.1| glutamyl-tRNA synthetase [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299526967|gb|ADJ25435.1| glutamyl-tRNA synthetase [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 488

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 194/485 (40%), Positives = 271/485 (55%), Gaps = 19/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + ++RVR APSPTG PH+G    ALFN+L A+  GG FI+RIEDTD  R    + +A++
Sbjct: 1   MNDRIRVRYAPSPTGFPHVGNIRAALFNWLFARHHGGSFIVRIEDTDRSRYVEGAVDAIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             L+W GL+WDEGP+ GGA+GPY QS+R + Y+   + L+    A+RC CS  RLE MR 
Sbjct: 61  DGLRWLGLDWDEGPEKGGAFGPYFQSDRLDRYRAAAERLITAGYAYRCTCSPGRLEAMRA 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q     P  YD  C   +    +         VVR  +P +G+  F D + G++     
Sbjct: 121 EQTAAKKPPGYDRCCRNRTEPVAQG-----VASVVRFKMPLEGTTTFTDLIRGDVSFDNP 175

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +D  VLLKSDG PTYHLANV+DDH M I+HV RGEEWISS P+H+LLYQ   +  P   
Sbjct: 176 LLDDFVLLKSDGYPTYHLANVVDDHDMAISHVIRGEEWISSAPRHLLLYQALGYHPPALA 235

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           HLP+I  PD+SKLSKR    SI+ Y   GYL EA++NFL+LL     +  + LM  +Q+I
Sbjct: 236 HLPMILGPDRSKLSKRHGAVSITEYRNQGYLAEAMVNFLSLLGWSLDDRTE-LMRPEQII 294

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRL 353
             F L  +S+  A+F+ +KLDW+NG ++RE LS  +F  R   +           ++  L
Sbjct: 295 RSFTLDRVSRTAAIFNIEKLDWMNGVYLRE-LSLADFTDRALPFLQAGVPETANFDRPYL 353

Query: 354 TQALTLAQSRITT---LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
            +AL L Q R+         P++T F F  DL  +AE+     + P      L       
Sbjct: 354 EKALALLQERVKKLGEFRDQPELTRFFFTDDLEYSAEALIGKKITPSASAAALAAAVSRV 413

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
             +  +  EN+E ALR++A+        +   L +A+TG   S PLF+++ +LGR     
Sbjct: 414 AAVDEFSVENLEKALRSLAEELGLKPGQLFGCLRIAVTGQSVSPPLFETMAVLGRERTLR 473

Query: 471 RLRHA 475
           RL  A
Sbjct: 474 RLEKA 478


>gi|190893500|ref|YP_001980042.1| glutamyl-tRNA synthetase [Rhizobium etli CIAT 652]
 gi|238692555|sp|B3Q0S3|SYE_RHIE6 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|190698779|gb|ACE92864.1| glutamyl-tRNA synthetase protein [Rhizobium etli CIAT 652]
          Length = 484

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 289/472 (61%), Positives = 356/472 (75%), Gaps = 1/472 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RST E E  V
Sbjct: 1   MTTSGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTPEFETKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +LKWCGL W EGPDIGG YGPYRQS+RK IYQPY Q LL+K  AFRCFC+  RLE+MR
Sbjct: 61  LDALKWCGLEWKEGPDIGGPYGPYRQSDRKPIYQPYAQELLDKGHAFRCFCTPARLEQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P +YDG CL L+++E+   +   +  V+R+ +P +GSC F D VYG++ IPW
Sbjct: 121 EAQRAAGKPPKYDGLCLSLTAEEVTSRTAAGEASVIRMKIPPEGSCDFTDGVYGDVSIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           ++VDMQVL+K+DGMPTYH+ANVIDDHLMKITHVARGEEW++SVPKHILLY+YF +  P F
Sbjct: 181 DSVDMQVLIKADGMPTYHMANVIDDHLMKITHVARGEEWLASVPKHILLYRYFGWDQPVF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYYSA+GY+PEAL+NFL L F+ +  + +EL+ M +L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYSALGYIPEALMNFLGLFFI-QIAEGEELLTMDEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
              FD  +LSKAGA+FD QKLDWLNGRWIREKLS  EF +RV  W  E DRL   L L+Q
Sbjct: 300 SEKFDPDNLSKAGAIFDIQKLDWLNGRWIREKLSEEEFQARVLAWAMENDRLKAGLRLSQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           +RI+ L  LP +  FL KSDL L    F      PEEI++IL T Q + E I  W  E I
Sbjct: 360 TRISKLGELPDLAGFLLKSDLGLQPSDFAKIKSPPEEILEILNTVQPDLEKILEWNVETI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
           E  LR ++    K LK++V PLF+A++GS  SLPLFDS+ ILGRSVV  RL+
Sbjct: 420 EAELRAISDRMGKKLKVVVSPLFVAVSGSPRSLPLFDSMAILGRSVVRQRLK 471


>gi|209550995|ref|YP_002282912.1| glutamyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238064693|sp|B5ZQW4|SYE_RHILW RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|209536751|gb|ACI56686.1| glutamyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 484

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 288/472 (61%), Positives = 356/472 (75%), Gaps = 1/472 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RST E E  V
Sbjct: 1   MTTSGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTPEFETKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +LKWCGL W EGPDIGG YGPYRQS+RK +YQPY + LL+K  AFRCFC+  RLE+MR
Sbjct: 61  LDALKWCGLEWKEGPDIGGPYGPYRQSDRKPMYQPYAEELLDKGHAFRCFCTPARLEQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P +YDG CL L+++E+       +  V+R+ +P +GSC F D VYG++ IPW
Sbjct: 121 EAQRAAGKPPKYDGLCLSLTAEEVTSRMAAGETTVIRMKIPAEGSCDFTDGVYGDVSIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           ++VDMQVL+K+DGMPTYH+ANVIDDHLMKITHVARGEEW++SVPKHILLY+YF +  P F
Sbjct: 181 DSVDMQVLIKADGMPTYHMANVIDDHLMKITHVARGEEWLASVPKHILLYRYFGWDQPVF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYYSA+GY+PEAL+NFL L F+ +  + +EL+ M++L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYSALGYIPEALMNFLGLFFI-QIAEGEELLTMEEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
              FD  +LSKAGA+FD QKLDWLNGRWIREKLS  EF +RV  W  E DRL   L L+Q
Sbjct: 300 SAKFDPENLSKAGAIFDIQKLDWLNGRWIREKLSEEEFQARVLAWAMENDRLKAGLRLSQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           +RI+ L  LP +  FL KSDL L    F      PEEI++IL T Q + E I  W  E I
Sbjct: 360 TRISKLGELPDLAGFLLKSDLGLQPSDFAKIKSPPEEILEILNTVQPDLEKILEWNVETI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
           E  LR +A    K LK++V PLF+A++GS  SLPLFDS+ ILGRSVV  RL+
Sbjct: 420 EAELRAIADRMGKKLKVVVSPLFVAVSGSSRSLPLFDSMAILGRSVVRQRLK 471


>gi|332685570|ref|YP_004455344.1| glutamyl-tRNA synthetase, glutamyl-tRNA (Gln) synthetase
           [Melissococcus plutonius ATCC 35311]
 gi|332369579|dbj|BAK20535.1| glutamyl-tRNA synthetase, glutamyl-tRNA (Gln) synthetase
           [Melissococcus plutonius ATCC 35311]
          Length = 486

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 172/490 (35%), Positives = 263/490 (53%), Gaps = 20/490 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD KR+    E + ++
Sbjct: 1   MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGDFIIRIEDTDQKRNIEGGEKSQLE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +LKW G++WDE PD  GAYGPYRQSERK+IYQP +  LL    A++C+C+ E L+E R  
Sbjct: 61  NLKWLGVDWDESPDNPGAYGPYRQSERKDIYQPLIDQLLSSNRAYKCYCTPEELKEEREG 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q+       Y G C  L+  E      +    V+R  VP   S  F D V GE+    + 
Sbjct: 121 QKALGEMPHYAGKCANLTPSEQAENEAKGLIPVIRFRVPRNTSYTFNDMVKGEIVFESDN 180

Query: 184 V-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +    V+ K DGMPTY+ A  +DDHLMKITHV RG++ I++ PK +++Y+ F +  P F 
Sbjct: 181 IGGDFVIQKQDGMPTYNFAVAVDDHLMKITHVLRGDDHIANTPKQLMIYEAFGWTPPIFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
           H+ LI N    K   +R+      I  Y  +GYLPEA++NF  LL       ++E+   +
Sbjct: 241 HMTLIINAATGKKLSKRDETILQFIEQYRELGYLPEAMLNFTTLLGWS-PVGEEEIFSQR 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD   LSK+ A FD +KL W+N +++++ +   E       +             
Sbjct: 300 ELIDMFDPKRLSKSPAAFDAKKLAWVNNQYVKK-MDLHELTEMCIPYLIADGRVEKEPSS 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           ++   L   + L Q +++  + +  ++   F     L        AL  E    +L   +
Sbjct: 359 EKIQWLENMVHLYQPQMSYAAEMVDLSALFFNEHPVLD--DAAKEALSGETTPIVLSNFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           ++ E + I+   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+  
Sbjct: 417 DQLEKLVIFDAPSIKAAIKTVQKETGIKGKPLFMPIRVAVSGQTHGPELAETIELLGKEK 476

Query: 468 VYFRLRHAIA 477
           V   L + ++
Sbjct: 477 VLNHLNNVLS 486


>gi|323703781|ref|ZP_08115419.1| glutamyl-tRNA synthetase [Desulfotomaculum nigrificans DSM 574]
 gi|323531250|gb|EGB21151.1| glutamyl-tRNA synthetase [Desulfotomaculum nigrificans DSM 574]
          Length = 485

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 173/480 (36%), Positives = 260/480 (54%), Gaps = 15/480 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  HIG A +ALFN+L+A+R GG+F++RIEDTD +RS+ ESE  ++ +L+
Sbjct: 3   VRVRFAPSPTGPLHIGGARSALFNWLLARRYGGQFLVRIEDTDLERSSRESEENILNALR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G++WDEG  +GG  GPYRQ+ER   Y+   + LLE+  A+ C+C+ E L   R A   
Sbjct: 63  WLGIDWDEGIAVGGPNGPYRQTERLEKYRQVARQLLEQGHAYHCYCTEEELAAEREALMA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           +    RY G C  L +++  RL    +K V+R  VP        D V G +E   N +  
Sbjct: 123 KGELPRYTGRCRNLCAEDKARLEAAGRKPVLRFKVPADRIITIDDHVRGHVEFESNGIGD 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +++KSD +PTY+ A V+DDH M ITHV R EE +S+ P+ ILLY    +  PEF H+ L
Sbjct: 183 FIIMKSDNIPTYNFAVVVDDHDMNITHVVRAEEHLSNTPRQILLYDALGWQKPEFAHISL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D++K+SKR   TSI  Y  +GYLPEAL+NFLALL      +++ L    ++   F 
Sbjct: 243 ILGKDRAKMSKRHGATSIEQYQKLGYLPEALVNFLALLGWSPGGEEEILTLE-EIKRQFS 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKDRLT 354
           L  ++K  AVFD  KL+WLNG +IR + S          +             ++   L 
Sbjct: 302 LDRVAKNPAVFDIDKLNWLNGHYIR-QCSIERLTKLAIPYLQEAGYLEQEVSPEKFAWLE 360

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + + L Q  ++ ++ +    +  F+  +    E  +   L  E++  ++ T  E     +
Sbjct: 361 KLVALTQPYLSYMAEITSHVEPFFREQVAPVDEEARQI-LAGEQVPLVMNTAIELISAAE 419

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
               E+I+  L+ V +      K +  PL +A+ G  +   L   I +LG+     RL+ 
Sbjct: 420 ELTEESIKPLLKAVGKQTGLKGKFVFMPLRVALIGKPHGPELHQIIAVLGKERTIARLKA 479


>gi|51891154|ref|YP_073845.1| glutamyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863]
 gi|67461731|sp|Q67TJ2|SYE_SYMTH RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|51854843|dbj|BAD39001.1| glutamyl-tRNA synthetase [Symbiobacterium thermophilum IAM 14863]
          Length = 482

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 182/480 (37%), Positives = 272/480 (56%), Gaps = 18/480 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVRIAPSPTG  H+G  +TALFN+L A+  GGKFILR EDTD +RS  E E  + + LK
Sbjct: 3   VRVRIAPSPTGPIHVGNVHTALFNWLFARHHGGKFILRFEDTDLERSRPEWEQVIFEDLK 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G++WDEGPDIGG YGPYRQ+ER ++Y+ Y Q LLE    ++C+C+ E  +  RR  + 
Sbjct: 63  WLGIDWDEGPDIGGPYGPYRQTERLDLYRKYAQQLLESGHVYKCYCTKEEEDADRREAQA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
              P +Y G C  L+ ++      E +K V+R  VP      F D V G +E+P +++  
Sbjct: 123 AGRPYQYKGRCRDLTPEQQAAFEAEGRKPVLRFRVPRGEVIRFNDLVRGPIEVPTDSIGD 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++++++GMP Y+ A V+DD  M ITHV RGE  I + P  IL+YQ   FP+PEF HL  
Sbjct: 183 FIIMRANGMPLYNFAVVVDDVTMNITHVLRGEGHIPNTPVQILIYQALGFPVPEFGHLGH 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKS--EDDDELMDMQQLIHH 304
           + NP++ KLSKR+   +I  Y   GYLPEA++NF++LL       E   E +  ++LI  
Sbjct: 243 MTNPERGKLSKRKGEAAIRDYREQGYLPEAMLNFMSLLGWTPPGAESGREFLTKEELIRE 302

Query: 305 FDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKDR 352
           FDL  ++KA +VFD+ KL+W+NG +IR+  S  EF      +                D 
Sbjct: 303 FDLSRVTKASSVFDRNKLNWMNGVYIRK-KSLEEFAELALPFVVSAGLCTEEQARARWDW 361

Query: 353 LTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEV 412
             + +     R+ TL+ +PQ  D   K ++ +  ++ +      E +    +   E    
Sbjct: 362 FKEVMAQVHERVETLAEIPQHVDIFLKDEIEMDEKAARK--FLTEAVKPFFQRVSEGLRS 419

Query: 413 IQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRL 472
           ++ W    IE  +R++ +    + K   +P+ +AITG   S  LF++I ++GR  V  R+
Sbjct: 420 VE-WSVPAIEQLVRSIQEEMGLTPKESFQPIRVAITGRTASPGLFETIYLIGRERVLERM 478


>gi|114566463|ref|YP_753617.1| glutamyl- and glutaminyl-tRNA synthetase [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
 gi|122318469|sp|Q0AYF8|SYE1_SYNWW RecName: Full=Glutamyl-tRNA synthetase 1; AltName:
           Full=Glutamate--tRNA ligase 1; Short=GluRS 1
 gi|114337398|gb|ABI68246.1| glutamyl-tRNA synthetase [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 495

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 179/488 (36%), Positives = 268/488 (54%), Gaps = 11/488 (2%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S +RVR APSPTG  H+G A TALFN+L A++ GGKFILRIEDTD +RS  +S   +++
Sbjct: 1   MSNIRVRFAPSPTGALHMGGARTALFNWLFARQNGGKFILRIEDTDFRRSREDSAQGIVE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            L W GL+WDEGPDIGG  GPYRQSER +IY  Y+Q LL+   A+ CFCS E L++ R  
Sbjct: 61  GLSWLGLDWDEGPDIGGPLGPYRQSERGDIYSRYLQELLDSGQAYYCFCSPEDLQKEREE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             +     +Y G C  L  +E   + Q  K  V+RL VP  G+ V  D + G++      
Sbjct: 121 AAQEKRDYKYGGRCKALKPEEASEMLQAGKPAVIRLKVPLDGNTVVPDLIRGDVSFSNAL 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
            D  ++ KSDG PTY+ A V+DD  M+I+HV R EE +S+ P+ +L+Y+      P F H
Sbjct: 181 FDDFIIAKSDGWPTYNFAVVVDDFSMQISHVLRAEEHLSNTPRQLLIYRALGLKEPAFAH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           L +I  PD+SKLSKR    S+  +   GYLPEAL+N+LALL     +D D +   ++++ 
Sbjct: 241 LSMILAPDRSKLSKRHGAISVQEFENQGYLPEALVNYLALLGWSTGKDID-IWSREEMMR 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDR--------LTQ 355
            F L H+SK+ A++D +KL W+NG+++   L     ++ V    +++            Q
Sbjct: 300 EFSLEHISKSPAIYDLEKLAWMNGQYMMR-LDIESLMALVEPQAQQQGWLNEDNFDYFQQ 358

Query: 356 ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
           A+ L ++R  T   L     + F+       +  K      ++   +L    E    +  
Sbjct: 359 AVELVRNRAKTRDELLDALGYFFEEVKQYDEKGVKKH-FGQQKASTMLSEVLEIVSNMGS 417

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA 475
           +    +E A R  AQ  +     ++ P  LA++G   +  LF+ +E+LG+     RL  A
Sbjct: 418 FSAAELEEAFRQRAQELKIKAADLIHPTRLALSGRTATPGLFELMEVLGQEKCISRLEKA 477

Query: 476 IALVSSLV 483
           +  ++ L 
Sbjct: 478 LDFIAKLT 485


>gi|88858343|ref|ZP_01132985.1| Glutamyl-tRNA synthetase (Glutamate-tRNA ligase) [Pseudoalteromonas
           tunicata D2]
 gi|88819960|gb|EAR29773.1| Glutamyl-tRNA synthetase (Glutamate-tRNA ligase) [Pseudoalteromonas
           tunicata D2]
          Length = 494

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 221/486 (45%), Positives = 310/486 (63%), Gaps = 2/486 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           +R R+APSPTG+PH+GTAY ALFNY  AK+ GG+F+LRIEDTD  RST ESE A+M SLK
Sbjct: 3   IRTRVAPSPTGDPHLGTAYIALFNYCFAKQQGGEFVLRIEDTDQVRSTRESEQAIMDSLK 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GLNWD GPD+GG +GPYRQSER  +Y+ Y   L+E   AF CF ++E L++MR  Q  
Sbjct: 63  WLGLNWDHGPDVGGEFGPYRQSERSELYRKYAHQLVEAGKAFYCFATSEELDQMRDEQVA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
             +  +YDG  LKLS+QE+       K +V+R+ +P +G+ VF+D + G++EIPW  VDM
Sbjct: 123 AGLRPKYDGRGLKLSAQEVAENLAAGKPYVIRMNIPEEGTFVFEDYLRGDIEIPWENVDM 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVLLK+DG PTY LANV+DDH M+I+H+ RGEEWI+S PK + LYQ F +  P   HLPL
Sbjct: 183 QVLLKADGFPTYFLANVVDDHHMEISHIFRGEEWINSAPKLLKLYQDFGWTPPVLGHLPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  MG+LPEAL+N+L  +     ++ ++   +  +I HFD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYKEMGFLPEALLNYLGRMGWSMPDEREK-FTLDDMIEHFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G +FD  KL+WLNG WIRE L+  + + R  +W    D + + +  A++RI T
Sbjct: 302 IKRVSLGGPIFDIDKLNWLNGLWIRENLTDEQLIQRFLEWKFNADLMAKVIPQAKTRINT 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS L ++                 +     + I   L+    E E ++ W +  I T  +
Sbjct: 362 LSDLVELAGHFVAGIPTYDPALLSAGKADADVIRQALQIFIWELEALRTWDKNEIFTIAK 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            VA H E  +K  ++P+F+AI+G   S  + D++EILG  +   RLR A+  +  + +  
Sbjct: 422 AVATHHELKIKEFLEPIFVAISGKTSSTSVVDAMEILGSDMSRARLRAALGHLG-VSKKQ 480

Query: 487 KKKELK 492
            K   K
Sbjct: 481 AKAFEK 486


>gi|146297188|ref|YP_001180959.1| glutamyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|238686640|sp|A4XLI3|SYE2_CALS8 RecName: Full=Glutamyl-tRNA synthetase 2; AltName:
           Full=Glutamate--tRNA ligase 2; Short=GluRS 2
 gi|145410764|gb|ABP67768.1| glutamyl-tRNA synthetase [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 482

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 178/481 (37%), Positives = 276/481 (57%), Gaps = 13/481 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG+ HIG A TALFNYL AK+  GKFILRIEDTD +RS  E   A+M+SLK
Sbjct: 2   VRVRFAPSPTGQLHIGGARTALFNYLFAKKHNGKFILRIEDTDLERSREEWAKAIMKSLK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEGPDIGG +GPY QS+RK+IY  Y+  LLE+  A+ CFCS E +E+ R   ++
Sbjct: 62  WLGIEWDEGPDIGGEFGPYFQSQRKDIYMEYINKLLEEGKAYYCFCSQEEIEKEREIAKQ 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
             +  +Y   C  +S +E +R  +  +K  VR+  P  G  V  D + G++E   + +D 
Sbjct: 122 NKVSYKYSKKCRNISLEEAKRRIKNGEKAAVRIKAPQDGVTVVHDIIRGDVEFSNDQLDD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++LKSDG PTY+   V+DD+ MKI+HV R EE +S+ PK +++YQ  N   P+F H+P+
Sbjct: 182 FIILKSDGNPTYNFVCVVDDYFMKISHVIRAEEHLSNTPKQLIIYQALNLTPPQFAHVPM 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD+SKLSKR   TS+  +   GYL EA++N+L LL      +D  ++ + + I  F+
Sbjct: 242 ILAPDRSKLSKRHGATSVEEFFENGYLKEAIVNYLLLLGWSPG-EDRTIIGLDEAIEKFE 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM---------KEKDRLTQAL 357
           L  +SK  A++D  KL W+NG +++E     +   R+  +           +K+ +  AL
Sbjct: 301 LEKVSKNAAIYDVNKLTWINGHYLKEIH-IEDLYERMKYFYSKKGIEIERFDKEYVKSAL 359

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            L + ++ TL  +   + + F        +  +       E ++I+K+  +E + ++ + 
Sbjct: 360 KLVREKVKTLVEVVDASTYFFDDSYEYDQKGVEK--YLTPENLNIVKSLLDELKNLEPFS 417

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
              IE+ +R  A+        I+  + + I+G   +  LF+ +E+LG+  V  R+     
Sbjct: 418 APEIESLVRKKAESLNVKAANIIHTIRVCISGRTVTPGLFEMMEVLGKKEVVKRIERTCE 477

Query: 478 L 478
            
Sbjct: 478 K 478


>gi|300861756|ref|ZP_07107836.1| glutamate--tRNA ligase [Enterococcus faecalis TUSoD Ef11]
 gi|300848281|gb|EFK76038.1| glutamate--tRNA ligase [Enterococcus faecalis TUSoD Ef11]
          Length = 485

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 169/489 (34%), Positives = 265/489 (54%), Gaps = 20/489 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + ++
Sbjct: 1   MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQLE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L W G+ WDE P   G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R A
Sbjct: 61  NLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAEREA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q+ R     Y G C  L+  E         + V+R  VP      F D V GE+    + 
Sbjct: 121 QQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFESDN 180

Query: 184 V-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +    V+ K DGMPTY+ A  +DDHLMKI+HV RG++ I++ PK +++Y+ F +  P F 
Sbjct: 181 IGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
           H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+   +
Sbjct: 241 HMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFSQE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
            LI  FD   LSK+ A FD +KL+W+N ++++ ++  +E       +             
Sbjct: 300 DLIKLFDEQRLSKSPAAFDAKKLEWINNQYMK-QMDLSELTDMCLPYLVADGRVEENPSP 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           ++ + L Q ++L Q +++  + + ++++  F     L         L  E +  +L   +
Sbjct: 359 EKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLD--DAAKEFLQGETVPTVLHAFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           E+ E + ++   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+  
Sbjct: 417 EQLEALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGKEK 476

Query: 468 VYFRLRHAI 476
               L   +
Sbjct: 477 ALDHLNKVL 485


>gi|327481720|gb|AEA85030.1| glutamyl-tRNA synthetase [Pseudomonas stutzeri DSM 4166]
          Length = 493

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 216/491 (43%), Positives = 316/491 (64%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESERQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER  IY+ Y   L+ K  AF CFCS ERL+++R
Sbjct: 59  YDALRWLGIEWDEGPDVGGPHGPYRQSERGEIYKKYSDELVAKGHAFPCFCSAERLDQVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q       RYDGHC+ L   E ER     + HV+R+ VP++G C  QD + G +EI W
Sbjct: 119 AEQMANKETPRYDGHCMHLDPAEAERRIAAGESHVIRMKVPSEGVCQVQDMLRGTVEIGW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTS+++Y  MG+LP+A++N+L  +     ++ ++   ++++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSVTFYERMGFLPQAMLNYLGRMGWSMPDEREK-FTLEEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFD+  +S  G +FD +KL WLNG+W+RE L   +F + V +W    + + +     Q
Sbjct: 298 IEHFDIRRVSLGGPIFDLEKLSWLNGQWLRE-LPVEQFAAEVRKWAFNPEYMMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   L L    F    L   ++  +++    + E ++ W++E I
Sbjct: 357 QRVETFSQIAPLAGFFFSGPLQLDQALFAHKKLDATQVRQVMQLILWKLEALRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              +  VA+H    L+ ++  +F AITG   S+ + D++EILG  +  FRLR+A+ L+  
Sbjct: 417 TACITQVAEHLGFKLRDVMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRNALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 ASKKEAKEWEK 487


>gi|29374701|ref|NP_813853.1| glutamyl-tRNA synthetase [Enterococcus faecalis V583]
 gi|39932159|sp|Q839V7|SYE_ENTFA RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|29342159|gb|AAO79925.1| glutamyl-tRNA synthetase [Enterococcus faecalis V583]
          Length = 485

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 169/489 (34%), Positives = 265/489 (54%), Gaps = 20/489 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + ++
Sbjct: 1   MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQLE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L W G+ WDE P   G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R A
Sbjct: 61  NLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAEREA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q+ R     Y G C  L+  E         + V+R  VP      F D V GE+    + 
Sbjct: 121 QQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFESDN 180

Query: 184 V-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +    V+ K DGMPTY+ A  +DDHLMKI+HV RG++ I++ PK +++Y+ F +  P F 
Sbjct: 181 IGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
           H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+   +
Sbjct: 241 HMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFSQE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
            LI  FD   LSK+ A FD +KL+W+N ++++ ++  +E       +             
Sbjct: 300 DLIKLFDEQRLSKSPAAFDAKKLEWINNQYMK-QMDLSELTDMCIPYLVADGRVEENPSP 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           ++ + L Q ++L Q +++  + + ++++  F     L         L  E +  +L   +
Sbjct: 359 EKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLD--DAAKEFLQGETVPTVLHAFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           E+ E + ++   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+  
Sbjct: 417 EQLEALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGKEK 476

Query: 468 VYFRLRHAI 476
               L   +
Sbjct: 477 ALDHLNKVL 485


>gi|258511833|ref|YP_003185267.1| glutamyl-tRNA synthetase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257478559|gb|ACV58878.1| glutamyl-tRNA synthetase [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 495

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 178/491 (36%), Positives = 258/491 (52%), Gaps = 14/491 (2%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + +VRVR APSPTG  HIG A TA FN+L A++ GGKF+LRI+DTD  RST  S   ++
Sbjct: 1   MAQEVRVRFAPSPTGALHIGGARTAYFNWLFARKHGGKFVLRIDDTDRARSTEASYQQIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           + L+W G+ WDEGPD+GG YGPYRQSER +IY+ ++  LL +  A+ CFC+ E L   R 
Sbjct: 61  EGLRWLGILWDEGPDVGGPYGPYRQSERMDIYRRHLDRLLAEDKAYPCFCTPEELARDRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           A ++   P RY G C  LS +E  R     + HV R+    +G  V  D + G++    +
Sbjct: 121 AAQREGKPPRYVGRCRHLSPEERSRRIAAGEPHVYRIRSRFEGETVVHDLIRGDVAFANS 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +D  ++ K+D  PTYH A+ +DD  MKI+HV R EE +S+ P+HI+L++      P F 
Sbjct: 181 EIDDFIIWKADDTPTYHFASCVDDVEMKISHVIRAEEHLSNTPRHIVLFEALGAEPPAFA 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+P+I  PD+SKLSKR   TS+S Y  MG LPEAL+N+L LL     +D + + D +  I
Sbjct: 241 HVPMILAPDRSKLSKRHGATSVSEYRDMGILPEALVNYLLLLGFSPGDDREIV-DRETAI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ------------WMKEK 350
             FDL  ++K  A++D +KL+WLN  + R++           Q              +  
Sbjct: 300 QLFDLEKVAKHAAIYDVKKLEWLNAHYFRQQSPEAVMDEAWPQLVERGYVAEDECRREVL 359

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
             +   +   Q+R   L  L       F+       +  +     PE     L+T  +  
Sbjct: 360 MWVRTVIAFVQTRSRNLQELVDGVRPYFEPVRAYDEKGVRKHFAHPETA-SRLRTVADRL 418

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
             +  +    IE   R   +        ++ P+ LAITG      LFD I ++GR     
Sbjct: 419 AGVAPFLAPVIEREFRRWIEEMGVKSGELIHPVRLAITGLTVGPGLFDVIALVGRDEAVR 478

Query: 471 RLRHAIALVSS 481
           RLR A   V +
Sbjct: 479 RLREAADRVEA 489


>gi|297171017|gb|ADI22031.1| glutamyl- and glutaminyl-tRNA synthetases [uncultured myxobacterium
           HF0200_05J13]
          Length = 482

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 217/478 (45%), Positives = 300/478 (62%), Gaps = 5/478 (1%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVRI PSPTG+PH+GTAY +LFNY+ AK+ GGKF+LRIEDTD  RS  E E  ++ SL+
Sbjct: 3   VRVRIGPSPTGDPHVGTAYISLFNYVFAKQHGGKFVLRIEDTDQTRSKPEWEQMIIDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEGPD+GG YGPYRQSER NIY  Y Q LL+K  A+RCFC++E L+E+R+AQR 
Sbjct: 63  WLGLDWDEGPDVGGEYGPYRQSERGNIYGEYAQMLLDKGAAYRCFCTSEELDEIRKAQRA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
              P  YDG    LS  E++      K  V+RL VP  G  + +D++ GE+E     +D 
Sbjct: 123 AGSPLGYDGRGRDLSDDEVQASIDAGKPFVLRLKVPRPGKTIVKDRLRGEIEFDNGQIDD 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVLLK+DGMPTYHLANV+DD+LMKI+HV R EEWISS PKH++LY+ F +  PEFIH+PL
Sbjct: 183 QVLLKTDGMPTYHLANVVDDYLMKISHVMRAEEWISSTPKHVMLYEAFGWDAPEFIHMPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++N DKSK+SKR+NP S++YY  +G+LP+AL+N+L ++     +  +E   +  +I +FD
Sbjct: 243 LRNKDKSKISKRKNPVSLNYYKEVGFLPDALLNYLGMMGWTMPDG-EEKFTVDDMIKNFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
              +S  G VFD QKL WLNG +IRE  S    + ++   +   + L     L   RI  
Sbjct: 302 FDRISLGGPVFDIQKLTWLNGLYIRE-ESVESIVEQLRANILTDEALHAVAGLVHKRIDK 360

Query: 367 LSALPQMTDFLFKSDLHLTAESFK---STALCPEEIIDILKTTQEEFEVIQIWKRENIET 423
           L      T F F  DL    ++ K         +E+ +  +   E  +V    + E++  
Sbjct: 361 LEDFVDQTAFFFGGDLTYDEKATKMMLPKGREKKEMTEAFQRAAEVIDVFADLEVESLTE 420

Query: 424 ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
           A+  + +      K    PL +A+TG+K S PLFDS+ +LG+     RLR A+  + +
Sbjct: 421 AMNTLREELGLKGKEFFMPLRIAVTGTKNSPPLFDSMVVLGKERCRRRLRMALQHLKT 478


>gi|312126758|ref|YP_003991632.1| glutamyl-tRNA synthetase [Caldicellulosiruptor hydrothermalis 108]
 gi|311776777|gb|ADQ06263.1| glutamyl-tRNA synthetase [Caldicellulosiruptor hydrothermalis 108]
          Length = 485

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 184/480 (38%), Positives = 268/480 (55%), Gaps = 15/480 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           +VR R APSPTG  HIG A TALFNYL AKR GGKFILRIEDTD +RS++ESE  +++SL
Sbjct: 2   EVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIESL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W G+ WDEG ++GG YGPYR +ER +IY+ YV  L EK  A+ C+C+ E LE  R+   
Sbjct: 62  RWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAYYCYCTEEELEAQRQELL 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RY G C  L+ +E  +L  E +K  VR  VP     V  D V G++E   + + 
Sbjct: 122 SKGQMPRYTGKCRNLTDEEKRKLEAEGRKPTVRFKVPEGVKIVVHDLVRGDVEFLSDDIG 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V++KSDG+PTY+ A VIDDHLMKI+HV RGEE +S+ P+ IL+Y    F +P+F H+ 
Sbjct: 182 DFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALGFELPQFAHVS 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           LI   D++K+SKR   T +  Y   GYL E LINFLALL     ED + + DM+ LI +F
Sbjct: 242 LILGKDRTKMSKRHGSTWVEQYKEQGYLKEGLINFLALLGWSPPEDKE-IFDMEYLIENF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------EKDRL 353
            L  +SK  A+FD  KL+++N + I+   S  E       +              + + L
Sbjct: 301 SLERVSKNPAIFDIDKLNYINSQHIKL-KSLDELTQMCIPYFVEAGYIKEDEAQSKFEWL 359

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
            + +      +  LS +    D  F +++ +  E      L  E + D++   + +   +
Sbjct: 360 KKIVKSVYEGLDYLSQIKDRVDIFFNNEVKI-EEDEAKEVLKWEHVKDLINVFENKVTQL 418

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
                E I+   + + +      K +  P+ + +TG  +   L + IEI+G+  +  RL 
Sbjct: 419 SELTPEAIKLLFKEIQKETGYKGKNLFMPIRVVLTGKTHGPELVEIIEIVGKENILKRLE 478


>gi|312793150|ref|YP_004026073.1| glutamyl-tRNA synthetase [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180290|gb|ADQ40460.1| glutamyl-tRNA synthetase [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 480

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 179/483 (37%), Positives = 283/483 (58%), Gaps = 13/483 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG+ HIG A TALFNYL AK+  GKFILRIEDTD +RS  E    +M+SL+
Sbjct: 2   VRVRFAPSPTGQLHIGGARTALFNYLFAKKHNGKFILRIEDTDLERSREEWAEGIMRSLR 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEGPD+GG +GPY QS+RK IY  Y+Q LL +  A+ CFC+ E +E  R   R+
Sbjct: 62  WLGIEWDEGPDVGGEFGPYFQSQRKEIYLEYIQKLLVEGKAYYCFCTQEEIEREREMARQ 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + IP +Y   C  +S +E ++  +  +K VVR+  P +G+ V  D + G++E   + +D 
Sbjct: 122 QKIPYKYSKKCRNISLEEAKKRIKNGEKAVVRIKAPVEGTTVVHDIIRGDVEFSNDQLDD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++LKSDG PTY+   VIDD+LMKI+HV R EE +S+ PK +++Y+  N   P+F H+P+
Sbjct: 182 FIILKSDGNPTYNFVCVIDDYLMKISHVIRAEEHLSNTPKQLIIYEALNIQPPQFAHVPM 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD+SKLSKR   TS+  +   GYL EA++N+L LL      +D  ++ + + I  F+
Sbjct: 242 ILAPDRSKLSKRHGATSVEEFFENGYLKEAIVNYLLLLGWSPG-EDRTIISLDEAIQKFE 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM---------KEKDRLTQAL 357
           L  +SK  A++D  KL W+NG +++E +   +   R+  +           +K+ +   L
Sbjct: 301 LEKVSKNAAIYDINKLTWINGYYLKE-IDLDDLYERMKYFYSKNGIDISSFDKEYVKSVL 359

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            L + ++ TL  +   + + F S+     +  +     P+ + + L+   ++ + I+ + 
Sbjct: 360 KLVREKVKTLVEVVSASIYFFDSNYEYEQKGVEK-YFTPDNLKN-LQLLLDDLKNIKPFS 417

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E IE  +R  A+        I+  + + I+G   +  LF+ +E+LG+  V  R+   + 
Sbjct: 418 AEEIEKLVRRKAEELNTKAANIIHTIRMCISGRTVTPGLFEMMEVLGKDEVINRIEKTLK 477

Query: 478 LVS 480
           + S
Sbjct: 478 MFS 480


>gi|312621499|ref|YP_004023112.1| glutamyl-tRNA synthetase [Caldicellulosiruptor kronotskyensis 2002]
 gi|312201966|gb|ADQ45293.1| glutamyl-tRNA synthetase [Caldicellulosiruptor kronotskyensis 2002]
          Length = 485

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 183/480 (38%), Positives = 266/480 (55%), Gaps = 15/480 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           +VR R APSPTG  HIG A TALFNYL AKR GGKFILRIEDTD +RS++ESE  +++SL
Sbjct: 2   EVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIESL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W G+ WDEG ++GG YGPYR +ER +IY+ YV  L EK  A+ C+C+ E LE  R+   
Sbjct: 62  RWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAYYCYCTEEELEAQRQELL 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RY G C  L+  +  R  QE +K  VR  VP     V  D V G +E   + + 
Sbjct: 122 SKGQMPRYTGKCRNLTEDQKRRFEQEGRKPTVRFKVPEGVKIVVHDLVRGNVEFLSDDIG 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V++KSDG+PTY+ A VIDDHLMKI+HV RGEE +S+ P+ IL+Y    F +P+F H+ 
Sbjct: 182 DFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALGFELPQFAHVS 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           LI   D++K+SKR   T +  Y   GYL E LINFLALL     ED + + DM+ LI +F
Sbjct: 242 LILGKDRTKMSKRHGSTWVEQYKDQGYLKEGLINFLALLGWSPPEDKE-IFDMEYLIENF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------EKDRL 353
            L  +SK  A+FD  KL+++N + I+   S  E       +              + + L
Sbjct: 301 SLERVSKNPAIFDIDKLNYINSQHIKL-KSLDELTQMCIPYFVEAGYIKEDEAQSKFEWL 359

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
            + +      +  LS +    D  F +++ +  E      L  + + D++   + +   +
Sbjct: 360 KKIVKSVYEGLDYLSQIKDRVDVFFNNEIKI-EEDEAKEVLKWDHVKDLINVFENKIRQM 418

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
                E I+   + + +      K +  P+ + +TG  +   L + IEI+G+  +  RL 
Sbjct: 419 NELTPEAIKLLFKEIQKETGYKGKNLFMPIRVVLTGKTHGPELVEIIEIVGKENILKRLE 478


>gi|218296517|ref|ZP_03497245.1| glutamyl-tRNA synthetase [Thermus aquaticus Y51MC23]
 gi|218243059|gb|EED09591.1| glutamyl-tRNA synthetase [Thermus aquaticus Y51MC23]
          Length = 468

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 190/478 (39%), Positives = 280/478 (58%), Gaps = 18/478 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V  RIAPSPTG+PH+GTAY ALFNY  A++ GG+FI+RIEDTD  R    +E  ++ +LK
Sbjct: 2   VVTRIAPSPTGDPHVGTAYIALFNYAWARKNGGRFIVRIEDTDRARYVPGAEERILAALK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W  + +DEGPDIGG + PYRQSER  IY+ Y + LL +  A+R F + E LE +R+ +  
Sbjct: 62  WLEIAYDEGPDIGGPHAPYRQSERLPIYKAYAEELLRRGWAYRAFETPEELERIRQEKGG 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
            +      G    +  +E E  ++  + HV+RL VP  G+   +D++ G +      +  
Sbjct: 122 YD------GRARHIPPEEAEERARRGEPHVIRLKVPRPGTTEVRDELRGVVVYDNGEIPD 175

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            VLLKSDG PTYHLANV+DDHLM +T V R EEW+ S P H+LLYQ F + +P F H+PL
Sbjct: 176 VVLLKSDGYPTYHLANVVDDHLMGVTDVIRAEEWLVSTPIHVLLYQAFGWEVPRFYHMPL 235

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPD++K+SKR++ TS+ +Y A G+LPEAL N+L L+     +  + +  +++ +  F 
Sbjct: 236 LRNPDRTKISKRKSHTSLEWYKAEGFLPEALRNYLCLMGFSMPDGRE-IFTLEEFVAAFS 294

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-------WMKEKDRLTQALTL 359
              +S  G +FD +KL W+NG++IRE LS  E   RV         +   +  L +A+ L
Sbjct: 295 WERVSLGGPIFDLEKLRWMNGKYIREVLSLEEVAQRVKPFLEAAGFFWPSEAYLRRAVEL 354

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            + RI TL  LP+   +LF  D   + ++        EE + +LK      +  + W   
Sbjct: 355 MRPRIDTLKELPEKAPYLFTEDYPFSEKARAKL----EEGLPVLKELLPLLKAQEDWGEA 410

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            +E  LRN A  R   L  + +PL  A+TGS  +  LF+ + +LGR     RL  A++
Sbjct: 411 ALEALLRNFAAQRGLKLGQVAQPLRAALTGSLETPGLFEIMALLGRERTLSRLERALS 468


>gi|86359246|ref|YP_471138.1| glutamyl-tRNA synthetase [Rhizobium etli CFN 42]
 gi|108935926|sp|Q2K425|SYE_RHIEC RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|86283348|gb|ABC92411.1| glutamyl-tRNA synthetase protein [Rhizobium etli CFN 42]
          Length = 488

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 288/471 (61%), Positives = 354/471 (75%), Gaps = 1/471 (0%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
           ++S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RST E E  V+
Sbjct: 6   TASGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTPEFETKVL 65

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKWCGL W EGPDIGG YGPYRQS+RK +YQPY Q LL+K  AFRCFC+  RLE+MR 
Sbjct: 66  DALKWCGLEWKEGPDIGGPYGPYRQSDRKPMYQPYAQELLDKGHAFRCFCTPARLEQMRE 125

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            QR    P +YDG CL L+++E+       +  V+R+ +P +GSC F D VYG++ IPW+
Sbjct: 126 TQRAAGKPPKYDGLCLNLTAEEVTARMAAGETTVIRMKIPAEGSCDFTDGVYGDVSIPWD 185

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +VDMQVL+K+DGMPTYH+ANVIDDHLMKITHVARGEEW++SVPKHILLY+YF +  P F+
Sbjct: 186 SVDMQVLIKADGMPTYHMANVIDDHLMKITHVARGEEWLASVPKHILLYRYFGWEQPVFM 245

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           HL L++N DKSKLSKR+NPTSISYYSA+GY+PEAL+NFL L F+ +  + +EL+ M++L 
Sbjct: 246 HLSLMRNADKSKLSKRKNPTSISYYSALGYIPEALMNFLGLFFM-QIAEGEELLTMEELS 304

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQS 362
             FD  +LSKAGA+FD QKLDWLNGRWIREKLS  EF +RV  W  E DRL   L L+Q+
Sbjct: 305 EKFDPDNLSKAGAIFDIQKLDWLNGRWIREKLSEEEFRARVLTWAMENDRLMAGLRLSQT 364

Query: 363 RITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIE 422
           RI+ L  LP +  FL KSDL L    F      PEEI++IL T Q + E I  W  E IE
Sbjct: 365 RISKLGELPDLASFLLKSDLGLQPSDFAKIKSPPEEILEILNTVQPDLEKILEWNVETIE 424

Query: 423 TALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
             LR VA    K LK++V PLF+A++GS  SLPLFDS+ +LGRSVV  RL+
Sbjct: 425 AELRAVADRLGKKLKVVVAPLFVAVSGSSRSLPLFDSMALLGRSVVRQRLK 475


>gi|317495367|ref|ZP_07953736.1| glutamyl-tRNA synthetase [Gemella moribillum M424]
 gi|316914426|gb|EFV35903.1| glutamyl-tRNA synthetase [Gemella moribillum M424]
          Length = 487

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 172/490 (35%), Positives = 268/490 (54%), Gaps = 16/490 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL AK  GG F+LRIEDTD KR+  E E + ++
Sbjct: 1   MTKVRVRYAPSPTGNLHIGNARTALFNYLFAKHYGGDFVLRIEDTDFKRNKEEGERSQLK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            + W GL++DEG      +GPYRQSER  IYQ Y + LL +  A++C+ + E LE  R  
Sbjct: 61  YMDWLGLDYDEGIGKEKEFGPYRQSERIEIYQKYAEQLLAEDKAYKCYMTAEELEAEREE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q    +P RY G    L+ +E ++  +E +K  +R+ VP   +  F D V GE+      
Sbjct: 121 QVANGLPPRYSGKHAHLTKEEQDQFEKEGRKPSIRIRVPQDRTYSFNDMVKGELSFEGKD 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
               V++K+DG+ TY+ A  IDDHLM+I+HV RG++ +S+ PK +++Y+   F  P F H
Sbjct: 181 FGDFVIVKNDGVATYNFAVAIDDHLMEISHVLRGDDHVSNTPKQLVVYEALGFKPPIFGH 240

Query: 244 LPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           + LI N +K KLSKR       I  Y  +GYLPEAL NF+ LL      + + +   ++ 
Sbjct: 241 MTLIVNENKKKLSKRDETIIQFIEQYDDLGYLPEALFNFITLLGWSPEGEQE-IFTREEF 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLST-----------TEFLSRVSQWMKEK 350
           +  FD   LSK+ A FD  KL W+N ++I+ +               E ++   +    +
Sbjct: 300 VKIFDEKRLSKSPAFFDNNKLTWINNQYIKAQPLERIVNIALPFFVKEGVATQEEVDNNR 359

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
               + ++L Q +++  + + ++T   F  ++    E  +   L  +  + + +   E+ 
Sbjct: 360 AWFEKLISLYQPQMSYGAEIVELTKQFFVEEIKFNEEELE--ILKQDTTVAVFEDFLEKL 417

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
           EV   +  ENI+T ++ + +      K +  P+ +A TGS +   L  S+E+LGR  V  
Sbjct: 418 EVAGDFTSENIKTLIKTIQKDTGVKGKNLFMPIRIASTGSMHGPELNTSLELLGRDRVVA 477

Query: 471 RLRHAIALVS 480
           R++ A+ L+ 
Sbjct: 478 RVKAALELIK 487


>gi|332976678|gb|EGK13518.1| glutamate--tRNA ligase [Psychrobacter sp. 1501(2011)]
          Length = 506

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 228/476 (47%), Positives = 318/476 (66%), Gaps = 2/476 (0%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
           S+  VR RIAPSPTG PH+GTAY ALFN   AK  GG+FILRIEDTD  RST +SE  ++
Sbjct: 6   SNRPVRTRIAPSPTGFPHVGTAYIALFNLAFAKAHGGEFILRIEDTDQSRSTEQSEKMIL 65

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +L+W GL+W EGPD GG + PYRQSER +IY+ + Q LL+K  AFRCFC+ E L+ MR 
Sbjct: 66  DALRWVGLDWAEGPDNGGPHAPYRQSERSDIYKKHAQELLDKGHAFRCFCTPEELDAMRA 125

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R     YDG    L  +E ++L+ E K  V+R+ VP +G C  QD + GE+EIPW 
Sbjct: 126 DQIARGENPHYDGRYADLPREESDKLAAEGKPFVIRMKVPTEGVCKVQDMLRGEVEIPWE 185

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            VDMQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW++S PKH LLY+YF + +P   
Sbjct: 186 QVDMQVLLKTDGLPTYHLANVVDDHLMEITHVIRGEEWLNSAPKHQLLYEYFGWEMPVLC 245

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+PL++NPDKSKLSKR+NPTSI+YY   G LPEAL+N+L  +     +D + +  ++++I
Sbjct: 246 HMPLLRNPDKSKLSKRKNPTSITYYRDAGVLPEALLNYLGRMGYSMPDDKE-IFTLEEMI 304

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQS 362
             FD+  +S  G +FD +KL+WLNG W+R  L+  +  +++  W  + D+LT      Q 
Sbjct: 305 ASFDITRVSLGGPIFDIEKLNWLNGEWLRA-LTPEQLKNKILDWANDSDKLTAIAAAIQP 363

Query: 363 RITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIE 422
           RI  LS       F F++  ++TAESF+  +L PE+I++IL+    + E +  W  ENI 
Sbjct: 364 RIHLLSDAVNWAGFYFQNLPNITAESFEHKSLTPEQIMEILQIATWKLEALPEWTEENIF 423

Query: 423 TALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
             L+ ++   +  L+ ++ P F+AI GS  S P+ +S+ ++G  +   RLRHA+ +
Sbjct: 424 ATLKGLSAAMDIKLRDMMAPFFIAIAGSTSSTPVMNSMYVIGADMTLTRLRHAVEV 479


>gi|256855021|ref|ZP_05560382.1| glutamyl-tRNA synthetase [Enterococcus faecalis T8]
 gi|257421382|ref|ZP_05598372.1| glutamyl-tRNA synthetase [Enterococcus faecalis X98]
 gi|294780001|ref|ZP_06745380.1| glutamate--tRNA ligase [Enterococcus faecalis PC1.1]
 gi|256709534|gb|EEU24581.1| glutamyl-tRNA synthetase [Enterococcus faecalis T8]
 gi|257163206|gb|EEU93166.1| glutamyl-tRNA synthetase [Enterococcus faecalis X98]
 gi|294452895|gb|EFG21318.1| glutamate--tRNA ligase [Enterococcus faecalis PC1.1]
 gi|323479280|gb|ADX78719.1| glutamyl-tRNA synthetase [Enterococcus faecalis 62]
          Length = 485

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 169/489 (34%), Positives = 264/489 (53%), Gaps = 20/489 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + ++
Sbjct: 1   MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQLE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L W G+ WDE P   G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R A
Sbjct: 61  NLAWLGMEWDESPAHPGEYGPYRQSERKEIYQPLIDQLLSSNRAYKCYCTPEELEAEREA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q+ R     Y G C  L+  E         + V+R  VP      F D V GE+    + 
Sbjct: 121 QQARGEMPHYAGTCANLTPSEQAAKEAAGLEPVIRFRVPRNTEYKFDDIVKGEITFESDN 180

Query: 184 V-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +    V+ K DGMPTY+ A  +DDHLMKI+HV RG++ I++ PK +++Y+ F +  P F 
Sbjct: 181 IGGDFVIQKRDGMPTYNFAVAVDDHLMKISHVLRGDDHIANTPKQLMIYEAFEWTPPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
           H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+   +
Sbjct: 241 HMTLIINSETGKKLSKRDETILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFSQE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
            LI  FD   LSK+ A FD +KL+W+N ++++ ++   E       +             
Sbjct: 300 DLIKLFDEQRLSKSPAAFDAKKLEWINNQYMK-QMDLGELTDMCIPYLVADGRVEENPSP 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           ++ + L Q ++L Q +++  + + ++++  F     L         L  E +  +L   +
Sbjct: 359 EKIEWLKQLVSLYQPQMSYAAEIVELSNLFFNEHPVLD--DAAKEFLQGETVPTVLHAFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           E+ E + ++   +I+ A++ V +      K +  P+ +A++G  +   L ++IE+LG+  
Sbjct: 417 EQLEALDVFDVPSIKAAIKAVQKETGVKGKNLFMPIRIAVSGQMHGPELGETIELLGKEK 476

Query: 468 VYFRLRHAI 476
               L   +
Sbjct: 477 ALDHLNKVL 485


>gi|135105|sp|P22249|SYE_BACST RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|143004|gb|AAA22494.1| transfer RNA-Gln synthetase [Geobacillus stearothermophilus]
          Length = 489

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 171/489 (34%), Positives = 274/489 (56%), Gaps = 19/489 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +  VRV  APSPTG  HIG A TALFNYL A+  GGK I+RIEDTD +R+    E + +
Sbjct: 1   MAKDVRVGYAPSPTGHLHIGGARTALFNYLFARHHGGKMIVRIEDTDIERNVEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++L+W G+++DE  D  G YGPYRQ+ER +IY+ YV  LLE+  A++CFC+ E LE  R 
Sbjct: 61  ENLQWLGIDYDESVDKDGGYGPYRQTERLDIYRKYVDELLEQGHAYKCFCTPEELERERE 120

Query: 123 AQRKRNIPSRYD-GHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            QR   I +    G C +L+ +++  L  + K + +RL VP   +    D V G++    
Sbjct: 121 EQRAAGIAAPQYSGKCRRLTPEQVAELEAQGKPYTIRLKVPEGKTYEVDDLVRGKVTFES 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             +   V++K++G+PTY+ A VIDDHLM+I+HV RGEE +S+ PK +++Y+YF +  P+F
Sbjct: 181 KDIGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHLSNTPKQLMVYEYFGWEPPQF 240

Query: 242 IHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            HL LI N  + KLSKR       +S Y  +GYLPEA+ NF ALL      + +E+    
Sbjct: 241 AHLTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMFNFFALLGWSPEGE-EEIFSKD 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD+  LSK+ ++FD +KL W+N ++I++ L     +                   
Sbjct: 300 ELIRIFDVSRLSKSPSMFDTKKLTWMNNQYIKK-LDLDRLVELALPHLVKAGRLPADMSD 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           +++      + L Q +++  + +  +++  FK ++    E+     L  E++ D+L    
Sbjct: 359 EQRQWARDLIALYQEQMSYGAEIVPLSELFFKEEVEYEDEA--RQVLAEEQVPDVLSAFL 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
                +  +  + I+ A++ V +   +  K +  P+  A+TG  +   L  +I++LG+  
Sbjct: 417 AHVRDLDPFTADEIKAAIKAVQKATGQKGKKLFMPIRAAVTGQTHGPELPFAIQLLGKQK 476

Query: 468 VYFRLRHAI 476
           V  RL  A+
Sbjct: 477 VIERLERAL 485


>gi|146307755|ref|YP_001188220.1| glutamyl-tRNA synthetase [Pseudomonas mendocina ymp]
 gi|166226846|sp|A4XVX2|SYE_PSEMY RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|145575956|gb|ABP85488.1| glutamyl-tRNA synthetase [Pseudomonas mendocina ymp]
          Length = 493

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 223/491 (45%), Positives = 321/491 (65%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER  IY+ Y   L+ K  AF CFCS ERL+E+R
Sbjct: 59  FDALRWLGIEWDEGPDVGGPHGPYRQSERGEIYKQYSDELVAKGHAFPCFCSAERLDEVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q       RYDGHC+ L   E +R     + HVVR+ VP++G CV  D + G++EIPW
Sbjct: 119 AQQMANKETPRYDGHCMHLDPAEAQRRIAAGESHVVRMKVPSEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P  
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPAL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTSI++Y  MGYLP+A++N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSITFYERMGYLPQAMLNYLGRMGWSMPDEREK-FSLNEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFD++ +S  G +FD +KL WLNG+W+RE L    F + V +W    + L +     Q
Sbjct: 298 IEHFDINRVSLGGPIFDLEKLSWLNGQWLRE-LPVETFAAEVQKWALNPEYLMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   L+L A+ F+   L P+++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQIAPLAGFFFSGALNLDAKLFEHKKLSPDQVRQLMQLILWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 TGCIQAVVEHLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRQALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 TSKKETKEWEK 487


>gi|312127975|ref|YP_003992849.1| glutamyl-tRNA synthetase [Caldicellulosiruptor hydrothermalis 108]
 gi|311777994|gb|ADQ07480.1| glutamyl-tRNA synthetase [Caldicellulosiruptor hydrothermalis 108]
          Length = 480

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 178/483 (36%), Positives = 283/483 (58%), Gaps = 13/483 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG+ HIG A TALFNYL AK+  GKFILRIEDTD +RS  E    +M+SLK
Sbjct: 2   VRVRFAPSPTGQLHIGGARTALFNYLFAKKHNGKFILRIEDTDLERSRKEWAEGIMKSLK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEGPD+GG +GPY QS+RK IY  Y+Q LLE+  A+ CFC+ E +E  R   R+
Sbjct: 62  WLGIEWDEGPDVGGEFGPYFQSQRKEIYLEYIQKLLEEGKAYYCFCTQEEIEREREIARQ 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + IP +Y   C  +S +E ++  +  +K VVR+  P +G+ V  D + G++E   + +D 
Sbjct: 122 QKIPYKYSKKCRNISLEEAKKRIENGEKAVVRIKAPVEGTTVVHDIIRGDVEFSNDQLDD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++LKSDG PTY+   VIDD+LMKI+HV R EE +S+ PK +++Y+  N   P+F H+P+
Sbjct: 182 FIILKSDGNPTYNFVCVIDDYLMKISHVIRAEEHLSNTPKQLIIYEALNIQPPQFAHVPM 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD+SKLSKR   TS+  +   GYL EA++N+L LL      +D  ++ +++ I  F+
Sbjct: 242 ILAPDRSKLSKRHGATSVEEFFENGYLKEAIVNYLLLLGWSPG-EDRTIISLEEAIQKFE 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM---------KEKDRLTQAL 357
           L  +SK  A++D  KL W+NG +++E +   +   R+  +           +K+ +   L
Sbjct: 301 LEKVSKNAAIYDINKLTWINGYYLKE-IDLDDLYERMKYFYSKKGIDISSFDKEYVKSVL 359

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            L + ++ TL  +   + + F S+     +  +         +  L+   ++ + +Q + 
Sbjct: 360 KLVREKVKTLVEVVSASTYFFDSNYEYEQKGVEKYFTADN--LKCLQLLLDDLKNVQPFS 417

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E IE  +R+ A+        ++  + + I+G   +  LF+ +E+LG+  V  R+   + 
Sbjct: 418 AEEIEKLVRSKAEEFNTKAANLIHTIRMCISGRTVTPGLFEMMEVLGKDEVIRRIEKTLK 477

Query: 478 LVS 480
           + +
Sbjct: 478 IFA 480


>gi|313635087|gb|EFS01436.1| glutamyl-tRNA synthetase [Listeria seeligeri FSL N1-067]
          Length = 491

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 170/490 (34%), Positives = 275/490 (56%), Gaps = 16/490 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNVEDGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M++LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL++ LA++C+C+ E LE  
Sbjct: 61  QMKNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQKLLDEGLAYKCYCTEEELEAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKEDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK +L+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQLLIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L     E ++E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWS-PEGEEEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK-------- 350
           ++ I  FD   LSK+ A+FD  KL W+N +++++ L   + +      +++         
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKK-LPLNDVVELSLPHLQKAGVVSAKLD 358

Query: 351 ----DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
               D + + ++L   +++  + +  +++  F     +T +  +   L  E +  ++   
Sbjct: 359 QAELDWVRKLVSLYHEQMSYGAEIVPLSEMFFADADSITFDEEEKAVLAEETVPTVISAF 418

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
           ++E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LG+ 
Sbjct: 419 KKELEALEVLEATEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGKE 478

Query: 467 VVYFRLRHAI 476
            V  RL   +
Sbjct: 479 KVINRLDTML 488


>gi|119468937|ref|ZP_01611962.1| glutamyl-tRNA synthetase [Alteromonadales bacterium TW-7]
 gi|119447589|gb|EAW28856.1| glutamyl-tRNA synthetase [Alteromonadales bacterium TW-7]
          Length = 494

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 213/482 (44%), Positives = 301/482 (62%), Gaps = 2/482 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           +R R+APSPTG+PH+GTAY ALFNY  AK+ GG+F+LRIEDTD  RST ESE A+M SL+
Sbjct: 3   IRTRVAPSPTGDPHLGTAYIALFNYCFAKQQGGEFVLRIEDTDQVRSTPESEQAIMDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WD GPD+GG +GPYRQSER ++Y+ Y   L+E+  AF CF ++E L++MR  Q  
Sbjct: 63  WLGLEWDHGPDVGGEFGPYRQSERSDLYKKYAHQLVEQGKAFYCFATSEELDQMREEQMA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
             +  +YDG  L  +  EI+      K +V+R+ +P++G+  F D +  E+EIPW  VDM
Sbjct: 123 EGLRPKYDGRGLNHTEDEIKANLAAGKPYVIRMKIPSEGTFKFNDYLRDEIEIPWENVDM 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVLLK+DG PTY LANV+DDH M+I+H+ RGEEWI+S PK + LY+ F +  P   HLPL
Sbjct: 183 QVLLKADGFPTYFLANVVDDHHMQISHIFRGEEWINSAPKLLKLYEDFGWEAPVLGHLPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  MGYLPEA++N+L  +     ++ ++   + ++I HFD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYKEMGYLPEAVLNYLGRMGWSMPDEREK-FTLDEMIEHFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD  KL WLNG WIRE L+  E + R   W    + L + L  A++RI T
Sbjct: 302 MKRVSLGGPVFDVDKLSWLNGTWIRENLTDEELVQRFVDWKFNGEMLAKVLPEAKTRINT 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS +  +                 +       I   L+    + E ++ + +  I    +
Sbjct: 362 LSDMVDLAGHFVGGIPTYDPALLTAGKADENVIRQALQFFVWQLEGLRSFDKPAIFGIAK 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            VA   E  +K  ++P+F+AITG   S  + D++EILG  +   RLR A+A +  + +  
Sbjct: 422 EVATFHELKIKDFLEPIFVAITGKTSSTSVLDAMEILGSDLSRARLRVALAHLG-ISKKQ 480

Query: 487 KK 488
            K
Sbjct: 481 AK 482


>gi|167629444|ref|YP_001679943.1| glutamyl-tRNA synthetase [Heliobacterium modesticaldum Ice1]
 gi|238687871|sp|B0TBU3|SYE_HELMI RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|167592184|gb|ABZ83932.1| glutamyl-tRNA synthetase [Heliobacterium modesticaldum Ice1]
          Length = 496

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 272/485 (56%), Gaps = 15/485 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
            +RVR APSPTG  HIG A +ALFN+L+A+R GG+FI+R+EDTD +RS+ ESE+ ++ +L
Sbjct: 3   NIRVRFAPSPTGPLHIGGARSALFNFLLARRFGGQFIVRVEDTDLERSSRESEDNILDAL 62

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W G+ WDEG  +GG + PYRQ+ER + Y+     LL +  A+RC+CS E LE  R+A  
Sbjct: 63  EWLGITWDEGIRVGGPHAPYRQTERLHTYREAADKLLAEGKAYRCYCSEEELEAERQAFA 122

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
           ++    RY G C  LS+ +  RL  E +K V+R  VP++G+    D V G +      + 
Sbjct: 123 EKGELPRYSGRCRSLSADDEARLRAEGRKPVIRFRVPDEGAVAIDDLVRGHVSFECAGIG 182

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             +++KSDG+PTY+ A VIDD  M ITHV RGEE +S+ P+ +L+Y       P+F H+ 
Sbjct: 183 DFIIVKSDGIPTYNFAVVIDDAQMAITHVIRGEEHLSNTPRQLLIYDALGLTPPKFAHVS 242

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           LI   D+SK+SKR   TS+  Y   GYLPEAL+NFL LL      + +E+  +  LI  F
Sbjct: 243 LILGKDRSKMSKRHGSTSVVAYQRQGYLPEALVNFLVLLGWSPGGE-EEIFSLDDLIAQF 301

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE------------KDRL 353
            L  ++K+ AVFD +KL+W+NG ++R+       ++     + E              ++
Sbjct: 302 SLDRVAKSPAVFDFEKLNWINGVYLRK-ADLDRLVALAMPHLIEAGVVQEPLDEAAARKV 360

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
              +   Q +++ ++ +       F   +   ++  K+  L  E++  +LK    +    
Sbjct: 361 RYMVQAIQEKVSYMAQIVDFIPLFFGDAITFESDEAKA-VLTEEQVPKVLKACLRKLTEG 419

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
           +    +N++  L+ V +  ++  + +  P+ +A+TG ++   L   I  LGR     R+R
Sbjct: 420 RDLTPDNVKAMLKEVTKETKEKGRNVFMPIRVALTGQQHGPDLNALITALGREGAVNRIR 479

Query: 474 HAIAL 478
            A  L
Sbjct: 480 RAAEL 484


>gi|312622789|ref|YP_004024402.1| glutamyl-tRNA synthetase [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203256|gb|ADQ46583.1| glutamyl-tRNA synthetase [Caldicellulosiruptor kronotskyensis 2002]
          Length = 480

 Score =  382 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 176/483 (36%), Positives = 283/483 (58%), Gaps = 13/483 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG+ HIG A TALFNYL AK+  GKFILRIEDTD +RS  E    +M+SL+
Sbjct: 2   VRVRFAPSPTGQLHIGGARTALFNYLFAKKHNGKFILRIEDTDLERSREEWAKGIMRSLR 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEGPD+GG +GPY QS+RK IY  Y++ LLE+  A+ CFC+ E +E  R   R+
Sbjct: 62  WLGIEWDEGPDVGGDFGPYFQSQRKEIYLEYIKKLLEEGKAYYCFCTQEEIEREREIARQ 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + IP +Y   C  +S +E ++  +  +K VVR+  P +G+ V  D + G++E   + +D 
Sbjct: 122 QKIPYKYSKKCRNISLEEAKKRIKNGEKAVVRIKAPVEGTTVVHDIIRGDVEFSNDQLDD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++LKSDG PTY+   VIDD+LMKI+HV R EE +S+ PK +++Y+  N   P+F H+P+
Sbjct: 182 FIILKSDGNPTYNFVCVIDDYLMKISHVIRAEEHLSNTPKQLIIYEALNIQPPQFAHVPM 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD+SKLSKR   TS+  +   GYL EA++N+L LL      +D  ++ + + I  F+
Sbjct: 242 ILAPDRSKLSKRHGATSVEEFFENGYLKEAIVNYLLLLGWSPG-EDRTIISLDEAIQKFE 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM---------KEKDRLTQAL 357
           L ++SK  A++D  KL W+NG +++E +   +   R+  +           +K+ +   L
Sbjct: 301 LENVSKNAAIYDINKLTWINGYYLKE-IDIDDLYERMKYFYSKNGIDISSFDKEYVKSVL 359

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            L + ++ TL+ +   + + F S+     +  +         +  L+    + + +Q + 
Sbjct: 360 KLVREKVKTLAEVVSASSYFFDSNYEYEQKGVEKYFTADN--LKYLQLLLNDLKNVQPFS 417

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E IE  +R+ A+        ++  + + I+G   +  LF+ +E+LG+  V  R+   + 
Sbjct: 418 AEEIEKLVRSKAEEFNTKAANLIHTIRMCISGRTVTPGLFEMMEVLGKDEVINRIEKTLK 477

Query: 478 LVS 480
           + +
Sbjct: 478 IFA 480


>gi|330502899|ref|YP_004379768.1| glutamyl-tRNA synthetase [Pseudomonas mendocina NK-01]
 gi|328917185|gb|AEB58016.1| glutamyl-tRNA synthetase [Pseudomonas mendocina NK-01]
          Length = 493

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 222/491 (45%), Positives = 319/491 (64%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER  IY+ Y   L+ K  AF CFCS ERL+E+R
Sbjct: 59  FDALRWLGIEWDEGPDVGGPHGPYRQSERGEIYKKYSDELVAKGHAFPCFCSAERLDEVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q       RYDGHC+ L   E +R     + HVVR+ VP++G CV  D + G +EIPW
Sbjct: 119 AQQMANKETPRYDGHCMHLEPAEAQRRIAAGESHVVRMKVPSEGVCVVPDMLRGHVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P  
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPAL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTSI++Y  MGYLP+A++N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSITFYERMGYLPQAMLNYLGRMGWSMPDEREK-FSLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFD++ +S  G +FD +KL WLNG+W+RE L    F + V +W    + L +     Q
Sbjct: 298 IEHFDINRVSLGGPIFDLEKLSWLNGQWLRE-LPVETFAAEVQKWALNPEYLMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+ T S +  +  F F   L+L A+ F+   L  +++  +++    + E ++ W++E I
Sbjct: 357 GRVETFSQIAPLAGFFFSGALNLDAKLFEHKKLSSDQVRQLMQLILWKLEALRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ V +H E  L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  
Sbjct: 417 TGCIQAVVEHLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRQALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 TSKKEAKEWEK 487


>gi|325295089|ref|YP_004281603.1| glutamyl-tRNA synthetase [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325065537|gb|ADY73544.1| glutamyl-tRNA synthetase [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 488

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 190/489 (38%), Positives = 282/489 (57%), Gaps = 14/489 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           +RVR APSPTG  H+G A TALFNYL AK   GK ILRIEDTD +R + E+ N + ++LK
Sbjct: 3   IRVRFAPSPTGFMHVGNARTALFNYLFAKHNDGKLILRIEDTDLERHSEEAVNVIYEALK 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G++WDEGP+IGG YGPYRQSER +IY+ Y++ L  K L + CFC+ E L+ MR+ Q +
Sbjct: 63  WMGISWDEGPNIGGDYGPYRQSERLDIYKRYIEELKNKGLVYECFCTPEELDAMRKEQLE 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA-VD 185
           R  P RY G C  L+ +E ER   E +K V+R  VP      F+D + GE+EI       
Sbjct: 123 RGEPPRYTGKCRNLTEKEKERFKAEGRKPVLRFKVPEDRVIKFKDLIKGEIEIHSRQLGG 182

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             VL++S+GMP Y+   VIDD LMKI+HV RGE+ IS+ PK ILLY+   F IP+F HLP
Sbjct: 183 DFVLVRSNGMPVYNFVVVIDDALMKISHVIRGEDHISNTPKQILLYEALGFSIPQFAHLP 242

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D+SKLSKR   TS+  +   GYL E+  NFLALL     +D  E++ M++LI  F
Sbjct: 243 MILGTDRSKLSKRHGSTSVKEFRDKGYLSESFTNFLALLG-WYPKDGKEILSMEELIERF 301

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW---------MKEKDRLTQA 356
           D+  ++ A AVFD  KL+W+N  +IR      +    +  +           ++  L + 
Sbjct: 302 DIKDVNSAPAVFDTTKLNWMNQVYIRA-YPIDKLTDFIIPYLEKVGFEVSKFDRSWLEKV 360

Query: 357 LTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI-QI 415
           + + +  +T LS  P   +   K D  +  E+ K   L  E  + +++T   + E + + 
Sbjct: 361 VEVTRDYLTVLSEAPIYMETFLKDDFEIEEEA-KKFVLENEVRLKVVETFYVKVENLDEE 419

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA 475
              E  +  ++ V +  +   K +  P+ +A+TG    + L   I +LG+  V  R+ ++
Sbjct: 420 LSSEKFKQIVKEVGKELKAKGKNLFMPVRIALTGKMKGVELDILISLLGKERVLKRISNS 479

Query: 476 IALVSSLVQ 484
           ++ +++   
Sbjct: 480 LSQLANKSN 488


>gi|313639764|gb|EFS04513.1| glutamyl-tRNA synthetase [Listeria seeligeri FSL S4-171]
          Length = 491

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 169/487 (34%), Positives = 273/487 (56%), Gaps = 16/487 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNVEDGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M++LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL++ LA++C+C+ E LE  
Sbjct: 61  QMKNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQKLLDEGLAYKCYCTEEELEAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKEDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK +L+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQLLIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK-------- 350
           ++ I  FD   LSK+ A+FD  KL W+N +++++ L   + +      +++         
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKK-LPLNDVVELSLPHLQKAGVVSAELD 358

Query: 351 ----DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
               D + + ++L   +++  + +  +++  F     +T +  +   L  E +  ++   
Sbjct: 359 QAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADADSITFDEEEKAVLAEETVPTVISAF 418

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
           ++E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LG+ 
Sbjct: 419 KKELEALEVLEATEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGKE 478

Query: 467 VVYFRLR 473
            V  RL 
Sbjct: 479 KVLNRLD 485


>gi|256827893|ref|YP_003156621.1| glutamyl-tRNA synthetase [Desulfomicrobium baculatum DSM 4028]
 gi|256577069|gb|ACU88205.1| glutamyl-tRNA synthetase [Desulfomicrobium baculatum DSM 4028]
          Length = 464

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 167/479 (34%), Positives = 247/479 (51%), Gaps = 23/479 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            + +  R  PSPTG  HIG A TALFNYL A++ GGKFILRIEDTD  RST E  +A++ 
Sbjct: 1   MTPIVTRFPPSPTGYLHIGGARTALFNYLYARQNGGKFILRIEDTDQARSTQEMTDAIID 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           ++ W GL++DEG        PY QSER ++Y  YV  L+E   A+ C C++E +E MR  
Sbjct: 61  AMHWLGLDFDEG--------PYFQSERGDLYNSYVDKLVETGKAYYCSCTSEEVEAMRET 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
            R   +  +Y+G C +L               VVR   P  G  VF D + G +      
Sbjct: 113 ARAAGLKPKYNGKCREL-------GLGPGPGRVVRFKTPLTGKVVFDDAIKGPISWDVQE 165

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  V+ ++DG   Y +A V+DD  M +THV RG++  ++ PK IL+Y+   FP+P F H
Sbjct: 166 MDDFVIRRADGSAIYQMAVVVDDAEMGVTHVLRGDDHQNNTPKQILIYEALGFPLPTFGH 225

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +P+I   DK K+SKR   TS+  Y  +GYLPEA++++L  L       DDEL  M +L+ 
Sbjct: 226 VPMILGSDKKKMSKRHGATSVMMYKDLGYLPEAMLSYLVRLGWS--HGDDELFTMAELLE 283

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLST------TEFLSRVSQWMKEKDRLTQAL 357
            F L  L K+ +VFD  KL+W N  +I+            E + + + +   +D L   +
Sbjct: 284 KFSLGGLGKSASVFDMDKLNWTNSHFIKIGDVPRLANLLDEMIRQNTDFEPARDYLEAIV 343

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            L Q R  TL  + +   F       L       T     E  + L    E  E +  + 
Sbjct: 344 PLFQPRAKTLKEMAEQATFFLHDAESLPYAEAAVTKFLTPETREHLNVLAERMEALPAFD 403

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI 476
            +++E  +    +      K + +P+ +AITG+  S  LF+++E+LGR     R R A+
Sbjct: 404 HQSLEEMVTAYLEETGLKFKALAQPIRVAITGTTMSPGLFETMEVLGRDRTLARFRKAL 462


>gi|283786481|ref|YP_003366346.1| glutamyl-tRNA synthetase [Citrobacter rodentium ICC168]
 gi|282949935|emb|CBG89560.1| glutamyl-tRNA synthetase [Citrobacter rodentium ICC168]
          Length = 471

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 247/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERL+ +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLDALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----GHEHHADDEPCVVRFANPQEGSVIFDDQIRGPIEFSNLELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+ +KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTEKLQWLNHHYINSLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLSAISDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPGLDVTVHAIGKARSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AGREAQQ 471


>gi|260767783|ref|ZP_05876718.1| glutamyl-tRNA synthetase [Vibrio furnissii CIP 102972]
 gi|260617292|gb|EEX42476.1| glutamyl-tRNA synthetase [Vibrio furnissii CIP 102972]
          Length = 475

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 155/489 (31%), Positives = 251/489 (51%), Gaps = 24/489 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAILEGMT 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEG        PY Q++R + Y   V+ LL +  A++C+   + L+E+R  Q  
Sbjct: 63  WLGLDWDEG--------PYYQTKRFDRYNEVVEQLLAEDKAYKCYAPKDLLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD    K+ +              +R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDADHPKIKAVNEAAKE--GDPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVVDDVDMGITHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDEGYLPEALINYLVRLGWG--HGDQEIFSREEMIELFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLT--------QALT 358
           L+ +SK+ + F+  KL WLN  +I+   S  E++++  +W  +   +           + 
Sbjct: 291 LNAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFDHQGINKANGPALADIVK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 349 LVGERCHTLVELAQQSRYFYEDFTEFDADAAKKH--LRGVAKEPLALALSKIEALTEWNT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   + +V    E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+A 
Sbjct: 407 EALHQVIADVCAELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGKDRVIARIQMALAF 466

Query: 479 VSSLVQNHK 487
           + +   N +
Sbjct: 467 IEAREANAQ 475


>gi|288554702|ref|YP_003426637.1| glutamyl-tRNA synthetase [Bacillus pseudofirmus OF4]
 gi|288545862|gb|ADC49745.1| glutamyl-tRNA synthetase [Bacillus pseudofirmus OF4]
          Length = 484

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 177/487 (36%), Positives = 274/487 (56%), Gaps = 16/487 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
             S+VRVR APSPTG  HIG A +ALFNYL AK  GGKFILRIEDTD  R+   +   +M
Sbjct: 1   MGSEVRVRFAPSPTGHLHIGGARSALFNYLFAKSQGGKFILRIEDTDQARNVETATEKLM 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            SLKW G+ WDE  D+GG YGPY   ER ++Y+ Y+Q L+++  A+ C+ +   LE  R 
Sbjct: 61  DSLKWLGIEWDESVDVGGEYGPYSCMERIDLYKEYIQKLIDEGKAYYCYMTESELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    +Y G    L+  E +   ++  K VVR  VP     V  D V G++    +
Sbjct: 121 EQLARGETPKYSGRDRNLTESERKAYEEKGLKPVVRFRVPEGQDIVIDDAVRGKVTFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V+ + DG+P Y+ A  +DDHLMKITHV RGEE +S+ P+ ++LYQ F +  P F 
Sbjct: 181 GIGDFVIARKDGVPMYNFAVTVDDHLMKITHVIRGEEHLSNTPRQVMLYQAFGWETPRFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H  LI NP++ K+SKR       +  Y  +GY+PEA++NFL+LL       ++E+  M++
Sbjct: 241 HASLILNPNRQKMSKRDESIIQFVEQYKELGYMPEAIVNFLSLLGWS-PVGEEEIFSMKE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIRE---------KLSTTEFLSRVSQWMKEKD 351
           L   F L  ++KA AVFD  KL W+N ++I+E          +   E   R+ + M E+ 
Sbjct: 300 LGEQFSLDRVAKAPAVFDTDKLTWMNNQYIKEAELERVLELTIPHLEKAGRLPEDMNEER 359

Query: 352 --RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + ++L Q ++   + + ++T+  FK+++    E+     L  E++ ++LK    E
Sbjct: 360 LEWTKRLVSLHQEKLHYGAEIVELTELFFKAEIDYNEEA--QNVLDEEQVPEVLKHFLSE 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E +  ++   I+ A+++  +   +  K +  P+ +A TG  +   L  SIE+LG++VV 
Sbjct: 418 LEELDTFEAAEIKAAIKSTQKATGQKGKNLFMPIRVATTGQTHGPDLLVSIELLGKAVVT 477

Query: 470 FRLRHAI 476
            RL+  +
Sbjct: 478 ARLKSLL 484


>gi|120554808|ref|YP_959159.1| glutamyl-tRNA synthetase [Marinobacter aquaeolei VT8]
 gi|166226834|sp|A1U1V3|SYE_MARAV RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|120324657|gb|ABM18972.1| glutamyl-tRNA synthetase [Marinobacter aquaeolei VT8]
          Length = 493

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 215/477 (45%), Positives = 310/477 (64%), Gaps = 2/477 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  ++ +L+
Sbjct: 3   VRTRIAPSPTGDPHVGTAYVALFNLCFARQHGGQFILRIEDTDQARSTAESEQDILTALR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GLNWDEGPD+GG +GPYRQSERK++Y  Y ++L+    AF CF + E L+ +R  ++ 
Sbjct: 63  WLGLNWDEGPDVGGPHGPYRQSERKHMYGQYAEDLVTAGHAFYCFRTPEELDAIREERKA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + +     G  L+L  +E++R       +V+R+ VP++G C  QD + G +EI W  VD 
Sbjct: 123 QGLNPGIKG-DLELPEEEVKRRLDAGDPYVIRMKVPDEGVCEIQDMLRGTIEIDWAQVDC 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           Q+LLKSDGMPTYHLANV+DDHLM ITHV RGEEWI+S PKH LLYQYF + +PE  HLPL
Sbjct: 182 QILLKSDGMPTYHLANVVDDHLMGITHVLRGEEWINSAPKHKLLYQYFGWDMPELCHLPL 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI++Y  MG+LPEA+ N+L  +     ++ ++   + ++I +FD
Sbjct: 242 LRNPDKSKLSKRKNPTSINFYERMGFLPEAVTNYLGRMGWSMPDEREK-FTLDEMIENFD 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD +KL WLNG+WIRE+LS  +F++R+ QW   +D L   +   + R   
Sbjct: 301 IQRVSLGGPVFDVEKLRWLNGQWIREELSDEQFMARMQQWWFNQDDLKALVPHIKGRAEV 360

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
            S +  M  F+F   L+L  E F    L   ++  +L+    + E  + W +  I   ++
Sbjct: 361 FSDVAPMAQFMFSGMLNLKPEDFAHNKLDESQVKRVLQFALWKLEAQRHWSKNTIFADIK 420

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLV 483
            +A+  +  +   +  +F+AI G+  S  + DS+ +LG  +   RLRHA+ ++    
Sbjct: 421 ALAKAMDLKMGDFMFSIFVAIAGTPNSWSVMDSMALLGPDMTRSRLRHALEVMGGFS 477


>gi|302872640|ref|YP_003841276.1| glutamyl-tRNA synthetase [Caldicellulosiruptor obsidiansis OB47]
 gi|302575499|gb|ADL43290.1| glutamyl-tRNA synthetase [Caldicellulosiruptor obsidiansis OB47]
          Length = 485

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 181/480 (37%), Positives = 272/480 (56%), Gaps = 15/480 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           +VR R APSPTG  HIG A TALFNYL AKR GGKFILRIEDTD +RS++ESE  +++SL
Sbjct: 2   EVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIESL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W G+ WDEG ++GG +GPYR +ER +IY+ YV  L EK  A+ C+CS E LE  R+   
Sbjct: 62  RWLGIEWDEGVEVGGPHGPYRSTERVDIYKKYVDVLFEKGYAYHCYCSEEELEAQRQQLL 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RY G C  L+ ++  R  QE +K  VR  VP     +  D V G++E   + + 
Sbjct: 122 SQGQMPRYLGKCRNLTEEQKRRFEQEGRKPTVRFKVPEGVKIIVHDLVRGDVEFMSDDIG 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V++KSDG+PTY+ A VIDDHLMKI+HV RGEE +S+ P+ IL+Y   +F +P+F H+ 
Sbjct: 182 DFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALDFNLPQFAHVS 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           LI   D++K+SKR   T +  Y   GYL E LINFLALL     ED + + DM  LI +F
Sbjct: 242 LILGKDRTKMSKRHGSTWVEQYKEQGYLKEGLINFLALLGWSPPEDKE-IFDMDYLIKNF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKDRL 353
            L  +SK  A+FD  KL+++N + I+   S  E       +             ++ + L
Sbjct: 301 SLDRVSKNPAIFDIDKLNYINSQHIKL-KSLDELTQMCIPYLIEAGYVTQKDAEEKFEWL 359

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
            + +      +  LS +    D  F +++ +  E      L  E +  ++   +++ + +
Sbjct: 360 KKIVKSVYEGLDYLSQIKDKVDIFFNNEVKI-EEDEAKEVLKWEHVKHLISVFEDKIKNV 418

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
           +    ++I+   + + +      K +  P+ + +TG  +   L + IEI+G+  +  RL 
Sbjct: 419 ENLNSDSIKMLFKEIQKETGYKGKNLFMPIRVVLTGKTHGPELVEIIEIVGKENILKRLE 478


>gi|253999402|ref|YP_003051465.1| glutamyl-tRNA synthetase [Methylovorus sp. SIP3-4]
 gi|253986081|gb|ACT50938.1| glutamyl-tRNA synthetase [Methylovorus sp. SIP3-4]
          Length = 469

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 152/476 (31%), Positives = 241/476 (50%), Gaps = 21/476 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R APSPTG  HIG A TALF++  A++ GG FILRIEDTD  RST E+  A++  + 
Sbjct: 3   VRTRFAPSPTGFLHIGGARTALFSWAYARKHGGSFILRIEDTDVARSTPEAVQAILDGMT 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEG        P+ Q +R + Y+  +Q LL+   A+ C+CS E L+ +R  Q +
Sbjct: 63  WLGLSWDEG--------PFYQMQRMDRYKEVIQQLLDSGDAYYCYCSKEELDALREQQMQ 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + I  RYDG   +  + ++          VVR   P  G+ V+ D V GE+ I    +D 
Sbjct: 115 QGIKPRYDGR-WRPEAGKVLPEPPAGVPPVVRFKNPQTGAVVWNDLVKGEIRISNEELDD 173

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M IT V RG++ +++ P+ I + Q     IP++ HL +
Sbjct: 174 LIIARADGTPTYNFCVVVDDWEMGITQVIRGDDHVNNTPRQINMLQALGAQIPQYAHLSM 233

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D  KLSKR    S+  Y   GYLPEA++N+LA L       DDE+  M Q    FD
Sbjct: 234 ILGDDGQKLSKRHGAVSVMQYHEDGYLPEAVLNYLARLGWS--HGDDEVFSMAQFCTWFD 291

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKL---STTEFLSRVSQWMKEKDRLTQ---ALTLA 360
           L H++ + A F+ +KL+WLN  +I++        +   R++    +          + L 
Sbjct: 292 LDHITPSAAQFNTEKLNWLNAHYIKQADISSLAADIQQRLTALGVDTANGPDLAGVIALY 351

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
           + R  TL+ L     + ++       ++  +      +++ +L     + E I  W  E+
Sbjct: 352 RERSNTLNDLASSIAYFYRKPET---DAAAAEKHLTVDVLPVLAGMAAKLENIA-WTTES 407

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI 476
           I   ++            I  PL + +TG   S  +   + +LG+     R+R ++
Sbjct: 408 IHDVIQATVSDNGLKFPKIAMPLRVMVTGGAQSPSIDAVMALLGKDETLSRIRESL 463


>gi|326567261|gb|EGE17381.1| glutamyl-tRNA synthetase [Moraxella catarrhalis 12P80B1]
 gi|326570012|gb|EGE20058.1| glutamyl-tRNA synthetase [Moraxella catarrhalis BC7]
 gi|326573682|gb|EGE23640.1| glutamyl-tRNA synthetase [Moraxella catarrhalis O35E]
          Length = 498

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 229/476 (48%), Positives = 311/476 (65%), Gaps = 2/476 (0%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +  VR RIAPSPTG PH+GTAY ALFN + AK  GG+FILRIEDTD  RST +SE  ++
Sbjct: 1   MTRPVRTRIAPSPTGFPHVGTAYIALFNLVFAKSMGGEFILRIEDTDQVRSTKQSEQMIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+W EGPD+GG + PYRQSER +IY+ Y + LL+   AFRCFC+ E L+ MR 
Sbjct: 61  DALKWAGLSWAEGPDVGGPHAPYRQSERADIYKKYAEKLLDDGHAFRCFCTPEELDAMRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ    +P +YDG    LS +E + L  + K  V+R+ VP+ G C  +D + GE+ IPW 
Sbjct: 121 AQMAAGLPVKYDGRYANLSREESDALVAQGKPFVIRMRVPSNGVCTIKDMLRGEVVIPWE 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            VDMQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLY+YF + +PE  
Sbjct: 181 QVDMQVLLKTDGLPTYHLANVVDDHLMQITHVLRGEEWLPSAPKHQLLYEYFGWQMPELC 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+PL++NPDKSKLSKR+NPTSI+YY   G LPEAL+N+L  +      + ++   + ++I
Sbjct: 241 HMPLLRNPDKSKLSKRKNPTSITYYRDAGILPEALMNYLGRMGYSLPNEQEK-FTLDEMI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQS 362
             FD+  +S  G VFD +KL WLNG ++R  LS  +  +++  W  +  +LT      Q 
Sbjct: 300 QSFDIQRISLGGPVFDIEKLYWLNGEYLRT-LSVDDLKNKILAWASDDTKLTAIARAIQP 358

Query: 363 RITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIE 422
           RI  LS       F F++   +TAE F   +L  E+I++IL     + E + IW  ENI 
Sbjct: 359 RINLLSDAINWAGFYFQNLPAITAEDFAYKSLDNEQILEILYLATWQLENLPIWSEENIY 418

Query: 423 TALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
             L+ +A H +  LK  ++P F+AI GS  S P+ +S+ I+G  +   RLRHA  +
Sbjct: 419 QTLKGLAAHFDIKLKDFMQPFFVAIAGSTSSTPVMNSMHIIGADMTLARLRHACEI 474


>gi|330686226|gb|EGG97838.1| glutamate--tRNA ligase [Staphylococcus epidermidis VCU121]
          Length = 484

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 173/487 (35%), Positives = 271/487 (55%), Gaps = 16/487 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S +VRVR APSPTG  HIG A TALFNYL AK  GG F++RIEDTDSKR+  + E++  
Sbjct: 1   MSERVRVRYAPSPTGYLHIGNARTALFNYLFAKHYGGDFVVRIEDTDSKRNLEDGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL WDE  D    YGPYRQSER +IY P ++ LLE+  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLEWDESVDKDKGYGPYRQSERADIYNPLIKQLLEEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V GE+    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPKDKTYTFNDMVKGEISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ +S+ PK +++Y+ F +  P F 
Sbjct: 181 NMGDWVIVKKDGVPTYNFAVAIDDHYMEISDVIRGDDHVSNTPKQLMIYEAFGWEAPRFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ LL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFITLLGWSPEGE-EEIYSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +           +   ++
Sbjct: 300 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFELALPHLIKANLIPENPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
            D   + + L Q  ++    +  +++  F        E  +   +  E++ +++     +
Sbjct: 360 LDWGRKLVALYQKEMSYAGEIVPLSEMFFNDMPEFGEE--EKEVINGEQVPELMTHLYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+ A++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKAIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKDKVL 477

Query: 470 FRLRHAI 476
            RL+  I
Sbjct: 478 SRLKEYI 484


>gi|262380453|ref|ZP_06073607.1| glutamyl-tRNA synthetase [Acinetobacter radioresistens SH164]
 gi|262297899|gb|EEY85814.1| glutamyl-tRNA synthetase [Acinetobacter radioresistens SH164]
          Length = 503

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 227/487 (46%), Positives = 309/487 (63%), Gaps = 2/487 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
            VR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   NVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           KW GLNW EGPDIGG + PYRQSER +IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  KWLGLNWSEGPDIGGPHAPYRQSERMHIYKQYALELVEKGHAFYCFATPEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    RYDG  L+LS +E+E      + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGESPRYDGRGLQLSHEEVECRLAAGEPHVIRMKVPAEGVCKFNDMLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQ+LLK+DG+PTYHLANV+DDHLM+ITHV RGEEWI S PKH LLY YF + +P   H+P
Sbjct: 182 MQILLKTDGLPTYHLANVVDDHLMQITHVIRGEEWIPSAPKHQLLYSYFGWDMPTICHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ ++   + ++I HF
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDESEK-FTLAEMIEHF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+  LS  E L+ +  W  ++++L +     Q RI 
Sbjct: 301 DIKRVSLGGPIFDVEKLNWLNGQWIKA-LSPAELLNTLLNWKADRNKLEEIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F    +++ E F+S  L  E++   L+      E +  W  + +   L
Sbjct: 360 LLSEAVNWAGFYFNQFPNISKEQFESKKLTEEQVRQSLQFAIWRLESLFTWNNDTVSQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            +++      L+  +   F+AI GS  S P+  S+  LG  + + RLR A+ +V    + 
Sbjct: 420 MDLSNQMGIKLRDFMPAFFIAIAGSTSSTPVMQSMVTLGPDLTFARLRRALEIVGGPSKK 479

Query: 486 HKKKELK 492
             K   K
Sbjct: 480 ELKAWEK 486


>gi|296113991|ref|YP_003627929.1| glutamyl-tRNA synthetase [Moraxella catarrhalis RH4]
 gi|295921685|gb|ADG62036.1| glutamyl-tRNA synthetase [Moraxella catarrhalis RH4]
 gi|326559296|gb|EGE09723.1| glutamyl-tRNA synthetase [Moraxella catarrhalis 7169]
 gi|326564328|gb|EGE14558.1| glutamyl-tRNA synthetase [Moraxella catarrhalis 103P14B1]
 gi|326565093|gb|EGE15286.1| glutamyl-tRNA synthetase [Moraxella catarrhalis 46P47B1]
 gi|326568234|gb|EGE18316.1| glutamyl-tRNA synthetase [Moraxella catarrhalis BC8]
 gi|326569934|gb|EGE19981.1| glutamyl-tRNA synthetase [Moraxella catarrhalis BC1]
 gi|326572871|gb|EGE22856.1| glutamyl-tRNA synthetase [Moraxella catarrhalis CO72]
 gi|326574696|gb|EGE24632.1| glutamyl-tRNA synthetase [Moraxella catarrhalis 101P30B1]
          Length = 498

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 229/476 (48%), Positives = 311/476 (65%), Gaps = 2/476 (0%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +  VR RIAPSPTG PH+GTAY ALFN + AK  GG+FILRIEDTD  RST +SE  ++
Sbjct: 1   MTRPVRTRIAPSPTGFPHVGTAYIALFNLVFAKSMGGEFILRIEDTDQVRSTKQSEQMIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+W EGPD+GG + PYRQSER +IY+ Y + LL+   AFRCFC+ E L+ MR 
Sbjct: 61  DALKWAGLSWAEGPDVGGPHAPYRQSERADIYKKYAEQLLDDGHAFRCFCTPEELDAMRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ    +P +YDG    LS +E + L  + K  V+R+ VP+ G C  +D + GE+ IPW 
Sbjct: 121 AQMAAGLPVKYDGRYANLSREESDALVAQGKPFVIRMRVPSNGVCTIKDMLRGEVVIPWE 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            VDMQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLY+YF + +PE  
Sbjct: 181 QVDMQVLLKTDGLPTYHLANVVDDHLMQITHVLRGEEWLPSAPKHQLLYEYFGWQMPELC 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+PL++NPDKSKLSKR+NPTSI+YY   G LPEAL+N+L  +      + ++   + ++I
Sbjct: 241 HMPLLRNPDKSKLSKRKNPTSITYYRDAGILPEALMNYLGRMGYSLPNEQEK-FTLDEMI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQS 362
             FD+  +S  G VFD +KL WLNG ++R  LS  +  +++  W  +  +LT      Q 
Sbjct: 300 QSFDIQRISLGGPVFDIEKLYWLNGEYLRT-LSVDDLKNKILAWASDDTKLTAIARAIQP 358

Query: 363 RITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIE 422
           RI  LS       F F++   +TAE F   +L  E+I++IL     + E + IW  ENI 
Sbjct: 359 RINLLSDAINWAGFYFQNLPAITAEDFAYKSLDNEQILEILYLATWQLENLPIWSEENIY 418

Query: 423 TALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
             L+ +A H +  LK  ++P F+AI GS  S P+ +S+ I+G  +   RLRHA  +
Sbjct: 419 QTLKGLAAHFDIKLKDFMQPFFVAIAGSTSSTPVMNSMHIIGADMTLARLRHACEI 474


>gi|255320237|ref|ZP_05361422.1| glutamyl-tRNA synthetase [Acinetobacter radioresistens SK82]
 gi|255302676|gb|EET81908.1| glutamyl-tRNA synthetase [Acinetobacter radioresistens SK82]
          Length = 503

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 227/487 (46%), Positives = 309/487 (63%), Gaps = 2/487 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
            VR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   NVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           KW GLNW EGPDIGG + PYRQSER +IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  KWLGLNWSEGPDIGGPHAPYRQSERMHIYKQYALELVEKGHAFYCFATPEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    RYDG  L+LS +E+E      + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGESPRYDGRGLQLSHEEVECRLAAGEPHVIRMKVPAEGVCKFNDMLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQ+LLK+DG+PTYHLANV+DDHLM+ITHV RGEEWI S PKH LLY YF + +P   H+P
Sbjct: 182 MQILLKTDGLPTYHLANVVDDHLMQITHVIRGEEWIPSAPKHQLLYSYFGWDMPTICHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ ++   + ++I HF
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDESEK-FTLAEMIEHF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+  LS  E L+ +  W  ++++L +     Q RI 
Sbjct: 301 DIKRVSLGGPIFDVEKLNWLNGQWIKA-LSPAELLNTLLNWKADRNKLEEIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F    +++ E F+S  L  E++   L+      E +  W  + +   L
Sbjct: 360 LLSDAVNWAGFYFNQFPNISKEQFESKKLTEEQVRQSLQFAIWRLESLFTWNNDTVSQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            +++      L+  +   F+AI GS  S P+  S+  LG  + + RLR A+ +V    + 
Sbjct: 420 MDLSNQMGIKLRDFMPAFFIAIAGSTSSTPVMQSMVTLGPDLTFARLRRALEIVGGPSKK 479

Query: 486 HKKKELK 492
             K   K
Sbjct: 480 ELKAWEK 486


>gi|329766872|ref|ZP_08258400.1| glutamyl-tRNA synthetase [Gemella haemolysans M341]
 gi|328837597|gb|EGF87222.1| glutamyl-tRNA synthetase [Gemella haemolysans M341]
          Length = 487

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 168/490 (34%), Positives = 265/490 (54%), Gaps = 16/490 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL AK  GG F+LRIEDTD KR+  E E + ++
Sbjct: 1   MTKVRVRYAPSPTGNLHIGNARTALFNYLFAKHYGGDFVLRIEDTDFKRNKEEGERSQLK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            + W GL++DEG      +GPYRQSER +IYQ Y   L+ +  A++C+ + E LE  R  
Sbjct: 61  YMDWLGLDYDEGIGKEKEFGPYRQSERIDIYQKYADQLIAEDKAYKCYMTAEELEAEREE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q    +P RY G    L+ +E E   +E +K  +R+ VP   +  F D V GE+    + 
Sbjct: 121 QIANGLPPRYSGKHAHLTKEEQEAFEKEGRKPSIRIRVPQDRTYKFDDMVKGELSFEGHD 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
               V++K+DG+ TY+ A  IDDHLM+I+HV RG++ +S+ PK +++Y+   F  P F H
Sbjct: 181 FGDFVIVKNDGVATYNFAVAIDDHLMQISHVLRGDDHVSNTPKQLVVYEALGFEPPRFGH 240

Query: 244 LPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           + LI N +K KLSKR       I  Y  +GYLPEAL NF+ LL      + + +   ++ 
Sbjct: 241 MTLIVNENKKKLSKRDETIIQFIEQYDELGYLPEALFNFITLLGWSPEGEQE-IFTKEEF 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLST-----------TEFLSRVSQWMKEK 350
           +  FD   LSK+ A FD  KL W+N ++I+ +               E ++   +    K
Sbjct: 300 VKIFDEKRLSKSPAFFDNNKLTWINNQYIKAQPLERIVDLSLPFFVKEGVATAEEVEDNK 359

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
               + ++L Q +++  + + ++T   F  ++    E  +   L  E    + +    + 
Sbjct: 360 AWFEKLISLYQPQMSYGAEIVELTKQFFVEEVKFDEEELE--ILRQETTATVFEDFLTKV 417

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
           E ++ +  +NI+  ++ + +      K +  P+ +A TGS +   L  S+E+LG+  V  
Sbjct: 418 EEVEEFTADNIKALIKAIQKDTGVKGKNLFMPIRIASTGSMHGPELNTSLELLGKERVAS 477

Query: 471 RLRHAIALVS 480
           R++ A+  + 
Sbjct: 478 RVKAALETIK 487


>gi|218890665|ref|YP_002439529.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa LESB58]
 gi|218770888|emb|CAW26653.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa LESB58]
          Length = 494

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 224/491 (45%), Positives = 320/491 (65%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER +IY+ Y   L+EK  AF CFC+ ERL+ +R
Sbjct: 59  YDALRWLGIEWDEGPDVGGPHGPYRQSERGHIYKKYSDELVEKGHAFTCFCTPERLDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDGHC+ L   E++R     + HV R+ VP +G CV  D + G++EIPW
Sbjct: 119 AEQMARKETPRYDGHCMHLPKDEVQRRLAAGESHVTRMKVPTKGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTSI++Y  MGYLP+AL+N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSITFYERMGYLPQALLNYLGRMGWSMPDEREK-FTLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFDL  +S  G +FD +KL WLNG+WIRE  S  EF   V +W    + L +     Q
Sbjct: 298 IEHFDLSRVSLGGPIFDLEKLSWLNGQWIRE-QSVEEFAREVQKWALNPEYLMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+   S +  +  F F   + L A  F+   L P ++  +L+    + E ++ W++E I
Sbjct: 357 GRVENFSQIAPLAGFFFSGGVPLDASLFEHKKLDPTQVRQVLQLVLWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ VA+H +  L+ ++  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVAEHLQLKLRDVMPLMFPAITGHASSVSVLDAMEILGADLSRYRLRQALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 ASKKETKEWEK 487


>gi|290968518|ref|ZP_06560057.1| glutamate--tRNA ligase [Megasphaera genomosp. type_1 str. 28L]
 gi|290781514|gb|EFD94103.1| glutamate--tRNA ligase [Megasphaera genomosp. type_1 str. 28L]
          Length = 485

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 168/483 (34%), Positives = 255/483 (52%), Gaps = 13/483 (2%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + K RVR APSPTG  HIG A +ALFNYLIAK  GG FI+RIEDTD KRST ESE  + 
Sbjct: 1   MAKKFRVRFAPSPTGPFHIGGARSALFNYLIAKHEGGDFIVRIEDTDRKRSTRESEENIK 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++L+W G++WDEG D GG++GPYRQ+ER +IY+ Y + LL +  A+ CFC+ E LE  +R
Sbjct: 61  EALRWLGISWDEGIDAGGSHGPYRQTERLDIYKQYTERLLAEGKAYYCFCTPEELEAQKR 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  +     Y G C  L  + ++      + +V+R+  P   +  F D V G +    N
Sbjct: 121 AQMDQGETPVYTGTCRDLPPETVQAYLAAGRPYVIRIKTPRNETLAFDDLVRGHVSFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            V   V++KSDG+P Y+   V+DD LM ITHV R EE +S+ P+ ++LY+   F  P F 
Sbjct: 181 KVGDFVIVKSDGIPVYNYCVVLDDALMDITHVIRAEEHLSNTPRQLVLYKALGFQAPTFA 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H+ LI   DK K+SKR   TS+  Y  +GYLPEA+INFL+LL       + E+    +LI
Sbjct: 241 HVSLILGKDKKKMSKRHGATSVQQYRDLGYLPEAIINFLSLLG-WTPGTEQEIFSRDELI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK-----------EKD 351
             F L  ++K  AVFD +KL+W+N  ++++          +                 ++
Sbjct: 300 RQFTLARVAKNPAVFDIEKLNWINFHYMKQLTEDELLALCLPHLQNAGYVSGTLTPERRE 359

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
            + Q +   +  +   + +  ++   F  +     E   +  L  E    +L    +E +
Sbjct: 360 WVKQVVAALRDHVQYGAQIAAVSKVFFTEEYAPENEE-AAAVLQEETAQPVLTCFAQELQ 418

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
            +       ++   + V +      K +  P+ +A+TG  +   L   + ++GR  V  R
Sbjct: 419 ALPEVTAATVQPLFKKVQKQVGVKGKFVYMPIRVALTGVMHGPDLHVIVALMGREKVLAR 478

Query: 472 LRH 474
           L  
Sbjct: 479 LAR 481


>gi|289433591|ref|YP_003463463.1| glutamyl-tRNA synthetase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289169835|emb|CBH26373.1| glutamyl-tRNA synthetase [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 491

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 169/487 (34%), Positives = 273/487 (56%), Gaps = 16/487 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNVEDGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M++LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL++ LA++C+C+ E LE  
Sbjct: 61  QMKNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQKLLDEGLAYKCYCTEEELEAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKEDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK +L+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQLLIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK-------- 350
           ++ I  FD   LSK+ A+FD  KL W+N +++++ L   + +      +++         
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKK-LPLNDVVELSLPHLQKAGVVSAKLD 358

Query: 351 ----DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
               D + + ++L   +++  + +  +++  F     +T +  +   L  E +  ++   
Sbjct: 359 QAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADADSITFDEEEKAVLAEETVPTVISAF 418

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
           ++E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LG+ 
Sbjct: 419 KKELEALEVLEATEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGKE 478

Query: 467 VVYFRLR 473
            V  RL 
Sbjct: 479 KVINRLD 485


>gi|299821028|ref|ZP_07052916.1| glutamate--tRNA ligase [Listeria grayi DSM 20601]
 gi|299816693|gb|EFI83929.1| glutamate--tRNA ligase [Listeria grayi DSM 20601]
          Length = 489

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 175/493 (35%), Positives = 274/493 (55%), Gaps = 19/493 (3%)

Query: 1   MIS-SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESEN 59
           M+  S KVRVR APSPTG  HIG A TALFNYL AK  GG FI+RIEDTD+KR+    E 
Sbjct: 1   MMEGSKKVRVRYAPSPTGFLHIGNARTALFNYLFAKHHGGDFIVRIEDTDAKRNVEGGEE 60

Query: 60  AVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEE 119
           + M +LKW G+ WDEG D+ G YGPYRQSER +IY P ++ LLEK LA++C+C+ E L+ 
Sbjct: 61  SQMNNLKWLGVEWDEGVDVPGKYGPYRQSERADIYNPLIEELLEKGLAYKCYCTEEELDA 120

Query: 120 MRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEI 179
            R AQ+ R    RY G C  L+ ++      +  +  +R  VP   +  F D V  E+  
Sbjct: 121 EREAQKARGEMPRYSGKCRHLTKEQQAEKEAQGIRPSIRFKVPADETITFNDIVKDEVSF 180

Query: 180 PWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIP 239
             N +   V++K DG+PTY+ A  +DDH+M+I+HV RG++ IS+ PK +++Y+ F +  P
Sbjct: 181 DSNGIGDFVIVKKDGIPTYNFAVAVDDHMMEISHVLRGDDHISNTPKQLMIYKAFGWEPP 240

Query: 240 EFIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMD 297
            F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+  
Sbjct: 241 VFGHMTLIVNESRKKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFS 299

Query: 298 MQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK--------- 348
            +  I  FD + LSK+ A+FDK KL W+N ++++  L   + +      ++         
Sbjct: 300 KEAFIKIFDENRLSKSPALFDKAKLTWVNNQYVKA-LPLEKVVELSLPHLQEAGVVSKEL 358

Query: 349 ---EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKT 405
              E + + + ++L   +++  + +  +++  F  ++   AE  +   L  E +  ++  
Sbjct: 359 TAEEAEWVNKLVSLYHEQMSYGAEIVPLSEMFFTDEVTFDAE--EQEVLEAETVPVVIDA 416

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
             +E   ++ ++   I+ A++ V +      K +  P+ +  TG  +   L  +IE+LG+
Sbjct: 417 FAKEVAELENFEAAEIKAAIKRVQKATSVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGK 476

Query: 466 SVVYFRLRHAIAL 478
             V  RL   +  
Sbjct: 477 EKVLKRLHSWLNK 489


>gi|241206403|ref|YP_002977499.1| glutamyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860293|gb|ACS57960.1| glutamyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 488

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 291/484 (60%), Positives = 362/484 (74%), Gaps = 1/484 (0%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
           +++ VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RST E E  V+
Sbjct: 6   TATGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTPEFETKVL 65

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKWCGL W EGPDIGG YGPYRQS+RK +YQPY Q LL+K  AFRCFC+  RLE+MR 
Sbjct: 66  DALKWCGLEWKEGPDIGGPYGPYRQSDRKEMYQPYGQELLDKGHAFRCFCTPARLEQMRE 125

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            QR    P +YDG CL L+++E+       +  V+R+ +P +GSC F D VYG++ IPW+
Sbjct: 126 TQRAAGKPPKYDGLCLNLTAEEVTSRIAAGETTVIRMKIPAEGSCDFTDGVYGDVSIPWD 185

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +VDMQVL+K+DGMPTYH+ANVIDDHLMKITHVARGEEW++SVPKHILLY+YF++  P F+
Sbjct: 186 SVDMQVLVKADGMPTYHMANVIDDHLMKITHVARGEEWLASVPKHILLYRYFDWDQPVFM 245

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           HL L++N DKSKLSKR+NPTSISYYSA+GY+PEAL+NFL L F+ +  + +EL+ M +L 
Sbjct: 246 HLSLMRNADKSKLSKRKNPTSISYYSALGYIPEALMNFLGLFFI-QIAEGEELLGMDELS 304

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQS 362
             FD  +LSKAGA+FD QKLDWLNGRWIREKLS  EF +RV  W  E DRL + L L+Q+
Sbjct: 305 EKFDPANLSKAGAIFDIQKLDWLNGRWIREKLSEEEFQARVLTWAMENDRLKEGLRLSQT 364

Query: 363 RITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIE 422
           RI+ L  LP +  FL KSDL L    F      PEEI++IL T Q + E I  W  E IE
Sbjct: 365 RISKLGELPDLAGFLLKSDLGLQPSDFAKIKSPPEEILEILNTVQPDLEKILEWNVETIE 424

Query: 423 TALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSL 482
             LR +A    K LK++V PLF+A++GS  SLPLFDS+ ILGRSVV  RL+ A   V++L
Sbjct: 425 AELRAIADRMGKKLKVVVSPLFVAVSGSSRSLPLFDSMAILGRSVVRQRLKLASQAVAAL 484

Query: 483 VQNH 486
           V + 
Sbjct: 485 VGSK 488


>gi|15598330|ref|NP_251824.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa PAO1]
 gi|107102683|ref|ZP_01366601.1| hypothetical protein PaerPA_01003748 [Pseudomonas aeruginosa PACS2]
 gi|254241828|ref|ZP_04935150.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa 2192]
 gi|12230942|sp|Q9XCL6|SYE_PSEAE RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|9949247|gb|AAG06522.1|AE004737_8 glutamyl-tRNA synthetase [Pseudomonas aeruginosa PAO1]
 gi|126195206|gb|EAZ59269.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa 2192]
          Length = 494

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 224/491 (45%), Positives = 320/491 (65%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER +IY+ Y   L+EK  AF CFC+ ERL+ +R
Sbjct: 59  YDALRWLGIEWDEGPDVGGPHGPYRQSERGHIYKKYSDELVEKGHAFTCFCTPERLDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDGHC+ L   E++R     + HV R+ VP +G CV  D + G++EIPW
Sbjct: 119 AEQMARKETPRYDGHCMHLPKDEVQRRLAAGESHVTRMKVPTEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTSI++Y  MGYLP+AL+N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSITFYERMGYLPQALLNYLGRMGWSMPDEREK-FTLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFDL  +S  G +FD +KL WLNG+WIRE  S  EF   V +W    + L +     Q
Sbjct: 298 IEHFDLSRVSLGGPIFDLEKLSWLNGQWIRE-QSVEEFAREVQKWALNPEYLMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+   S +  +  F F   + L A  F+   L P ++  +L+    + E ++ W++E I
Sbjct: 357 GRVENFSQIAPLAGFFFSGGVPLDASLFEHKKLDPTQVRQVLQLVLWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ VA+H +  L+ ++  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVAEHLQLKLRDVMPLMFPAITGHASSVSVLDAMEILGADLSRYRLRQALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 ASKKETKEWEK 487


>gi|27262332|gb|AAN87447.1| Glutamyl-tRNA synthetase [Heliobacillus mobilis]
          Length = 489

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 174/488 (35%), Positives = 276/488 (56%), Gaps = 15/488 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
              VRVR APSPTG  HIG A +ALFN+L+A+R GG+FI+RIEDTD +RS+LESE  ++ 
Sbjct: 1   MQNVRVRFAPSPTGPLHIGGARSALFNFLLARRFGGQFIVRIEDTDLERSSLESEKNILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           SL+W G+ WDEG  +GG + PYRQ+ER +IY    + LL    A+RC+CS E LE  R+A
Sbjct: 61  SLEWLGITWDEGIRVGGPHAPYRQTERLSIYTEAAEKLLASGQAYRCYCSEEELEAQRQA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
              +    RY G+C  LS ++  R   E +K V+R  VP++G+    D V G++      
Sbjct: 121 FIDKGEMPRYAGNCRCLSPEDEARYQAEGRKPVIRFRVPDEGAVTVDDLVRGQVSFDCAG 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +   +++KSDG+PTY+ A V+DD  M ITHV RGEE +S+ P+ +L+Y       P+F H
Sbjct: 181 IGDFIIVKSDGIPTYNFAVVLDDASMDITHVIRGEEHLSNTPRQLLIYDALGLSRPKFAH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + LI   D++K+SKR   TS+  Y + GYLPEAL+NFL LL      + +E+  + +LI 
Sbjct: 241 VSLILGKDRTKMSKRHGSTSVVAYQSQGYLPEALVNFLVLLGWSPEGE-EEIFTLDELIS 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKD 351
            F L  ++K  AVFD  KL+++NG +IR+       +                    +K 
Sbjct: 300 RFSLDRVAKNPAVFDSDKLNYINGVYIRK-AEIDRLIELALPHLREAGYLAEALDDGQKQ 358

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
           ++   +   Q +I+ ++ +       F  ++   ++  K+  L  E++  +L    ++  
Sbjct: 359 KVRWMMQAVQEKISYMAQVADFAPLFFGDEVTFESDEAKA-VLAEEQVPLVLNAFLQKIT 417

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
             +  + ++++  L+ V +  ++  K +  P+ +A+TG ++   L   I  LGR  V  R
Sbjct: 418 DGRAIEPDSVKALLKEVTKETKQGGKKVFMPIRIALTGQQHGPDLNYIIAALGRESVVAR 477

Query: 472 LRHAIALV 479
           +RH+ A +
Sbjct: 478 VRHSAAQL 485


>gi|302872187|ref|YP_003840823.1| glutamyl-tRNA synthetase [Caldicellulosiruptor obsidiansis OB47]
 gi|302575046|gb|ADL42837.1| glutamyl-tRNA synthetase [Caldicellulosiruptor obsidiansis OB47]
          Length = 480

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 181/483 (37%), Positives = 284/483 (58%), Gaps = 13/483 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG+ HIG A TALFNYL AK+  GKFILRIEDTD +RS  E    +M+SL+
Sbjct: 2   VRVRFAPSPTGQLHIGGARTALFNYLFAKKHNGKFILRIEDTDLERSREEWAEGIMRSLR 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEGPDIGG +GPY QS+RK IY  Y+Q LLE+  A+ CFC+ E +E  R   R+
Sbjct: 62  WLGIEWDEGPDIGGEFGPYFQSQRKEIYLEYIQKLLEEGKAYYCFCTQEEIEREREIARQ 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + IP +Y   C  +S +E ++  +  +K VVR+  P +G+ V  D + G++E   + +D 
Sbjct: 122 QKIPYKYSKKCRNISLEEAKKRIENGEKAVVRIKAPVEGTTVVHDIIRGDVEFSNDQLDD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++LKSDG PTY+   VIDD+LMKI+HV R EE +S+ PK +++Y+  N   P+F H+P+
Sbjct: 182 FIILKSDGNPTYNFVCVIDDYLMKISHVIRAEEHLSNTPKQLIIYEALNIQPPQFAHVPM 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD+SKLSKR   TS+  +   GYL EA++N+L LL      +D  ++ + + I  F+
Sbjct: 242 ILAPDRSKLSKRHGATSVEEFFENGYLKEAIVNYLLLLGWSPG-EDKTIISLDEAIQKFE 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM---------KEKDRLTQAL 357
           L  +SK  A++D  KL W+NG +++E +   +   R+  +           +K+ +   L
Sbjct: 301 LEKISKNAAIYDINKLTWINGYYLKE-IDIDDLYERMKYFYSKVGIEITSFDKEYVKSVL 359

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            L + ++ TL  +   + + F S+     +  +     P+ + + L+   ++ + I+ + 
Sbjct: 360 KLVREKVKTLVEVVSASIYFFDSNYEYEQKGVEK-YFTPDNLKN-LQLLLDDLKNIKPFS 417

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E IE  +R  A+        I+  + + I+G   +  LF+ +E+LG+  V  R+   + 
Sbjct: 418 AEEIEKLVRRKAEELNTKAANIIHTIRMCISGRTVTPGLFEMMEVLGKDEVINRIEKTLK 477

Query: 478 LVS 480
           + S
Sbjct: 478 IFS 480


>gi|327189569|gb|EGE56722.1| glutamyl-tRNA synthetase protein [Rhizobium etli CNPAF512]
          Length = 484

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 289/472 (61%), Positives = 356/472 (75%), Gaps = 1/472 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RST E E  V
Sbjct: 1   MTTSGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTPEFETKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +LKWCGL W EGPDIGG YGPYRQS+RK IYQPY Q LL+K  AFRCFC+  RLE+MR
Sbjct: 61  LDALKWCGLEWKEGPDIGGPYGPYRQSDRKPIYQPYAQELLDKAHAFRCFCTPARLEQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P +YDG CL L+++E+   +   +  V+R+ +P +GSC F D VYG++ IPW
Sbjct: 121 EAQRAAGKPPKYDGLCLSLTAEEVTSRTAAGEASVIRMKIPAEGSCDFTDGVYGDVSIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           ++VDMQVL+K+DGMPTYH+ANVIDDHLMKITHVARGEEW++SVPKHILLY+YF +  P F
Sbjct: 181 DSVDMQVLIKADGMPTYHMANVIDDHLMKITHVARGEEWLASVPKHILLYRYFGWDQPVF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYYSA+GY+PEAL+NFL L F+ +  + +EL+ M +L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYSALGYIPEALMNFLGLFFI-QIAEGEELLTMDEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
              FD  +LSKAGA+FD QKLDWLNGRWIREKLS  EF +RV  W  E DRL   L L+Q
Sbjct: 300 SEKFDPDNLSKAGAIFDIQKLDWLNGRWIREKLSEEEFQARVLAWAMENDRLKAGLRLSQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           +RI+ L  LP +  FL KSDL L    F      PEEI++IL T Q + E I  W  E I
Sbjct: 360 TRISKLGELPDLAGFLLKSDLGLQPSDFAKIKSPPEEILEILNTVQPDLEKILEWNVETI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
           E  LR ++    K LK++V PLF+A++GS  SLPLFDS+ ILGRSVV  RL+
Sbjct: 420 EAELRAISDRMGKKLKVVVSPLFVAVSGSSRSLPLFDSMAILGRSVVRQRLK 471


>gi|152985301|ref|YP_001347374.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa PA7]
 gi|166226845|sp|A6V2T9|SYE_PSEA7 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|150960459|gb|ABR82484.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa PA7]
          Length = 494

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 223/491 (45%), Positives = 319/491 (64%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER +IY+ Y   L+E+  AF CFC+ ERL+ +R
Sbjct: 59  FDALRWLGIEWDEGPDVGGPHGPYRQSERGHIYKKYSDELVEQGHAFTCFCTPERLDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDGHC+ L   E++R     + HV R+ VP +G CV  D + G +EIPW
Sbjct: 119 AEQMARKETPRYDGHCMHLPKDEVQRRVAAGESHVTRMKVPTEGVCVVPDMLRGNVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTSI++Y  MGYLP+AL+N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSITFYERMGYLPQALLNYLGRMGWSMPDEREK-FTLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFDL  +S  G +FD +KL WLNG+WIRE  S  EF   V +W    + L +     Q
Sbjct: 298 IEHFDLSRVSLGGPIFDLEKLSWLNGQWIRE-QSVEEFAREVQKWALNPEYLMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+   S +  +  F F   + L A  F+   L P ++  +L+    + E ++ W++E I
Sbjct: 357 GRVENFSQIAPLAGFFFSGGVPLDASLFEHKKLDPTQVRQVLQLVLWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ VA+H +  L+ ++  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVAEHLQLKLRDVMPLMFPAITGHASSVSVLDAMEILGADLSRYRLRQALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 ASKKETKEWEK 487


>gi|326391120|ref|ZP_08212666.1| glutamyl-tRNA synthetase [Thermoanaerobacter ethanolicus JW 200]
 gi|325992819|gb|EGD51265.1| glutamyl-tRNA synthetase [Thermoanaerobacter ethanolicus JW 200]
          Length = 485

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 181/489 (37%), Positives = 271/489 (55%), Gaps = 16/489 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S +RVR APSPTG  HIG   TALFNYL ++  G  F+LRIEDTD +RS+ E E  + +
Sbjct: 1   MSNLRVRFAPSPTGAIHIGNIRTALFNYLFSRSEGATFVLRIEDTDLERSSKEFEELIFK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            L+W G+ WDEGPD  G YGPYRQSER  IY  + Q L+E+K A+RC+C+ E LEE RR 
Sbjct: 61  ELEWLGIEWDEGPDKPGPYGPYRQSERLEIYHKFAQKLIEEKKAYRCYCTPEELEEDRRN 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             +R    RY G C  L+ ++ E   +E +K V+R  +P+     F+D + G++ I  + 
Sbjct: 121 AVERGDIPRYSGRCRYLTKEQEEAFIREGRKPVIRFIIPDDEVIEFEDMIKGKITIKSDT 180

Query: 184 VDMQV-LLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +   + ++KSDGMPTY+ A VIDD LMKITHV RGE+ I + PK IL+Y+   F IP+F 
Sbjct: 181 LGGDMVIVKSDGMPTYNFAVVIDDALMKITHVIRGEDHIYNTPKQILIYKALGFEIPKFA 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H PLI  PD++KLSKR   T I  Y  +GYLPEA+ NFL+LL     ++ + +M  +++I
Sbjct: 241 HAPLILGPDRTKLSKRHGNTYIGQYRELGYLPEAMFNFLSLLSWSPEDNVE-IMSKEEII 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-----------MKEKD 351
             F+   +  A  VFD +KL+W+N ++I++  S    +                     +
Sbjct: 300 KKFNFRRIHSANPVFDIEKLNWMNQQYIQK-SSIERIVDLAIPHLKAAGYIDEIDDVMYN 358

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
            L   + L +  +  ++ + +     F  ++  T E+ K   L       +L+  ++  E
Sbjct: 359 WLKDVIFLYKDGLQYVAQITEKAKMFFVEEVEYTDETMK--ILNSPNSKTVLEAVKKAIE 416

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
                  E ++  L+ + +      K    P+ +A+TG  +   L   I +LG+  V  R
Sbjct: 417 EADEITEEYVKDLLKKLQKETNVKGKEFFMPIRVAVTGEDHGPELVKIIPLLGKDKVINR 476

Query: 472 LRHAIALVS 480
           L+ AI L+ 
Sbjct: 477 LKKAINLIK 485


>gi|313108457|ref|ZP_07794461.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa 39016]
 gi|310880963|gb|EFQ39557.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa 39016]
          Length = 494

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 224/491 (45%), Positives = 320/491 (65%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER +IY+ Y   L+EK  AF CFC+ ERL+ +R
Sbjct: 59  YDALRWLGIEWDEGPDVGGPHGPYRQSERGHIYKKYSDELVEKGHAFTCFCTPERLDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDGHC+ L   E++R     + HV R+ VP +G CV  D + G++EIPW
Sbjct: 119 AEQMARKETPRYDGHCMHLPKDEVQRRVAAGESHVTRMKVPTEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTSI++Y  MGYLP+AL+N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSITFYERMGYLPQALLNYLGRMGWSMPDEREK-FTLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFDL  +S  G +FD +KL WLNG+WIRE  S  EF   V +W    + L +     Q
Sbjct: 298 IEHFDLSRVSLGGPIFDLEKLSWLNGQWIRE-QSVEEFAREVQKWALNPEYLMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+   S +  +  F F   + L A  F+   L P ++  +L+    + E ++ W++E I
Sbjct: 357 GRVENFSQIAPLAGFFFSGGVPLDASLFEHKKLDPTQVRQVLQLVLWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ VA+H +  L+ ++  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVAEHLQLKLRDVMPLMFPAITGHASSVSVLDAMEILGADLSRYRLRQALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 ASKKETKEWEK 487


>gi|291279461|ref|YP_003496296.1| glutamyl-tRNA synthetase [Deferribacter desulfuricans SSM1]
 gi|290754163|dbj|BAI80540.1| glutamyl-tRNA synthetase [Deferribacter desulfuricans SSM1]
          Length = 483

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 183/486 (37%), Positives = 268/486 (55%), Gaps = 17/486 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  H+G   TALFNYL AK   GKFILRIEDTD +RST ESEN + + L+
Sbjct: 3   VRVRFAPSPTGHIHVGNVRTALFNYLFAKHNNGKFILRIEDTDLERSTKESENLIYEDLQ 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEGP  GG YGPYRQ+ER +IY+ YV  LLE+  A++CFCS E LEE +    K
Sbjct: 63  WLGLDWDEGPIKGGDYGPYRQTERFDIYKKYVDKLLEEGKAYKCFCSKEELEEKKERALK 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
              P RY+G C  L+  +IE L ++  K  +R  V ++      D + GE+    +A   
Sbjct: 123 EGKPPRYNGKCRNLNENQIEELEKKGVKPSIRFKVEDEDVV-VNDLIKGEITFNTDAFGD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++++ DG P Y+   VIDD LMKITHV RG++ +S+ PK +L+Y+   F IP F H+P+
Sbjct: 182 FIIVRPDGTPVYNFVVVIDDALMKITHVIRGDDHLSNTPKQVLIYKALGFDIPYFAHIPM 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD SKLSKR   TS++ +   GYLPEAL N+LALL     E+ + ++   +LI  F 
Sbjct: 242 ILGPDHSKLSKRHGDTSVNQFREKGYLPEALFNYLALLSWSHPEEKE-ILSKDELIKSFT 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKDRLT 354
           L  +SK+ AVFD +KL W+NG +IR      E       +                +RL 
Sbjct: 301 LDRVSKSAAVFDFEKLKWINGIYIRN-KDIKELTKLCIPFLLKSGLIDEDFINTSFNRLA 359

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
             +   +  +  LS + +     FK  +    +      L  E    +L+T ++  E ++
Sbjct: 360 NMVESIRDNLEVLSDVTKYIGVYFK--METDFDDATKEILSYETTKPVLETFKKNIENLE 417

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
           I   +N ++ ++ V +      K +   + + ++G      L   +  LG++ V  R+  
Sbjct: 418 ILDVDNYKSIIKAVQKETGAKGKKLFMAIRVGVSGKIKGPELDKLVINLGKNEVINRINK 477

Query: 475 AIALVS 480
            + ++S
Sbjct: 478 ILDMLS 483


>gi|148651948|ref|YP_001279041.1| glutamyl-tRNA synthetase [Psychrobacter sp. PRwf-1]
 gi|187645688|sp|A5WBQ0|SYE_PSYWF RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|148571032|gb|ABQ93091.1| glutamyl-tRNA synthetase [Psychrobacter sp. PRwf-1]
          Length = 505

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 226/477 (47%), Positives = 311/477 (65%), Gaps = 2/477 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
            +   VR RIAPSPTG PH+GTAY ALFN   AK  GG+FILRIEDTD  RST +SE  +
Sbjct: 5   TAQRPVRTRIAPSPTGFPHVGTAYIALFNLAFAKAHGGEFILRIEDTDQSRSTEQSEQMI 64

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +L+W GL+W EGPD GG + PYRQSER  IY+ Y Q LL+K  AFRCFC+ E L+ MR
Sbjct: 65  LDALRWVGLDWAEGPDNGGPHAPYRQSERSEIYKQYAQELLDKGHAFRCFCTPEELDAMR 124

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R     YDG    L  +E ++++ E K  V+R+ VP +G C  QD + GE+EIPW
Sbjct: 125 AEQIARGENPHYDGRYANLPREESDKMAAEGKPFVIRMKVPTEGVCKVQDMLRGEVEIPW 184

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             VDMQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW++S PKH LLY YF + +P  
Sbjct: 185 EQVDMQVLLKTDGLPTYHLANVVDDHLMEITHVIRGEEWLNSAPKHQLLYDYFGWEMPVL 244

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+PL++NPDKSKLSKR+NPTSI+YY   G LPEAL+N+L  +     +D + +  + ++
Sbjct: 245 CHMPLLRNPDKSKLSKRKNPTSITYYRDAGVLPEALLNYLGRMGYSMPDDKE-IFTLDEM 303

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I  FD+  +S  G +FD +KL WLNG W+R  L+  +  +++  W  + D+LT      Q
Sbjct: 304 IESFDITRVSLGGPIFDLEKLHWLNGEWLRA-LTPEQLKNKILDWANDSDKLTAIAAAIQ 362

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            RI  LS       F F++   +TAESF+   L PE+I++IL+    + E +  W  +NI
Sbjct: 363 PRIHLLSDAVNWGGFYFQNLPSITAESFEHKTLTPEQIMEILQIATWKLEALPEWSEDNI 422

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
              L+ ++   +  L+ ++ P F+AI GS  S P+ +S+ ++G  +   RLRHA+ +
Sbjct: 423 FKTLKGLSAALDIKLRDMMAPFFIAIAGSTSSTPVMNSMYVIGADMTLTRLRHAVEV 479


>gi|254236103|ref|ZP_04929426.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa C3719]
 gi|126168034|gb|EAZ53545.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa C3719]
          Length = 494

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 224/491 (45%), Positives = 319/491 (64%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER +IY+ Y   L+EK  AF CFC+ ERL+ +R
Sbjct: 59  YDALRWLGIEWDEGPDVGGPHGPYRQSERGHIYKKYSDELVEKGHAFTCFCTPERLDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDGHC+ L   E++R     + HV R+ VP +G CV  D + G +EIPW
Sbjct: 119 AEQMARKETPRYDGHCMHLPKDEVQRRLAAGESHVTRMKVPTEGVCVVPDMLRGAVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTSI++Y  MGYLP+AL+N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSITFYERMGYLPQALLNYLGRMGWSMPDEREK-FTLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFDL  +S  G +FD +KL WLNG+WIRE  S  EF   V +W    + L +     Q
Sbjct: 298 IEHFDLSRVSLGGPIFDLEKLSWLNGQWIRE-QSVEEFAREVQKWALNPEYLMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+   S +  +  F F   + L A  F+   L P ++  +L+    + E ++ W++E I
Sbjct: 357 GRVENFSQIAPLAGFFFSGGVPLDASLFEHKKLDPTQVRQVLQLVLWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ VA+H +  L+ ++  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVAEHLQLKLRDVMPLMFPAITGHASSVSVLDAMEILGADLSRYRLRQALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 ASKKETKEWEK 487


>gi|254831938|ref|ZP_05236593.1| glutamyl-tRNA synthetase [Listeria monocytogenes 10403S]
          Length = 491

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 170/486 (34%), Positives = 268/486 (55%), Gaps = 14/486 (2%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNIADGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M +LKW G++WDEG D+ G YGPYRQSER+ IY+P +Q LL++ LA++C+C+ E L+  
Sbjct: 61  QMTNLKWLGMDWDEGVDVPGKYGPYRQSERQAIYEPLIQQLLDEGLAYKCYCTEEELDAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK IL+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WM 347
           ++ I  FD   LSK+ A+FD  KL W+N +++++          +               
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVVELSLPHLQKAGVVSAELNQ 359

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
            E D + + ++L   +++  + +  +++  F     +T +  ++  L  E +  ++   +
Sbjct: 360 AELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEETAVLAEETVPTVISAFK 419

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           +E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LGR  
Sbjct: 420 KELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGREK 479

Query: 468 VYFRLR 473
           V  RL 
Sbjct: 480 VLNRLD 485


>gi|217965676|ref|YP_002351354.1| glutamyl-tRNA synthetase [Listeria monocytogenes HCC23]
 gi|290892622|ref|ZP_06555615.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL J2-071]
 gi|217334946|gb|ACK40740.1| glutamyl-tRNA synthetase [Listeria monocytogenes HCC23]
 gi|290557931|gb|EFD91452.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL J2-071]
 gi|307569776|emb|CAR82955.1| glutamyl-tRNA synthetase [Listeria monocytogenes L99]
          Length = 491

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 170/486 (34%), Positives = 269/486 (55%), Gaps = 14/486 (2%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNIADGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M +LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL++ LA++C+C+ E L+  
Sbjct: 61  QMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQQLLDEGLAYKCYCTEEELDAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK IL+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WM 347
           ++ I  FD   LSK+ A+FD  KL W+N +++++          +               
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVVELSLPHLQKAGVVSAELNQ 359

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
            E D + + ++L   +++  + +  +++  F     +T +  ++  L  E +  ++   +
Sbjct: 360 AELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEETAVLAEETVPTVISAFK 419

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           +E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LGR  
Sbjct: 420 KELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGREK 479

Query: 468 VYFRLR 473
           V  RL 
Sbjct: 480 VLNRLD 485


>gi|46906470|ref|YP_012859.1| glutamyl-tRNA synthetase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|226222866|ref|YP_002756973.1| glutamyl-tRNA synthetase [Listeria monocytogenes Clip81459]
 gi|254825719|ref|ZP_05230720.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL J1-194]
 gi|254853496|ref|ZP_05242844.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL R2-503]
 gi|254932455|ref|ZP_05265814.1| glutamyl-tRNA synthetase [Listeria monocytogenes HPB2262]
 gi|254991763|ref|ZP_05273953.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL J2-064]
 gi|300764638|ref|ZP_07074630.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL N1-017]
 gi|67461801|sp|Q724H5|SYE_LISMF RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|46879734|gb|AAT03036.1| glutamyl-tRNA synthetase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|225875328|emb|CAS04025.1| Putative glutamyl-tRNA synthetase [Listeria monocytogenes serotype
           4b str. CLIP 80459]
 gi|258606868|gb|EEW19476.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL R2-503]
 gi|293584012|gb|EFF96044.1| glutamyl-tRNA synthetase [Listeria monocytogenes HPB2262]
 gi|293594963|gb|EFG02724.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL J1-194]
 gi|300514745|gb|EFK41800.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL N1-017]
 gi|328467848|gb|EGF38888.1| glutamyl-tRNA synthetase [Listeria monocytogenes 1816]
 gi|328476080|gb|EGF46789.1| glutamyl-tRNA synthetase [Listeria monocytogenes 220]
 gi|332310648|gb|EGJ23743.1| Glutamyl-tRNA synthetase [Listeria monocytogenes str. Scott A]
          Length = 491

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 170/487 (34%), Positives = 273/487 (56%), Gaps = 16/487 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNIADGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M +LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL++ LA++C+C+ E L+  
Sbjct: 61  QMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQQLLDEGLAYKCYCTEEELDAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK IL+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK-------- 350
           ++ I  FD   LSK+ A+FD  KL W+N +++++ L   + +      +++         
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKK-LPLNDVVELSLPHLQKAGVVSAELD 358

Query: 351 ----DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
               D + + ++L   +++  + +  +++  F     +T +  ++  L  E +  ++   
Sbjct: 359 QAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEETAVLAEETVPTVISAF 418

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
           ++E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LGR 
Sbjct: 419 KKELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGRE 478

Query: 467 VVYFRLR 473
            V  RL 
Sbjct: 479 KVLNRLD 485


>gi|307266364|ref|ZP_07547902.1| glutamyl-tRNA synthetase [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918600|gb|EFN48836.1| glutamyl-tRNA synthetase [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 485

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 182/489 (37%), Positives = 271/489 (55%), Gaps = 16/489 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S +RVR APSPTG  HIG   TALFNYL ++  G  F+LRIEDTD +RS+ E E  + +
Sbjct: 1   MSNLRVRFAPSPTGAIHIGNIRTALFNYLFSRSEGATFVLRIEDTDLERSSKEFEELIFK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            L+W G+ WDEGPD  G YGPYRQSER  IY  + Q L+E+K A+RC+C+ E LEE RR 
Sbjct: 61  ELEWLGIEWDEGPDKPGPYGPYRQSERLEIYHKFAQKLIEEKKAYRCYCTPEELEEDRRN 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             +R    RY G C  L+ ++ E   +E +K V+R  +P+     F+D + G++ I  + 
Sbjct: 121 AVERGDIPRYSGRCRYLTKEQEEAFIREGRKPVIRFIIPDDEVIEFEDMIKGKITIKSDT 180

Query: 184 VDMQV-LLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +   + ++KSDGMPTY+ A VIDD LMKITHV RGE+ I + PK IL+Y+   F IP+F 
Sbjct: 181 LGGDMVIVKSDGMPTYNFAVVIDDALMKITHVIRGEDHIYNTPKQILIYKALGFEIPKFA 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H PLI  PD++KLSKR   T I  Y  +GYLPEA+ NFL+LL     ++ + +M  +++I
Sbjct: 241 HAPLILGPDRTKLSKRHGNTYIGQYRELGYLPEAMFNFLSLLSWSPEDNVE-IMSKEEII 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-----------MKEKD 351
             F+   +  A  VFD +KL+W+N ++I++  S    +                     +
Sbjct: 300 KKFNFRRIHSANPVFDIEKLNWMNQQYIQK-SSIERIVDLAIPHLKAAGYIDEIDDVMYN 358

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
            L   + L +  +  ++ + +     F  ++  T E+ K   L       +L+  ++  E
Sbjct: 359 WLKDVIFLYKDGLQYVAQITEKAKMFFVEEVEYTDETMK--ILNSPNSKTVLEAVKKAIE 416

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
                  E ++  L+ + +      K    P+ +AITG  +   L   I +LG+  V  R
Sbjct: 417 EADEITEEYVKDLLKKLQKETNVKGKEFFMPIRVAITGEDHGPELVKIIPLLGKDKVINR 476

Query: 472 LRHAIALVS 480
           L+ AI L+ 
Sbjct: 477 LKKAINLIK 485


>gi|297621898|ref|YP_003710035.1| glutamyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
 gi|297377199|gb|ADI39029.1| glutamyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
          Length = 507

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 220/487 (45%), Positives = 299/487 (61%), Gaps = 3/487 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVRIAPSPTG+PH+GTAY A+FN + A+   G FILRIEDTD  RS  E E  + ++L 
Sbjct: 3   VRVRIAPSPTGDPHVGTAYIAVFNSIFARHHNGTFILRIEDTDRTRSRPEYEQNIYEALS 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEGP+IGGAYGPYRQSER  IY+ Y   L+EK  A++CFC+ E L EMR+   K
Sbjct: 63  WSGIEWDEGPNIGGAYGPYRQSERLPIYKEYADKLVEKGHAYKCFCTAEELAEMRQVLAK 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           +     YD  C  LS +EI+      K  V+RL VP +G CVF D++ G +  PW  +D 
Sbjct: 123 KGGRQGYDRRCRNLSPEEIKEKEAAGKPSVIRLKVPLKGECVFTDRIKGRIAFPWADIDD 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVL+K+DG PTYHLANV+DD+LMKI+HV RG+EWISS PKHILLY+YF + +PEF+H+PL
Sbjct: 183 QVLMKTDGFPTYHLANVVDDYLMKISHVIRGDEWISSTPKHILLYKYFEWEVPEFLHMPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           +   D  KLSKR+NPTSI +Y   GYLPEA  NFL L+    + D + +   ++++  FD
Sbjct: 243 LLGVDGKKLSKRKNPTSIFFYRDSGYLPEAFKNFLTLMGYSMTGDRE-IYPFEEIVQEFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
              +  +GAVFD +KLDWLN ++I   +   +   R+ +W      + + + L  SRI T
Sbjct: 302 ASRIGVSGAVFDIKKLDWLNQQYIINCIPQEKLWDRLKEWRFNDAFMERLIPLCYSRIKT 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
                ++ DFLF ++L    + F    L   +   IL+      E    W  + I+ A +
Sbjct: 362 FGDFMELFDFLFINNLEYKEQDFTQKGLSKLQGAFILQGMIWVLESSSGWSAQEIQQASK 421

Query: 427 NVAQHREKSLKI-IVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
           +VA+    + K  ++  LF +I G     PLFDS EILG+ VV  R   +I  +  +  N
Sbjct: 422 DVAERFGINHKKGVMPILFTSIMGKIQGPPLFDSAEILGKDVVRARFLRSIEFLGGIS-N 480

Query: 486 HKKKELK 492
            K  ELK
Sbjct: 481 KKGAELK 487


>gi|255520319|ref|ZP_05387556.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL J1-175]
          Length = 491

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 170/487 (34%), Positives = 273/487 (56%), Gaps = 16/487 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNIADGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M +LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL++ LA++C+C+ E L+  
Sbjct: 61  QMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQQLLDEGLAYKCYCTEEELDAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK IL+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK-------- 350
           ++ I  FD   LSK+ A+FD  KL W+N +++++ L   + +      +++         
Sbjct: 300 EEFIKMFDPKXLSKSPALFDNVKLTWVNNQYVKK-LPLNDVVELSLPHLQKAGVVSAELD 358

Query: 351 ----DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
               D + + ++L   +++  + +  +++  F     +T +  ++  L  E +  ++   
Sbjct: 359 QAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEETAVLAEETVPTVISAF 418

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
           ++E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LGR 
Sbjct: 419 KKELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGRE 478

Query: 467 VVYFRLR 473
            V  RL 
Sbjct: 479 KVLNRLD 485


>gi|262377033|ref|ZP_06070259.1| glutamyl-tRNA synthetase [Acinetobacter lwoffii SH145]
 gi|262308071|gb|EEY89208.1| glutamyl-tRNA synthetase [Acinetobacter lwoffii SH145]
          Length = 502

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 227/482 (47%), Positives = 308/482 (63%), Gaps = 2/482 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL+
Sbjct: 3   VRTRIAPSPTGFPHVGTAYIALFNLCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GLNW EGPD+GG + PYRQSER +IY+ Y   L+EK  AF CF + E L++MR  Q+ 
Sbjct: 63  WLGLNWSEGPDVGGPHAPYRQSERMDIYKNYALELVEKGHAFYCFATAEELDQMRAEQQA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           R    RYDG  L LS +E+ER     + HV+R+ VP +G C F D + GE+EIPW  VDM
Sbjct: 123 RGESPRYDGRGLNLSQEEVERRLVAGEPHVIRMKVPTEGICKFNDMLRGEVEIPWAQVDM 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           Q+LLK+DG+PTYHLANV+DDHLM+ITHV RGEEWI S PKH LLYQYF + +P   H+PL
Sbjct: 183 QILLKTDGLPTYHLANVVDDHLMQITHVIRGEEWIPSAPKHQLLYQYFGWEMPVLCHMPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ ++   + ++I HFD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDESEK-FTLAEMIEHFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G +FD +KL+WLNG+WI+  LS  E L  +  W  ++ +L +     Q RI  
Sbjct: 302 IKRVSLGGPIFDVEKLNWLNGQWIKA-LSPAELLDTLLAWKADRAKLEEIAAAIQPRINL 360

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS     +   F     L+ E F+S  L  E++   L+      E +  W  + +   L 
Sbjct: 361 LSEAVNWSAHYFNHFPTLSKEQFESKKLSDEQVRQSLQFAIWRLESLFTWNNDTVSQTLM 420

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
           ++A   E  L+  +   F+AI GS  S P+  ++  +G  + + RLRHA+ +V    +  
Sbjct: 421 DLAAQMEIKLRDFMPAFFIAIAGSTASTPVMQTMVTIGPDLTFARLRHALEIVGGPSKKE 480

Query: 487 KK 488
            K
Sbjct: 481 LK 482


>gi|116051130|ref|YP_790039.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|122260265|sp|Q02PU7|SYE_PSEAB RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|4928924|gb|AAD33773.1|AF139107_3 glutamyl-tRNA synthetase [Pseudomonas aeruginosa]
 gi|115586351|gb|ABJ12366.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 494

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 224/491 (45%), Positives = 320/491 (65%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER +IY+ Y   L+EK  AF CFC+ ERL+ +R
Sbjct: 59  YDALRWLGIEWDEGPDVGGPHGPYRQSERGHIYKRYSDELVEKGHAFTCFCTPERLDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDGHC+ L   E++R     + HV R+ VP +G CV  D + G++EIPW
Sbjct: 119 AEQMARKETPRYDGHCMHLPKDEVQRRLAAGESHVTRMKVPTEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTSI++Y  MGYLP+AL+N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSITFYERMGYLPQALLNYLGRMGWSMPDEREK-FTLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFDL  +S  G +FD +KL WLNG+WIRE  S  EF   V +W    + L +     Q
Sbjct: 298 IEHFDLSRVSLGGPIFDLEKLSWLNGQWIRE-QSVEEFAREVQKWALNPEYLMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+   S +  +  F F   + L A  F+   L P ++  +L+    + E ++ W++E I
Sbjct: 357 GRVENFSQIAPLAGFFFSGGVPLDASLFEHKKLDPTQVRQVLQLVLWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ VA+H +  L+ ++  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVAEHLQLKLRDVMPLMFPAITGHASSVSVLDAMEILGADLSRYRLRQALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 ASKKETKEWEK 487


>gi|50086349|ref|YP_047859.1| glutamyl-tRNA synthetase [Acinetobacter sp. ADP1]
 gi|67461752|sp|Q6F7C8|SYE_ACIAD RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|49532325|emb|CAG70037.1| glutamyl-tRNA synthetase [Acinetobacter sp. ADP1]
          Length = 502

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 230/483 (47%), Positives = 308/483 (63%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNLCFAKQHGGEFILRIEDTDQLRSTPESEQMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y  +L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALDLIEKGHAFYCFATAEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKLS +E+ER     + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLSQEEVERRLAAGEPHVIRMKVPEEGICKFNDLLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPKHQLLYQYFGWDMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +  +I HF
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDERE-VFTLTDMIEHF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD  KL+WLNG+WI+      + L R+  W  ++  L    T  Q RI 
Sbjct: 301 DIQRVSLGGPIFDVDKLNWLNGQWIKSLTPG-QLLDRLLSWKSDRQTLEDIATAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F    ++TAE F+S  L PE++   L+      E    W  E +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPNITAEMFESKKLSPEQVRQSLQFAIWRLESQFTWNNETVSQIL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A   +  L+  +   F+AI GS  S P+  S+  +G  + + RLR A+ +V +  + 
Sbjct: 420 MDLANQMDIKLRDFMPAFFIAIAGSTSSTPVMQSMVTIGPDLTFARLRRALEIVGAPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 ELK 482


>gi|312135924|ref|YP_004003262.1| glutamyl-tRNA synthetase [Caldicellulosiruptor owensensis OL]
 gi|311775975|gb|ADQ05462.1| glutamyl-tRNA synthetase [Caldicellulosiruptor owensensis OL]
          Length = 485

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 184/480 (38%), Positives = 268/480 (55%), Gaps = 15/480 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           +VR R APSPTG  HIG A TALFNYL AKR GGKFILRIEDTD +RS++ESE  +++SL
Sbjct: 2   EVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIESL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           KW G+ WDEG ++GG +GPYR +ER +IY+ YV  L EK  A+ C+C+ E LE  R+   
Sbjct: 62  KWLGIEWDEGIEVGGPHGPYRSTERVDIYKKYVDVLFEKGYAYHCYCTEEELEAQRQQLL 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RY G C  L+ ++  R  QE +K  VR  VP     V  D V G++E   + + 
Sbjct: 122 SQGQMPRYLGKCRNLTEEQKRRFEQEGRKPTVRFKVPEGVKIVVHDLVRGDVEFMSDDIG 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V++KSDG+PTY+ A VIDDHLMKI+HV RGEE +S+ P+ IL+Y    F +P+F H+ 
Sbjct: 182 DFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALEFELPQFAHVS 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           LI   D++K+SKR   T +  Y   GYL E LINFLALL     ED + + DM+ LI +F
Sbjct: 242 LILGKDRTKMSKRHGSTWVEQYREQGYLKEGLINFLALLGWSPPEDKE-IFDMEYLIENF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------EKDRL 353
            L  +SK  A+FD  KL+++N + I+   S  E       +              + + L
Sbjct: 301 SLDRVSKNPAIFDIDKLNYINSQHIKL-KSLDELTQMCIPYFVEAGYIKEDEAKSKFEWL 359

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
            + +      +  LS +    D  F +++ +  E      L  E +  ++   + + +  
Sbjct: 360 KKIVKSVYEGLDYLSQIKDKVDIFFNNEVKI-EEDEAKEVLKWEHLKHLIDVFENKIKEA 418

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
                ENI+   + + +      K +  P+ + +TG  +   L + IEI+G+  +  RL 
Sbjct: 419 GDLTPENIKVLFKEIQKETGYKGKNLFMPIRVVLTGKTHGPELVEIIEIVGKESILKRLE 478


>gi|313201425|ref|YP_004040083.1| glutamyl-tRNA synthetase [Methylovorus sp. MP688]
 gi|312440741|gb|ADQ84847.1| glutamyl-tRNA synthetase [Methylovorus sp. MP688]
          Length = 469

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 152/476 (31%), Positives = 242/476 (50%), Gaps = 21/476 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R APSPTG  HIG A TALF++  A++ GG FILRIEDTD  RST E+  A++  + 
Sbjct: 3   VRTRFAPSPTGFLHIGGARTALFSWAYARKHGGSFILRIEDTDVARSTPEAVQAILDGMT 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEG        P+ Q +R + Y+  +Q LL+   A+ C+CS E L+ +R  Q +
Sbjct: 63  WLGLSWDEG--------PFYQMQRMDRYKEVIQQLLDSGDAYYCYCSKEELDALREQQMQ 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + I  RYDG   +  + ++          VVR   P  G+ V+ D V GE+ I    +D 
Sbjct: 115 QGIKPRYDGR-WRPEAGKVLPEPPAGVPPVVRFKNPQTGAVVWNDLVKGEIRISNEELDD 173

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M IT V RG++ +++ P+ I + Q     IP++ HL +
Sbjct: 174 LIIARADGTPTYNFCVVVDDWEMGITQVIRGDDHVNNTPRQINMLQALGAQIPQYAHLSM 233

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D  KLSKR    S+  Y   GYLPEA++N+LA L       DDE+  M+Q    FD
Sbjct: 234 ILGDDGQKLSKRHGAVSVMQYHEDGYLPEAVLNYLARLGWS--HGDDEVFSMEQFCAWFD 291

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKL---STTEFLSRVSQWMKEKDRLTQ---ALTLA 360
           L H++ + A F+ +KL+WLN  +I++        +   R++    +          + L 
Sbjct: 292 LDHITPSAAQFNTEKLNWLNAHYIKQADISLLAADIQQRLTALGVDTANGPDLAGVIALY 351

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
           + R  TL+ L     + ++       ++  +      +++ +L     + E I  W  E+
Sbjct: 352 RERSNTLNDLASSIAYFYRKPET---DAAAAEKHLTVDVLPMLAGMAAKLENIA-WTTES 407

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI 476
           I   ++            I  PL + +TG   S  +   + +LG+     R+R ++
Sbjct: 408 IHDVIQATVSDNGLKFPKIAMPLRVMVTGGAQSPSIDAVMALLGKDETLSRIRESL 463


>gi|296388364|ref|ZP_06877839.1| glutamyl-tRNA synthetase [Pseudomonas aeruginosa PAb1]
          Length = 494

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 224/491 (45%), Positives = 320/491 (65%), Gaps = 4/491 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++  VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  +
Sbjct: 1   MTT--VRTRIAPSPTGDPHVGTAYIALFNLCFARQHGGQFILRIEDTDQLRSTRESEQQI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +L+W G+ WDEGPD+GG +GPYRQSER +IY+ Y   L+EK  AF CFC+ ERL+ +R
Sbjct: 59  YDALRWLGIEWDEGPDVGGPHGPYRQSERGHIYKRYSDELVEKGHAFTCFCTPERLDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RYDGHC+ L   E++R     + HV R+ VP +G CV  D + G++EIPW
Sbjct: 119 AEQMARKETPRYDGHCMHLPKDEVQRRLAAGESHVTRMKVPTEGVCVVPDMLRGDVEIPW 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +DMQVL+K+DG+PTY LANV+DDHLM ITHV RGEEW+ S PK I LY+YF +  P+ 
Sbjct: 179 DRMDMQVLMKADGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLIKLYEYFGWEQPQL 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            ++PL++NPDKSKLSKR+NPTSI++Y  MGYLP+AL+N+L  +     ++ ++   + ++
Sbjct: 239 CYMPLLRNPDKSKLSKRKNPTSITFYERMGYLPQALLNYLGRMGWSMPDEREK-FTLAEM 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I HFDL  +S  G +FD +KL WLNG+WIRE  S  EF   V +W    + L +     Q
Sbjct: 298 IEHFDLSRVSLGGPIFDLEKLSWLNGQWIRE-QSVEEFAREVQKWALNPEYLMKIAPHVQ 356

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
            R+   S +  +  F F   + L A  F+   L P ++  +L+    + E ++ W++E I
Sbjct: 357 GRVENFSQIEPLAGFFFSGGVPLDASLFEHKKLDPTQVRQVLQLVLWKLESLRQWEKERI 416

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
              ++ VA+H +  L+ ++  +F AITG   S+ + D++EILG  +  +RLR A+ L+  
Sbjct: 417 TGCIQAVAEHLQLKLRDVMPLMFPAITGHASSVSVLDAMEILGADLSRYRLRQALELLGG 476

Query: 482 LVQNHKKKELK 492
             +   K+  K
Sbjct: 477 ASKKETKEWEK 487


>gi|241889517|ref|ZP_04776816.1| glutamyl-tRNA synthetase [Gemella haemolysans ATCC 10379]
 gi|241863824|gb|EER68207.1| glutamyl-tRNA synthetase [Gemella haemolysans ATCC 10379]
          Length = 487

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 170/490 (34%), Positives = 267/490 (54%), Gaps = 16/490 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL AK   G F+LRIEDTD KR+  E E + ++
Sbjct: 1   MTKVRVRYAPSPTGNLHIGNARTALFNYLFAKHNDGDFVLRIEDTDFKRNKEEGERSQLK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            + W GL++DEG      +GPYRQSER +IYQ Y   L+ +  A++C+ + E LE  R  
Sbjct: 61  YMNWLGLDYDEGIGKEKEFGPYRQSERIDIYQKYADQLIAEDKAYKCYMTAEELEAEREE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q    +P RY G    L+ +E E   +E +K  +R+ VP   +  F D V GE+    + 
Sbjct: 121 QIANGLPPRYSGKHANLTKEEQEAFEKEGRKPAIRIRVPQDRTYKFDDMVKGELSFEGHD 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
               V++K+DG+ TY+ A VIDD+LMKI+HV RG++ +S+ PK +++Y+   F  P F H
Sbjct: 181 FGDFVIIKNDGVATYNFAVVIDDYLMKISHVLRGDDHVSNTPKQLVVYEALGFEPPRFGH 240

Query: 244 LPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           + LI N +K KLSKR       I  Y  +GYLPEAL NF+ALL      + + +   ++ 
Sbjct: 241 MTLIVNENKKKLSKRDESIIQFIEQYDELGYLPEALFNFIALLGWSPEGEQE-IFSKEEF 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLST-----------TEFLSRVSQWMKEK 350
           +  FD   LSK+ A FD  KL W+N ++I+ +               E ++   +    K
Sbjct: 300 VKIFDEKRLSKSPAFFDNNKLTWINNQYIKAQPLERIVDLSLPFFIKEGVATAEEVEANK 359

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
               + ++L Q +++  + + ++T   F  D+    E  +   L  E    + +    + 
Sbjct: 360 VWFEKLISLYQPQMSYGAEIVELTKQFFVEDVKFDEEELE--ILKQETTATVFEDFLTKV 417

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
           E ++ +  +NI+  ++++ +      K +  P+ +A TGS +   L  S+E+LG+  V  
Sbjct: 418 EEVEEFTADNIKDLIKSIQKDTGVKGKNLFMPIRIASTGSMHGPELNTSLELLGKERVAA 477

Query: 471 RLRHAIALVS 480
           R++ A+  + 
Sbjct: 478 RVKAALETIK 487


>gi|77359588|ref|YP_339163.1| glutamyl-tRNA synthetase [Pseudoalteromonas haloplanktis TAC125]
 gi|115305789|sp|Q3IHK6|SYE_PSEHT RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|76874499|emb|CAI85720.1| Glutamyl-tRNA synthetase (Glutamate-tRNA ligase) [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 494

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 211/482 (43%), Positives = 301/482 (62%), Gaps = 2/482 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           +R R+APSPTG+PH+GTAY ALFNY  AK+ GG+F+LRIEDTD  RST ESE A+M SL+
Sbjct: 3   IRTRVAPSPTGDPHLGTAYIALFNYCFAKQQGGEFVLRIEDTDQVRSTAESEQAIMDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WD GPD+GG +GPYRQSER ++Y+ Y   L++   AF CF ++E L++MR  Q  
Sbjct: 63  WLGLEWDHGPDVGGEFGPYRQSERSDLYKKYAHQLVDDGKAFYCFATSEELDKMREEQMA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
             +  +YDG  L  +  EI+      K +V+R+ +P++G+  F D +  E+EIPW  VDM
Sbjct: 123 EGLRPKYDGRGLNHTDDEIKANLAAGKPYVIRMKIPSEGTFKFNDYLRDEIEIPWENVDM 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVLLK+DG PTY LANV+DDH M+I+H+ RGEEWI+S PK + LY+ F +  P   HLPL
Sbjct: 183 QVLLKADGFPTYFLANVVDDHHMQISHIFRGEEWINSAPKLLKLYEDFGWEAPVLGHLPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  MGYLPEA++N+L  +     ++ ++   + ++I +FD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYKEMGYLPEAVLNYLGRMGWSMPDEREK-FTLNEMIENFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD  KL WLNG WIRE L+  + + R   W    + L + L  A++RI T
Sbjct: 302 MKRVSLGGPVFDVDKLSWLNGMWIRENLTDEQLIQRFVDWKFNGEMLAKVLPEAKARINT 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS L  +                 +     + I   L+    + E ++ + +  I    +
Sbjct: 362 LSDLVDLAGHFVGGIPTYDPALLTAGKADEDVIRQALQFFVWQLEGLRSFDKPAIFAIAK 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            VA   E  +K  ++P+F+AITG   S  + D++EILG  +   RLR A+A +  + +  
Sbjct: 422 EVATFHELKIKDFLEPIFVAITGKTSSTSVLDAMEILGSDLSRARLRVALAHLG-ISKKQ 480

Query: 487 KK 488
            K
Sbjct: 481 AK 482


>gi|239636925|ref|ZP_04677923.1| glutamyl-tRNA synthetase [Staphylococcus warneri L37603]
 gi|239597473|gb|EEQ79972.1| glutamyl-tRNA synthetase [Staphylococcus warneri L37603]
          Length = 484

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 171/487 (35%), Positives = 270/487 (55%), Gaps = 16/487 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S +VRVR APSPTG  HIG A TALFNYL AK  GG F++RIEDTDSKR+  + E++  
Sbjct: 1   MSERVRVRYAPSPTGYLHIGNARTALFNYLFAKHYGGDFVVRIEDTDSKRNLEDGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL WDE  D    YGPYRQSER +IY P ++ LL++  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLEWDESVDKDKGYGPYRQSERADIYNPLIKQLLDEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V GE+    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPKDKTYTFNDMVKGEISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ +S+ PK +++Y+ F +  P F 
Sbjct: 181 NMGDWVIVKKDGVPTYNFAVAIDDHYMEISDVIRGDDHVSNTPKQLMIYEAFGWEAPRFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ LL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFITLLGWSPEGE-EEIYSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +           +   ++
Sbjct: 300 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFELALPHLIKANLIPENPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
            D   + + L Q  ++    +  +++  F        E  +   +  E++ +++     +
Sbjct: 360 LDWGRKLVALYQKEMSYAGEIVPLSEMFFNDMPEFGEE--EKEVINGEQVPELMTHLYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKDKVL 477

Query: 470 FRLRHAI 476
            RL+  I
Sbjct: 478 SRLKEYI 484


>gi|71066611|ref|YP_265338.1| glutamyl-tRNA synthetase [Psychrobacter arcticus 273-4]
 gi|115305791|sp|Q4FQ04|SYE_PSYA2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|71039596|gb|AAZ19904.1| glutamyl-tRNA synthetase [Psychrobacter arcticus 273-4]
          Length = 509

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 224/485 (46%), Positives = 315/485 (64%), Gaps = 9/485 (1%)

Query: 1   MI-------SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRS 53
           M+       S+  VR RIAPSPTG PH+GTAY ALFN   AK  GG+FILRIEDTD  RS
Sbjct: 1   MMQPSTSTNSNRPVRTRIAPSPTGFPHVGTAYIALFNLAFAKAHGGEFILRIEDTDQTRS 60

Query: 54  TLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCS 113
           T +SE  ++ +L+W GL+W EGPD+GG + PYRQSER  IY+ + + L++   AFRCFC+
Sbjct: 61  TEQSEKMILDALRWVGLDWSEGPDVGGPHAPYRQSERSAIYKKHAEQLIDSDHAFRCFCT 120

Query: 114 TERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKV 173
           +E L+ MR  Q       RYDG C  L++++ E+L +E K +V+R+ VP +G C  QD +
Sbjct: 121 SEELDTMRAEQMANGETPRYDGRCAHLATEKTEQLVKEGKPNVIRMRVPTEGVCQVQDML 180

Query: 174 YGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQY 233
            G +EIPW  VDMQVLLK+DGMPTYHLANV+DDHLM I+HV RGEEW++S PKH LLY+Y
Sbjct: 181 RGTVEIPWTQVDMQVLLKTDGMPTYHLANVVDDHLMDISHVLRGEEWLNSAPKHQLLYEY 240

Query: 234 FNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDD 293
           F + +P   H+PL++NPDKSKLSKR+NPTSI+YY   G LPEAL+N+L  +     ++ +
Sbjct: 241 FGWEMPVLCHMPLLRNPDKSKLSKRKNPTSITYYRDAGVLPEALLNYLGRMGYSMPDEAE 300

Query: 294 ELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRL 353
           +   + ++I   D+  +S  G +FD +KL+WLN  W+R  L+  E  +++  W    D+L
Sbjct: 301 K-FTLDEMIASLDIQRVSLGGPIFDIEKLNWLNAEWLRA-LTPEELKNKILDWASNSDKL 358

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
           T      Q RI  LS     + F F++   + AESF   +L  E+II++L+    + E +
Sbjct: 359 TAIAAAIQPRIELLSDAVNWSGFYFQNLPDINAESFTHKSLTAEQIIEMLQLALWQLETL 418

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
             W  ENI   L+ +A H +  ++  + P F+AI GS  S P+ +S+ I+G  +   RLR
Sbjct: 419 PTWSEENIYATLKGLAAHLDIKMRDFMAPFFIAIAGSTSSTPVMNSMAIIGADMTLTRLR 478

Query: 474 HAIAL 478
           HA+ +
Sbjct: 479 HAVDV 483


>gi|228475262|ref|ZP_04059987.1| glutamate--tRNA ligase [Staphylococcus hominis SK119]
 gi|228270727|gb|EEK12136.1| glutamate--tRNA ligase [Staphylococcus hominis SK119]
          Length = 484

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 173/485 (35%), Positives = 272/485 (56%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S +VRVR APSPTG  HIG A TALFNYL AK   G F++RIEDTDSKR+  + E++  
Sbjct: 1   MSERVRVRYAPSPTGYLHIGNARTALFNYLFAKHYDGDFVVRIEDTDSKRNLEDGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    +GPYRQSER +IY P +Q LL++  A++C+ + E LEE R 
Sbjct: 61  DNLKWLGLDWDESIDKDKGHGPYRQSERADIYNPLIQQLLDEDKAYKCYMTEEELEEERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E +K  +R  VP   +  F D V GE+    N
Sbjct: 121 AQIARGEMPRYGGKHAHLTEEQRQQFEAEGRKPAIRFRVPKDKTYTFDDMVKGEISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  +DDH M+I+ V RG++ +S+ PK +++Y+ F +  P F 
Sbjct: 181 NIGDWVIVKKDGVPTYNFAVAVDDHYMEISDVIRGDDHVSNTPKQLMIYEAFGWEPPRFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ALL      + DE+   ++
Sbjct: 241 HMSLIVNEQRKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-DEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKE 349
            I  FD   LSK+ A+FD+QKL W+N ++++ K + T F   +           +   ++
Sbjct: 300 FIKIFDEQRLSKSPAMFDRQKLAWVNNQYMKTKDTETVFELALPHLIKANLIPENPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
           K+   + + L Q  ++    +  +++  F     L  E  +   L  E++ +++     +
Sbjct: 360 KEWGRKLIGLYQKEMSYAGEIVPLSEMFFHDMPELGEE--EQEVLNGEQVPELMSHLYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 SRLKK 482


>gi|329770403|ref|ZP_08261785.1| glutamyl-tRNA synthetase [Gemella sanguinis M325]
 gi|328836526|gb|EGF86186.1| glutamyl-tRNA synthetase [Gemella sanguinis M325]
          Length = 487

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 169/490 (34%), Positives = 269/490 (54%), Gaps = 16/490 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL AK  GG F+LRIEDTD KR+  E E + ++
Sbjct: 1   MTKVRVRYAPSPTGNLHIGNARTALFNYLFAKHYGGDFVLRIEDTDFKRNKEEGERSQLK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            + W GL++DEG +    +GPYRQSER +IY+ Y + LL +  A++C+ + E LE  R  
Sbjct: 61  YMDWLGLDYDEGIEKEKEFGPYRQSERLDIYRKYAEQLLAEDKAYKCYMTAEELEAEREE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q    +P RY G    L+ +E E   +E +K  +R+ VP   +  F D V GE+    + 
Sbjct: 121 QIANGLPPRYSGKHAHLTKEEQEAFEKEGRKPSIRIRVPQDRTYSFDDMVKGELSFEGHD 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
               V++K+DG+ TY+ A  IDDHLM+I+HV RG++ +S+ PK +++Y+   F  P F H
Sbjct: 181 FGDFVIVKNDGVATYNFAVAIDDHLMEISHVLRGDDHVSNTPKQLVVYEALGFEPPRFGH 240

Query: 244 LPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           + LI N +K KLSKR       I  Y  +GYLPEAL NF+ LL      + + +   ++ 
Sbjct: 241 MTLIVNENKKKLSKRDETIIQFIEQYDDLGYLPEALFNFITLLGWSPEGEQE-IFTKEEF 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLST-----------TEFLSRVSQWMKEK 350
           I  FD   LSK+ A FD  KL W+N ++I+ +               E ++   +    +
Sbjct: 300 IKIFDEKRLSKSPAFFDNNKLTWINNQYIKAQPLERIVELSLPFFVKEGVATKEEVENNR 359

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
               + ++L Q +++  + + ++T   F  ++    E  +   L  +    + +    + 
Sbjct: 360 AWFEKLISLYQPQMSYGAEIVELTKQFFNENIEFDEEELE--ILKQDSTKVVFEDFLGKL 417

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
           + IQ +  +NI+  ++++ +      K +  P+ +A TGS +   L  S+E+LG+  V  
Sbjct: 418 DSIQEFTADNIKALIKSIQKDTGVKGKNLFMPIRIASTGSMHGPELNTSLELLGKERVST 477

Query: 471 RLRHAIALVS 480
           R++ A+ L+ 
Sbjct: 478 RVKVALDLIK 487


>gi|89100733|ref|ZP_01173588.1| glutamyl-tRNA synthetase [Bacillus sp. NRRL B-14911]
 gi|89084550|gb|EAR63696.1| glutamyl-tRNA synthetase [Bacillus sp. NRRL B-14911]
          Length = 485

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 178/484 (36%), Positives = 273/484 (56%), Gaps = 18/484 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S+++RVR APSPTG  HIG A TALFNYL A+  GGKFI+RIEDTD KR+    E + +
Sbjct: 1   MSNEIRVRYAPSPTGHLHIGNARTALFNYLFARSKGGKFIIRIEDTDLKRNIEGGEESQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           + L+W G++WDE  D  G YGPYRQSER +IYQ   Q LL+K LA++C+C+ E LE  R 
Sbjct: 61  KYLQWLGIDWDESIDKDGGYGPYRQSERNDIYQELYQELLDKDLAYKCYCTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    +Y G C  L+ +E E+L  E ++  +R  VP      F D V  E+    +
Sbjct: 121 EQMARGDNPQYSGKCRHLTQEEREKLEAEGRRPSIRFIVPKGKVYAFNDMVKDEVSFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
                V++K DG+PTY+ A   DDH+MKI+HV RG++ IS+ PK +++Y+ F +  P F 
Sbjct: 181 GFGDFVIVKKDGIPTYNFAVAADDHMMKISHVLRGDDHISNTPKQLMIYEAFGWEPPVFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ALL    + + +E+   ++
Sbjct: 241 HMTLIVNESRKKLSKRDESIIQFIEQYEDLGYLPEALFNFIALLGWSPAGE-EEIFTKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------ 348
           LI+ F+   LSK+ A+FDKQKL W+N ++I+ +    + +      +             
Sbjct: 300 LINIFEADRLSKSPALFDKQKLTWMNNQYIK-QEELDKLVEISLPHLIKAGKVSENLTAA 358

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           +++ +   ++L Q +++  + +  ++   F  D+    E+     L  E++ ++L     
Sbjct: 359 DEEWVRGLISLYQDQMSYGAEIVDLSGIFFTEDVSYDGEA--KEVLSEEQVPEVLSAFLT 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           E + ++ +  E I+ AL+ V +      K +  P+  AITG  +   L  +I +LG+  V
Sbjct: 417 EIDSLEDFTAEEIKAALKAVQKGTGHKGKKLFMPVRAAITGQTHGPDLPKAIALLGKDKV 476

Query: 469 YFRL 472
             RL
Sbjct: 477 KNRL 480


>gi|220932714|ref|YP_002509622.1| glutamyl-tRNA synthetase [Halothermothrix orenii H 168]
 gi|219994024|gb|ACL70627.1| glutamyl-tRNA synthetase [Halothermothrix orenii H 168]
          Length = 491

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 184/489 (37%), Positives = 280/489 (57%), Gaps = 15/489 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVRVR APSPTG+ HIG   TALFN+L A+   G FILRIEDTD++RST ES   ++++L
Sbjct: 4   KVRVRFAPSPTGDLHIGGVRTALFNWLFARHNNGDFILRIEDTDAQRSTEESSRQIIKAL 63

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           KW GL WDEGP +GG YGPY QSER+  YQ  +  LLE   A+ C+C+ E +E+M++   
Sbjct: 64  KWVGLEWDEGPGVGGDYGPYFQSERQQFYQKAIDYLLENDKAYYCYCTPEEIEDMKKEAD 123

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
           KR  P+ Y G C  L+ +E + L +E +K VVRL  P++G  V +D V G++      ++
Sbjct: 124 KRGEPAIYSGKCCNLTEEERKELEKEGRKPVVRLKTPDEGYTVVKDIVRGKVSFENRLLE 183

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             +++KSDG PTY+ A V+DDH M ITHV R +E +S+ PK I++Y+   + IP F H+P
Sbjct: 184 DLIIMKSDGKPTYNFACVVDDHRMGITHVIRADEHLSNTPKQIMVYKALGYDIPNFAHVP 243

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I  PD++KLSKR   TS+  +   GYLP+ALIN+L LL      ++DE++ + + I  F
Sbjct: 244 MILAPDRTKLSKRHGATSVDEFMEQGYLPQALINYLLLLGWS-PGNNDEIISLDRAIRDF 302

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ------------WMKEKDRL 353
            L  +SK  AV+D +KL W+NG+++R  L   E +                    E++RL
Sbjct: 303 KLDDVSKNPAVYDTKKLTWVNGQYMRS-LPLEEIIKHALPLIKEAGFVNFPLNTDEEERL 361

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
            + +   + R  TL  L     + +  +     +  K   +  ++ I IL+   +  + +
Sbjct: 362 YKIIDAVRERSRTLVELVDGISYFYDDNFEYDEKGVKKHFM-KDDTITILENDIDCLKKV 420

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
           + + RE IE   R  ++        ++    LA++G  +   LF  +E++GR     RL 
Sbjct: 421 EPFNREAIEEIYRARSKDLGVKAARMIHTTRLALSGRTFGPGLFTLVELVGREEAIKRLE 480

Query: 474 HAIALVSSL 482
            A+  V + 
Sbjct: 481 RALEYVKNK 489


>gi|39932177|sp|Q896M5|SYE_CLOTE RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
          Length = 488

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 181/491 (36%), Positives = 267/491 (54%), Gaps = 10/491 (2%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ +K+R R APSPTG  H+G   TAL+ YLIAK   G F+LRIEDTD +R    + + +
Sbjct: 1   MNGNKIRTRFAPSPTGYMHVGNLRTALYAYLIAKHENGDFLLRIEDTDQERQVEGALDII 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +LK  G++ DEGPDIGG  GPY QSERK+IY  Y Q L++K  A+ CFC+ ERL+ +R
Sbjct: 61  YNTLKMTGIHHDEGPDIGGPVGPYVQSERKHIYTEYAQKLIDKGEAYYCFCTKERLDMLR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
                   P +YD HC  LS +EIE   +     V+R   PN+G+  F+D+++G++ +  
Sbjct: 121 ENSESLGRPHKYDKHCSHLSKEEIEENLKAGIPFVIRQNNPNKGTTYFEDEIFGKITVDN 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +D  VL+KSDG PTY+ ANV+DDHLM ITHV RG E++SS PK+  LY  F + +P++
Sbjct: 181 SELDDMVLIKSDGFPTYNFANVVDDHLMGITHVVRGSEYLSSSPKYNRLYDAFGWDVPKY 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           IH P I     SKLSKR    S       GYL +A++N++ALL        +E+  ++ L
Sbjct: 241 IHCPPIMKDSHSKLSKRNGDASFQDLLEKGYLKDAILNYIALLG-WNPGTTEEIFSLEDL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQAL---- 357
           I  FD   ++KA A+FD +KL W+NG +IR   S  EF      + K        L    
Sbjct: 300 IGKFDYKSINKAPAIFDNKKLKWMNGEYIR-MFSLEEFHKLALPYYKGVITKDFDLLKIS 358

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHL--TAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
            L  +R   LS +P+     F             K      E  ++ L+      E I  
Sbjct: 359 ELLHTRTELLSEIPEQ-VDFFDELPEYSCDLYVHKKMKTNFENSLESLEKALPVLESIDN 417

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSL-PLFDSIEILGRSVVYFRLRH 474
           W  E I  ++  + +  E    I++ P+  A++G K++    F+  EILG+     R++ 
Sbjct: 418 WNTETIHDSIMELIKELEVKNGIVLWPIRTAVSGKKFTPGGAFEIAEILGKEETLKRVKI 477

Query: 475 AIALVSSLVQN 485
            I  + + +  
Sbjct: 478 GIEKLKNEINQ 488


>gi|161502430|ref|YP_001569542.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189082164|sp|A9MIG3|SYE_SALAR RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|160863777|gb|ABX20400.1| hypothetical protein SARI_00469 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 471

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 154/487 (31%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERL+++R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLDQLREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I+ F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--NGDQEIFTREEMINLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSSSAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSAITDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A+++ A+  E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQSTAEELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|218705914|ref|YP_002413433.1| glutamyl-tRNA synthetase [Escherichia coli UMN026]
 gi|293405849|ref|ZP_06649841.1| gltX [Escherichia coli FVEC1412]
 gi|298381598|ref|ZP_06991197.1| glutamyl-tRNA synthetase [Escherichia coli FVEC1302]
 gi|300901365|ref|ZP_07119455.1| glutamyl-tRNA synthetase [Escherichia coli MS 198-1]
 gi|218433011|emb|CAR13906.1| glutamyl-tRNA synthetase [Escherichia coli UMN026]
 gi|291428057|gb|EFF01084.1| gltX [Escherichia coli FVEC1412]
 gi|298279040|gb|EFI20554.1| glutamyl-tRNA synthetase [Escherichia coli FVEC1302]
 gi|300355209|gb|EFJ71079.1| glutamyl-tRNA synthetase [Escherichia coli MS 198-1]
          Length = 471

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLNLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|258625263|ref|ZP_05720171.1| Glutamyl-tRNA synthetase [Vibrio mimicus VM603]
 gi|258582436|gb|EEW07277.1| Glutamyl-tRNA synthetase [Vibrio mimicus VM603]
          Length = 513

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 42  VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 101

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 102 WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 153

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 154 NKEMPRYDANHPKIKAVNEAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 211

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 212 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 271

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 272 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 329

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L  +SK+ + F+  KL WLN  +I+   S  E++++  +W  +   + +         + 
Sbjct: 330 LGAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFDHQGINKATGPALAEVVK 387

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 388 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 445

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+A 
Sbjct: 446 EALHQVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALAY 505

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 506 IETREANA 513


>gi|94502073|ref|ZP_01308577.1| glutamyl-tRNA synthetase [Oceanobacter sp. RED65]
 gi|94425784|gb|EAT10788.1| glutamyl-tRNA synthetase [Oceanobacter sp. RED65]
          Length = 501

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 221/486 (45%), Positives = 323/486 (66%), Gaps = 2/486 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R+APSPTG+PH+GTAY ALFN   A++ GG+F+LRIEDTD  RST ESE ++  SL+
Sbjct: 3   VRTRVAPSPTGDPHVGTAYIALFNLAYARQHGGQFLLRIEDTDQARSTAESEQSIYDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEGPD+GG+ GPYRQSER +IY+ ++  LLEK  AF+C+ + E LEE+R  +++
Sbjct: 63  WLGLEWDEGPDVGGSCGPYRQSERGDIYKEHINILLEKGHAFKCYRTNEELEELRSQKQE 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           +   S      L+LS +E  +       +VVR+ VP +G C F+D++ GE+E+ W  +D 
Sbjct: 123 QGGYSALKFSDLRLSEEEQAKREAAGDSYVVRMHVPEEGVCTFKDELRGEIEMEWAMIDC 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           Q+L+KSDGMPTYHLANV+DDHLM+ITHV RGEEW+SS PKH LLY+YF++ +P  IH+PL
Sbjct: 183 QILMKSDGMPTYHLANVVDDHLMEITHVIRGEEWLSSAPKHQLLYKYFDWQMPTLIHMPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI YY  MG+LPEAL+N+L  +     ++ +      ++  HFD
Sbjct: 243 LRNPDKSKLSKRKNPTSILYYKRMGFLPEALLNYLGRMGWSMPDERE-QFTRDEMFEHFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G +FD++KL WLN +W+R+ LS  EF+ R   W  +K  L   +   Q R+  
Sbjct: 302 IGRVSLGGPIFDQEKLSWLNSQWLRD-LSEEEFVQRFVDWGLDKSALMPVVQHVQPRVER 360

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS +  +T FL    L +T + F+   +  +E++ +L+    + E I+ W++  I+  L 
Sbjct: 361 LSDVVPLTSFLLSGMLDVTEQQFEHKKIEKDELVKLLQMGLWQLEAIRHWEKPEIQKRLF 420

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            +A+ +E   K  ++P F+AI G+  S  + DS+E+LG  +   R+RHAI ++  + +  
Sbjct: 421 ALAKIKELKPKEFLQPFFVAIAGTTQSFSVLDSMEVLGPDMSRARVRHAIEVLGGVSKKG 480

Query: 487 KKKELK 492
            KK  K
Sbjct: 481 MKKLEK 486


>gi|39996321|ref|NP_952272.1| glutamyl-tRNA synthetase [Geobacter sulfurreducens PCA]
 gi|67461825|sp|Q74DU6|SYE_GEOSL RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|39983201|gb|AAR34595.1| glutamyl-tRNA synthetase [Geobacter sulfurreducens PCA]
 gi|298505331|gb|ADI84054.1| glutamyl-tRNA synthetase, non-discriminating [Geobacter
           sulfurreducens KN400]
          Length = 466

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 163/484 (33%), Positives = 258/484 (53%), Gaps = 26/484 (5%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S VR+R APSPTG  H+G A TALFN+L+A++ GG FILRIEDTD  RST ES +A++Q
Sbjct: 1   MSDVRLRFAPSPTGYLHVGGARTALFNWLLARKQGGTFILRIEDTDVARSTQESVDAILQ 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            ++W GL+WDEG        P+ QSER  +Y+ +V+ LL +  A+RC+C+ E LE  R  
Sbjct: 61  GMEWLGLDWDEG--------PFYQSERFPVYREFVERLLAEGKAYRCYCTPEELEARREQ 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             K     +YDG C  L +Q+ +R        VVR   P++G   F D + G +      
Sbjct: 113 AMKEGRKPKYDGTCRDLVTQDADR------PFVVRFRAPHEGVTAFDDLIKGRIAFNNEE 166

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  ++ ++DG PTY+   VIDD  M IT V RG++ I++ P+ ILLY+   +P+P F H
Sbjct: 167 LDDLIIQRTDGTPTYNFVVVIDDATMGITTVIRGDDHINNTPRQILLYEALGYPVPRFAH 226

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +P+I   DK++LSKR   TS+  Y  MG+LPEA++N+L  L       D+E+   Q L+ 
Sbjct: 227 VPMILGADKTRLSKRHGATSVMAYRDMGFLPEAMVNYLVRLGWS--HGDEEIFSRQDLVE 284

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRL-------TQA 356
            F +  + K+  VF+  KL WLN  +I+E  S       +  +++E+           Q 
Sbjct: 285 KFTIEAVGKSAGVFNPDKLLWLNHHYIKE-SSPERLAELLVPFLRERGVDPSTGPSLPQV 343

Query: 357 LTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIW 416
           +   Q R  TL  +     F ++S++    E+     +     + +L +  E+ +    +
Sbjct: 344 VKTLQERSRTLVEMADGALFYYRSEISYDEEAAAKHLV--PGTLPLLASLAEKLDACADF 401

Query: 417 KRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI 476
               +E A +     +      +   + +++ G   S  +++ +E LG+     RLR A+
Sbjct: 402 SHSGLEAAFKEFIAEKGIKFGQLGPAVRVSLCGGTASPGIYEVVEALGKDETLRRLRRAV 461

Query: 477 ALVS 480
           A + 
Sbjct: 462 AYLE 465


>gi|293610696|ref|ZP_06692996.1| glutamyl-tRNA synthetase [Acinetobacter sp. SH024]
 gi|292827040|gb|EFF85405.1| glutamyl-tRNA synthetase [Acinetobacter sp. SH024]
          Length = 502

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 227/483 (46%), Positives = 306/483 (63%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAFYCFATAEELDQMRVEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKLS +E+ R  +  + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLSQEEVTRRLEAGEPHVIRMKVPEEGVCKFNDLLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPKHQLLYQYFGWEMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +Q ++ +F
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDERE-VFTLQDMMDNF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+      + L R+  W  +++ L       Q RI 
Sbjct: 301 DIQRVSLGGPIFDVEKLNWLNGQWIKGLTPG-QLLDRLLTWKSDRNTLEDIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F     +TAE F+S  L  E++   L+      E    W  + +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQFAIWRLEGQFTWNNDTVSQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A      L+  +   F+AI GS  S P+  S+  LG  + + RLRHA+ +V    + 
Sbjct: 420 MDLANQMGIKLRDFMPAFFIAIAGSTSSTPVMQSMVTLGPDLTFARLRHALEIVGGPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 EVK 482


>gi|291327215|ref|ZP_06127378.2| glutamate--tRNA ligase [Providencia rettgeri DSM 1131]
 gi|291311203|gb|EFE51656.1| glutamate--tRNA ligase [Providencia rettgeri DSM 1131]
          Length = 498

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 157/492 (31%), Positives = 254/492 (51%), Gaps = 23/492 (4%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           IS SK++ R APSPTG  H+G A TAL+++L ++   G+F+LRIEDTD +RST E+ +A+
Sbjct: 24  ISMSKIKTRFAPSPTGYLHVGGARTALYSWLFSRHNQGEFVLRIEDTDLERSTQEAIDAI 83

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           M  + W  LNWDEG        PY Q++R + Y   +  +L+   A+RC+CS ERLE +R
Sbjct: 84  MDGMNWLNLNWDEG--------PYYQTKRFDRYNDVIDQMLDAGTAYRCYCSKERLEALR 135

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q   N   RYDG C   +           + HVVR   P +GS +F DK+ G +E   
Sbjct: 136 EEQMANNEKPRYDGCCRDHAHNH-----TPDEPHVVRFRNPQEGSVIFDDKIRGPIEFSN 190

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
             +D  ++ ++DG PTY+   VIDD  M+ITHV RGE+ I++ P+ I + +    P+P +
Sbjct: 191 QELDDLIIRRTDGSPTYNFCVVIDDWDMEITHVIRGEDHINNTPRQINILKALGAPVPVY 250

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+ +I   D  KLSKR    S+  Y   GYLP+AL+N+L  L       D E+  ++++
Sbjct: 251 AHVSMILGDDGKKLSKRHGAVSVMQYRDDGYLPQALLNYLVRLGWS--HGDQEIFTVEEM 308

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTT---EFLSRVSQWMKEKDRLTQALT 358
             +F L  +SK+ + F+ +KL WLN  +I    +          + Q   +     Q + 
Sbjct: 309 KEYFSLDAISKSASAFNTEKLQWLNHHYINSLPAEEVATYLAWHIEQQNIDTSTGPQLVD 368

Query: 359 LAQ---SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
           L +    R  TL  + +   + ++      A++ K            L+  +++   I  
Sbjct: 369 LIKLLGERCKTLKEMAESCHYFYQDFEEFDADAAKKH--LRPVARQPLEVVKDKLAAITD 426

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA 475
           W  EN+  A+   A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A
Sbjct: 427 WTAENVHQAIEATAAELEVGMGKVGMPLRVAVTGAGQSPGLDVTVHAIGQARSIARIEKA 486

Query: 476 IALVSSLVQNHK 487
           +A ++    + +
Sbjct: 487 LAFIAEREASAQ 498


>gi|314937167|ref|ZP_07844514.1| glutamate--tRNA ligase [Staphylococcus hominis subsp. hominis C80]
 gi|313655786|gb|EFS19531.1| glutamate--tRNA ligase [Staphylococcus hominis subsp. hominis C80]
          Length = 484

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 174/485 (35%), Positives = 273/485 (56%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S +VRVR APSPTG  HIG A TALFNYL AK   G F++RIEDTDSKR+  + E++  
Sbjct: 1   MSERVRVRYAPSPTGYLHIGNARTALFNYLFAKHYDGDFVVRIEDTDSKRNLEDGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    +GPYRQSER +IY P +Q LL++  A++C+ + E LEE R 
Sbjct: 61  DNLKWLGLDWDESIDKDKGHGPYRQSERADIYNPLIQQLLDEDKAYKCYMTEEELEEERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E +KH +R  VP   +  F D V GE+    N
Sbjct: 121 AQIARGEMPRYGGKHAHLTEEQRQQFEAEGRKHAIRFRVPKDKTYTFDDMVKGEISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  +DDH M+I+ V RG++ +S+ PK +++Y+ F +  P F 
Sbjct: 181 NIGDWVIVKKDGVPTYNFAVAVDDHYMEISDVIRGDDHVSNTPKQLMIYEAFGWEPPRFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ALL      + DE+   ++
Sbjct: 241 HMSLIVNEQRKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-DEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKE 349
            I  FD   LSK+ A+FD+QKL W+N ++++ K + T F   +           +   ++
Sbjct: 300 FIKIFDEQRLSKSPAMFDRQKLAWVNNQYMKTKDTETVFELALPHLIKANLIPENPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
           K+   + + L Q  ++    +  +++  F     L  E  +   L  E++ +++     +
Sbjct: 360 KEWGRKLIGLYQKEMSYAGEIVPLSEMFFHDMPELGEE--EQEVLNGEQVPELMSHLYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 SRLKK 482


>gi|315179385|gb|ADT86299.1| glutamyl-tRNA synthetase [Vibrio furnissii NCTC 11218]
          Length = 475

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 155/489 (31%), Positives = 252/489 (51%), Gaps = 24/489 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAILEGMT 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEG        PY Q++R + Y   V+ LL +  A++C+   + L+E+R  Q  
Sbjct: 63  WLGLDWDEG--------PYYQTKRFDRYNEVVEQLLAEDKAYKCYAPKDLLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD    K+ +              +R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDADHPKIKAVNEAAKE--GDPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVVDDVDMGITHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDEGYLPEALINYLVRLGWG--HGDQEIFSREEMIELFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLT--------QALT 358
           L+ +SK+ + F+  KL WLN  +I+   S  E++++  +W  +   +           + 
Sbjct: 291 LNAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFDHQGINKANGPALADIVK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 349 LVGERCHTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLALALSKIEALTEWNT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   + +V    E  +  I  PL +A+TG   S  +   + ++G++ V  R++ A+A 
Sbjct: 407 EALHQVIADVCAELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGKARVIARIQMALAF 466

Query: 479 VSSLVQNHK 487
           + +   N +
Sbjct: 467 IEAREANAQ 475


>gi|222149833|ref|YP_002550790.1| glutamyl-tRNA synthetase [Agrobacterium vitis S4]
 gi|221736815|gb|ACM37778.1| glutamyl-tRNA synthetase [Agrobacterium vitis S4]
          Length = 484

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 283/482 (58%), Positives = 358/482 (74%), Gaps = 1/482 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +++S VRVRIAPSPTGEPH+GTAY ALFNYL AK+ GG+FILRIEDTD+ RST E E  V
Sbjct: 1   MTTSGVRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGEFILRIEDTDATRSTAEFEQKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +LKW GL W EGPD+GG YGPYRQSERK+ Y+P+V  ++ +  AFRCFC+  RL++MR
Sbjct: 61  LDALKWTGLTWAEGPDVGGPYGPYRQSERKDTYRPFVDKMVTEGNAFRCFCTPARLDQMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P  YDG CL L ++E++      + HVVRL +P +GSC F D VYG++ IPW
Sbjct: 121 EAQRAAGKPPGYDGLCLHLKAEEVDARVAAGEPHVVRLKIPTEGSCDFHDGVYGDVSIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
            +VDMQVLLK+DGMPTYH+ANV+DDHLMKITHVARGEEW++SVPKHIL+Y+Y     P F
Sbjct: 181 ESVDMQVLLKADGMPTYHMANVVDDHLMKITHVARGEEWLASVPKHILIYKYLGLEPPVF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSISYYSA+GYLPEAL+NFL L F+ +  + +EL+ M +L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSISYYSALGYLPEALMNFLGLFFM-QIAEGEELLTMDEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           I  FD  +LSKAGA+FD QKLDWLNGRW+REKL+  EFL RV  W  E DRLT+ L LAQ
Sbjct: 300 IAKFDPDNLSKAGAIFDIQKLDWLNGRWLREKLTPDEFLGRVLTWASENDRLTEGLKLAQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
           SRIT L  LP +  FL  +D+ LT  SF      P E ++I+ T Q + E I  W    I
Sbjct: 360 SRITKLGELPPLAGFLLANDVGLTPASFGGLKTSPAETLEIVTTVQADLEKILEWNVATI 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSS 481
           E  LR +A    K L+++  PLF+A++GS+ SLPLFDS+ +LGRSVV  RL+ AI +++S
Sbjct: 420 EEELRAIADRLGKKLRVVTPPLFVAVSGSQRSLPLFDSMALLGRSVVRQRLKVAIQVLTS 479

Query: 482 LV 483
           + 
Sbjct: 480 MA 481


>gi|312134781|ref|YP_004002119.1| glutamyl-tRNA synthetase [Caldicellulosiruptor owensensis OL]
 gi|311774832|gb|ADQ04319.1| glutamyl-tRNA synthetase [Caldicellulosiruptor owensensis OL]
          Length = 480

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 176/483 (36%), Positives = 283/483 (58%), Gaps = 13/483 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG+ HIG A TALFNYL A++  GKF+LRIEDTD +RS  E    +M+SL+
Sbjct: 2   VRVRFAPSPTGQLHIGGARTALFNYLFARKHNGKFVLRIEDTDLERSREEWAKGIMKSLR 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEGPD+GG +GPY QS+RK IY  Y+Q LLE+  A+ CFC+ E +E  R   R+
Sbjct: 62  WLGIEWDEGPDVGGEFGPYFQSQRKEIYLEYIQKLLEEGKAYYCFCTHEEIEREREIARQ 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + IP +Y   C  +S ++ ++  +  +K VVR+  P +G+ V  D + G++E   + +D 
Sbjct: 122 QKIPYKYSKKCRNISLEDAKKKIENGEKAVVRIKAPMEGTTVVHDIIRGDVEFSNDHLDD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++LKSDG PTY+   VIDD+LMKI+HV R EE +S+ PK +++Y+  N   P+F H+P+
Sbjct: 182 FIILKSDGNPTYNFVCVIDDYLMKISHVIRAEEHLSNTPKQLIIYEALNIQPPQFAHVPM 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD+SKLSKR   TS+  +   GYL EA++N+L LL      +D  ++ + + I  F+
Sbjct: 242 ILAPDRSKLSKRHGATSVEEFFENGYLKEAIVNYLLLLGWSPG-EDRTIITLDEAIQKFE 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM---------KEKDRLTQAL 357
           L  +SK  A++D  KL W+NG +++E +   +   R+  +           +K+ +   L
Sbjct: 301 LEKVSKNAAIYDINKLTWINGYYLKE-IDIDDLYERMKYFYSKEGIDITSFDKEYVKSVL 359

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            L + ++ TL  +   + + F S+     +  +     P+ + + L+   ++ + I+ + 
Sbjct: 360 KLVREKVKTLVEVVSASTYFFDSNYEYEQKGVEK-YFTPDNLKN-LQLLLDDLKNIKPFS 417

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E IE  +R  A+        I+  + + I+G   +  LF+ +E++G+  V  R+   I 
Sbjct: 418 AEEIEKLVRRKAEELNTKAANIIHTIRMCISGRTVTPGLFEMMEVIGKDEVVSRIEKTIK 477

Query: 478 LVS 480
             +
Sbjct: 478 KFA 480


>gi|222528937|ref|YP_002572819.1| glutamyl-tRNA synthetase [Caldicellulosiruptor bescii DSM 6725]
 gi|222455784|gb|ACM60046.1| glutamyl-tRNA synthetase [Caldicellulosiruptor bescii DSM 6725]
          Length = 480

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 176/483 (36%), Positives = 281/483 (58%), Gaps = 13/483 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG+ HIG A TALFNYL AK+  GKFILRIEDTD +RS  E    +M+SL+
Sbjct: 2   VRVRFAPSPTGQLHIGGARTALFNYLYAKKHNGKFILRIEDTDLERSREEWAKGIMRSLR 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEGPD+GG +GPY QS+RK IY  Y++ LLE+  A+ CFC+ E +E  R   R+
Sbjct: 62  WLGIEWDEGPDVGGEFGPYFQSQRKEIYLEYIKKLLEEGKAYYCFCTQEEIEREREIARQ 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           + IP +Y   C  +S +E ++  +  +K VVR+  P +G+ V  D + G++E   + +D 
Sbjct: 122 QKIPYKYSKKCRNISLEEAKKRIENGEKAVVRIKAPVEGTTVVHDIIRGDVEFSNDQLDD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++LKSDG PTY+   VIDD+LMKI+HV R EE +S+ PK +++Y+  N   P+F H+P+
Sbjct: 182 FIILKSDGNPTYNFVCVIDDYLMKISHVIRAEEHLSNTPKQLIIYEALNIQPPQFAHVPM 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD+SKLSKR   TS+  +   GYL EA++N+L LL      +D  ++ + + I  F+
Sbjct: 242 ILAPDRSKLSKRHGATSVEEFFENGYLKEAIVNYLLLLGWSPG-EDRTIISLDEAIQKFE 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM---------KEKDRLTQAL 357
           L  +SK  A++D  KL W+NG +++E +   +   R+  +           +K+ +   L
Sbjct: 301 LEKVSKNAAIYDINKLTWINGYYLKE-IDIDDLYERMKYFYSKNGIDISSFDKEYVKSVL 359

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            L + ++ TL  +   + + F S+     +  +         +  L+    + + +Q + 
Sbjct: 360 KLVREKVKTLVEVVSASTYFFDSNYEYEQKGVEKYFTADN--LKCLQLLLNDLKNVQPFS 417

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E IE  +R+ A+        ++  + + I+G   +  LF+ +E+LG+  V  R+   + 
Sbjct: 418 SEEIEKLVRSKAEEFNTKAANLIHTIRMCISGRTVTPGLFEMMEVLGKDEVINRIEKTLK 477

Query: 478 LVS 480
           + +
Sbjct: 478 IFA 480


>gi|169794469|ref|YP_001712262.1| glutamyl-tRNA synthetase [Acinetobacter baumannii AYE]
 gi|184159724|ref|YP_001848063.1| glutamyl-tRNA synthetase [Acinetobacter baumannii ACICU]
 gi|213158959|ref|YP_002320957.1| glutamyl-tRNA synthetase [Acinetobacter baumannii AB0057]
 gi|215482059|ref|YP_002324241.1| glutamyl-tRNA synthetase [Acinetobacter baumannii AB307-0294]
 gi|239501979|ref|ZP_04661289.1| glutamyl-tRNA synthetase [Acinetobacter baumannii AB900]
 gi|260556902|ref|ZP_05829119.1| glutamyl-tRNA synthetase [Acinetobacter baumannii ATCC 19606]
 gi|301345406|ref|ZP_07226147.1| glutamyl-tRNA synthetase [Acinetobacter baumannii AB056]
 gi|301595236|ref|ZP_07240244.1| glutamyl-tRNA synthetase [Acinetobacter baumannii AB059]
 gi|332851369|ref|ZP_08433421.1| glutamate--tRNA ligase [Acinetobacter baumannii 6013150]
 gi|332868780|ref|ZP_08438403.1| glutamate--tRNA ligase [Acinetobacter baumannii 6013113]
 gi|332873761|ref|ZP_08441703.1| glutamate--tRNA ligase [Acinetobacter baumannii 6014059]
 gi|238688070|sp|B0V8Q3|SYE_ACIBY RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|238691014|sp|B2I0L0|SYE_ACIBC RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|169147396|emb|CAM85257.1| glutamyl-tRNA synthetase [Acinetobacter baumannii AYE]
 gi|183211318|gb|ACC58716.1| Glutamyl- and glutaminyl-tRNA synthetase [Acinetobacter baumannii
           ACICU]
 gi|213058119|gb|ACJ43021.1| glutamyl-tRNA synthetase [Acinetobacter baumannii AB0057]
 gi|213988245|gb|ACJ58544.1| glutamyl-tRNA synthetase [Acinetobacter baumannii AB307-0294]
 gi|260409508|gb|EEX02809.1| glutamyl-tRNA synthetase [Acinetobacter baumannii ATCC 19606]
 gi|322509637|gb|ADX05091.1| gltX [Acinetobacter baumannii 1656-2]
 gi|323519655|gb|ADX94036.1| glutamyl-tRNA synthetase [Acinetobacter baumannii TCDC-AB0715]
 gi|332730085|gb|EGJ61413.1| glutamate--tRNA ligase [Acinetobacter baumannii 6013150]
 gi|332733209|gb|EGJ64406.1| glutamate--tRNA ligase [Acinetobacter baumannii 6013113]
 gi|332737984|gb|EGJ68869.1| glutamate--tRNA ligase [Acinetobacter baumannii 6014059]
          Length = 502

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 227/483 (46%), Positives = 306/483 (63%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAFYCFATAEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKLS +E+ R  +  + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLSQEEVARRLEAGEPHVIRMKVPEEGVCKFNDLLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPKHQLLYQYFGWEMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +Q ++ +F
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDERE-VFTLQDMMDNF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+      + L R+  W  ++  L       Q RI 
Sbjct: 301 DIQRVSLGGPIFDVEKLNWLNGQWIKGLTPG-QLLDRLLTWKSDRSTLEDIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F     +TAE F+S  L  E++   L+      E    W  + +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQFAIWRLESQFTWNNDTVSQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A      L+  +   F+AI GS  S P+  S+  LG  + + RLRHA+ +V +  + 
Sbjct: 420 MDLANQMGIKLRDFMPTFFIAIAGSTSSTPVMQSMVTLGPDLTFARLRHALEIVGAPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 EVK 482


>gi|313625377|gb|EFR95167.1| glutamyl-tRNA synthetase [Listeria innocua FSL J1-023]
          Length = 491

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/487 (35%), Positives = 272/487 (55%), Gaps = 16/487 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNVADGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M++LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL+K LA++C+C+ E LE  
Sbjct: 61  QMKNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQQLLDKGLAYKCYCTEEELEAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++     ++  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEEQGFKPSIRFKVPANETITFNDMVKDDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK IL+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK-------- 350
           ++ I  FD   LSK+ A+FD  KL W+N +++++ L   + +      +++         
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKK-LPLNDVVELSLPHLQKAGVVSADLD 358

Query: 351 ----DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
               D + + ++L   +++  + +  +++  F     +T +  +   L  E +  ++   
Sbjct: 359 QAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEEKAVLAEETVPTVISAF 418

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
           ++E E + + +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LG  
Sbjct: 419 KKELEALDVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGLE 478

Query: 467 VVYFRLR 473
            V  RL 
Sbjct: 479 KVLNRLN 485


>gi|254362454|ref|ZP_04978562.1| glutamate--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|261494000|ref|ZP_05990506.1| glutamate--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496946|ref|ZP_05993313.1| glutamate--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153094046|gb|EDN74958.1| glutamate--tRNA ligase [Mannheimia haemolytica PHL213]
 gi|261307382|gb|EEY08718.1| glutamate--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261310346|gb|EEY11543.1| glutamate--tRNA ligase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 479

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 161/484 (33%), Positives = 246/484 (50%), Gaps = 24/484 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHNDGEFVLRIEDTDLERSTPEATAAILEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  +LE   A+RC+CS ERL+E+R  Q 
Sbjct: 74  EWLDLAW--------EHGPYFQTKRFDRYNQVIDQMLEAGTAYRCYCSKERLDEVRAEQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                ++YD HCL              + HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKAKYDQHCLHNPQN------DPSQPHVVRFKNPTEGSVVFDDAVRGRIEIANSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H+ 
Sbjct: 180 DLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+    ++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFSRDEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST------TEFLSRVSQWMKEKDRLTQALTL 359
           D+H +SK+ + F+ +KL WLN  +IR    +         +           +L + + +
Sbjct: 298 DIHSVSKSASAFNTEKLQWLNQHYIRSLAPSYVAKHLEWHMQTQGIDFTSGPKLEEIIPV 357

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  L + + + ++       ++         E +  L    E+      W  E
Sbjct: 358 LGERCKTLKELAESSRYFYQEFKAYDEKAAAKNF--KAEAVAPLAKLLEKLTACNDWTVE 415

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           NI  A+   A   E  +  +  P  LA+TGS  S  +  + +++G+     RL+ AI  +
Sbjct: 416 NIHEAMNQTAAELEIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGKERTLARLQKAIEFI 475

Query: 480 SSLV 483
            +  
Sbjct: 476 QANS 479


>gi|254225789|ref|ZP_04919394.1| glutamyl-tRNA synthetase [Vibrio cholerae V51]
 gi|125621695|gb|EAZ50024.1| glutamyl-tRNA synthetase [Vibrio cholerae V51]
          Length = 509

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/504 (30%), Positives = 255/504 (50%), Gaps = 34/504 (6%)

Query: 1   MISSSK----------VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDS 50
           M+SS +          V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD 
Sbjct: 22  MLSSQQKNLTKVIEMTVKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDL 81

Query: 51  KRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC 110
           +RST  + +A+++ + W GL WDEG        PY Q++R + Y   +  LL +  A++C
Sbjct: 82  ERSTQAAVDAIIEGMTWLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKC 133

Query: 111 FCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQ 170
           +   E L+E+R  Q       RYD +  K+ +          +   +R   P +GS VF 
Sbjct: 134 YAPKELLDEIRAEQEANKEMPRYDANHPKIKAVNDAAKE--GEPCCIRFRNPKEGSVVFD 191

Query: 171 DKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILL 230
           D++ G +EI  + +D  ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +
Sbjct: 192 DQIRGRIEIRNDQLDDLIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINI 251

Query: 231 YQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSE 290
           Y+     IP F H  +I   D +KLSKR    S+  Y   GYLPEAL+N+L  L      
Sbjct: 252 YKAMGATIPTFAHCAMILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--H 309

Query: 291 DDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK 350
            D E+    ++I+ F L+ +SK+ + F+  KL WLN  +I+   S  E++++  +W  E 
Sbjct: 310 GDQEIFSRDEMINLFSLNAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFEN 367

Query: 351 DRLTQ--------ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDI 402
             + +         + L   R  TL  L Q + + ++      A++ K          + 
Sbjct: 368 QGINKATGPALAEVVKLVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEP 425

Query: 403 LKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEI 462
           L     + E +  W  E +   +  V +  E  +  I  PL +A+TG   S  +   + +
Sbjct: 426 LMLALSKIEALTEWNTEALHQVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNL 485

Query: 463 LGRSVVYFRLRHAIALVSSLVQNH 486
           +G+  V  R++ A+  + +   N 
Sbjct: 486 IGQERVIARIKMALEYIETREANA 509


>gi|167036778|ref|YP_001664356.1| glutamyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320115200|ref|YP_004185359.1| glutamyl-tRNA synthetase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|238687708|sp|B0KCH7|SYE1_THEP3 RecName: Full=Glutamyl-tRNA synthetase 1; AltName:
           Full=Glutamate--tRNA ligase 1; Short=GluRS 1
 gi|166855612|gb|ABY94020.1| glutamyl-tRNA synthetase [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319928291|gb|ADV78976.1| glutamyl-tRNA synthetase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 485

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 179/485 (36%), Positives = 270/485 (55%), Gaps = 16/485 (3%)

Query: 8   RVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKW 67
           RVR APSPTG  HIG   TALFNYL ++  G  F+LRIEDTD +RS+ E E  + + L+W
Sbjct: 5   RVRFAPSPTGAIHIGNIRTALFNYLFSRSEGATFVLRIEDTDLERSSKEFEELIFKELEW 64

Query: 68  CGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKR 127
            G+ WDEGPD  G YGPYRQSER  IY  + Q L+E+K A+RC+C+ E LEE RR   +R
Sbjct: 65  LGIEWDEGPDKPGPYGPYRQSERLEIYHKFAQKLIEEKKAYRCYCTPEELEEDRRKAVER 124

Query: 128 NIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQ 187
                Y G C  L+ ++ E   +E +K V+R  +P+     F+D + G++ I  + +   
Sbjct: 125 GDIPCYSGRCRYLTKEQEEAFIREGRKPVIRFIIPDDEVIEFEDMIKGKITIKSDTLGGD 184

Query: 188 V-LLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           + ++KSDGMPTY+ A VIDD LMKITHV RGE+ I + PK IL+Y+   F IP+F H PL
Sbjct: 185 MVIVKSDGMPTYNFAVVIDDALMKITHVIRGEDHIYNTPKQILIYKALGFEIPKFAHAPL 244

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD++KLSKR   T I  Y  +GYLPEA+ NFL+LL     ++ + +M  +++I  F+
Sbjct: 245 ILGPDRTKLSKRHGNTYIGQYRELGYLPEAMFNFLSLLSWSPEDNVE-IMSKEEIIKKFN 303

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-----------MKEKDRLTQ 355
              +  A  VFD +KL+W+N ++I++  S    +                     + L  
Sbjct: 304 FRRIHSANPVFDIEKLNWMNQQYIQK-SSIERIVDLAIPHLRRAGYIDGIDDMVYNWLKD 362

Query: 356 ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
            ++L +  +  ++ + +     F  ++  + E+ K   L       +L+  ++  E    
Sbjct: 363 VISLYKDGLQYVAQITEKAKMFFVEEVEYSDETVK--ILNSPNSKIVLEVVKKVIEEADE 420

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA 475
              E ++  L+ + +  +   K    P+ +AITG  +   L   I +LG+  V  RL+ A
Sbjct: 421 ITEEYVKDLLKKLQKETKVKGKEFFMPIRVAITGEDHGPELVKIIPLLGKDKVINRLKKA 480

Query: 476 IALVS 480
           I L+ 
Sbjct: 481 INLIK 485


>gi|28210684|ref|NP_781628.1| glutamyl-tRNA synthetase [Clostridium tetani E88]
 gi|28203122|gb|AAO35565.1| glutamyl-tRNA synthetase [Clostridium tetani E88]
          Length = 522

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 181/491 (36%), Positives = 267/491 (54%), Gaps = 10/491 (2%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ +K+R R APSPTG  H+G   TAL+ YLIAK   G F+LRIEDTD +R    + + +
Sbjct: 35  MNGNKIRTRFAPSPTGYMHVGNLRTALYAYLIAKHENGDFLLRIEDTDQERQVEGALDII 94

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             +LK  G++ DEGPDIGG  GPY QSERK+IY  Y Q L++K  A+ CFC+ ERL+ +R
Sbjct: 95  YNTLKMTGIHHDEGPDIGGPVGPYVQSERKHIYTEYAQKLIDKGEAYYCFCTKERLDMLR 154

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
                   P +YD HC  LS +EIE   +     V+R   PN+G+  F+D+++G++ +  
Sbjct: 155 ENSESLGRPHKYDKHCSHLSKEEIEENLKAGIPFVIRQNNPNKGTTYFEDEIFGKITVDN 214

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +D  VL+KSDG PTY+ ANV+DDHLM ITHV RG E++SS PK+  LY  F + +P++
Sbjct: 215 SELDDMVLIKSDGFPTYNFANVVDDHLMGITHVVRGSEYLSSSPKYNRLYDAFGWDVPKY 274

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           IH P I     SKLSKR    S       GYL +A++N++ALL        +E+  ++ L
Sbjct: 275 IHCPPIMKDSHSKLSKRNGDASFQDLLEKGYLKDAILNYIALLG-WNPGTTEEIFSLEDL 333

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQAL---- 357
           I  FD   ++KA A+FD +KL W+NG +IR   S  EF      + K        L    
Sbjct: 334 IGKFDYKSINKAPAIFDNKKLKWMNGEYIR-MFSLEEFHKLALPYYKGVITKDFDLLKIS 392

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHL--TAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
            L  +R   LS +P+     F             K      E  ++ L+      E I  
Sbjct: 393 ELLHTRTELLSEIPEQ-VDFFDELPEYSCDLYVHKKMKTNFENSLESLEKALPVLESIDN 451

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSL-PLFDSIEILGRSVVYFRLRH 474
           W  E I  ++  + +  E    I++ P+  A++G K++    F+  EILG+     R++ 
Sbjct: 452 WNTETIHDSIMELIKELEVKNGIVLWPIRTAVSGKKFTPGGAFEIAEILGKEETLKRVKI 511

Query: 475 AIALVSSLVQN 485
            I  + + +  
Sbjct: 512 GIEKLKNEINQ 522


>gi|258621035|ref|ZP_05716069.1| Glutamyl-tRNA synthetase [Vibrio mimicus VM573]
 gi|258586423|gb|EEW11138.1| Glutamyl-tRNA synthetase [Vibrio mimicus VM573]
          Length = 509

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 38  VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 97

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 98  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 149

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 150 NKEMPRYDANHPKIKAVNEAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 207

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 208 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 267

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 268 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 325

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L  +SK+ + F+  KL WLN  +I+   S  E++++  +W  +   + +         + 
Sbjct: 326 LGAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFDHQGINKATGPALAEVVK 383

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 384 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 441

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+A 
Sbjct: 442 EALHQVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALAY 501

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 502 IETREANA 509


>gi|110642586|ref|YP_670316.1| glutamyl-tRNA synthetase [Escherichia coli 536]
 gi|191173782|ref|ZP_03035304.1| glutamyl-tRNA synthetase [Escherichia coli F11]
 gi|300997712|ref|ZP_07181831.1| glutamyl-tRNA synthetase [Escherichia coli MS 200-1]
 gi|123147856|sp|Q0TF64|SYE_ECOL5 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|110344178|gb|ABG70415.1| glutamyl-tRNA synthetase [Escherichia coli 536]
 gi|190905930|gb|EDV65547.1| glutamyl-tRNA synthetase [Escherichia coli F11]
 gi|300304142|gb|EFJ58662.1| glutamyl-tRNA synthetase [Escherichia coli MS 200-1]
 gi|324011043|gb|EGB80262.1| glutamyl-tRNA synthetase [Escherichia coli MS 60-1]
          Length = 471

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLNLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 ALNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLTAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|298528228|ref|ZP_07015632.1| glutamyl-tRNA synthetase [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511880|gb|EFI35782.1| glutamyl-tRNA synthetase [Desulfonatronospira thiodismutans ASO3-1]
          Length = 463

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 174/476 (36%), Positives = 257/476 (53%), Gaps = 22/476 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            SKV  R APSPTG  HIG A TALFN+L+A+ +GG+F+LRIEDTD +RS+ E   A++ 
Sbjct: 1   MSKVVARFAPSPTGYLHIGGARTALFNWLLARGSGGRFLLRIEDTDVERSSQEMTQAILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           S+ W GL++D+         PY QS+R  +Y+ Y+Q L+    A+ C C+ E +EEMR  
Sbjct: 61  SMHWLGLDYDQ--------EPYYQSKRFEVYKEYIQKLVRTGHAYYCRCTPEEVEEMREK 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
            R         G   K S +  E   Q     V+RL  P  G  V+QD+V G + +    
Sbjct: 113 ARA-------LGQKPKYSGKCREACLQPGPDTVIRLKAPQAGQTVYQDQVKGSIAVDNTQ 165

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  VL + DG PTY+LA V DD  M ITHV RG++ I++ P+ +L+YQ  +   P F H
Sbjct: 166 LDDLVLERMDGTPTYNLAVVADDIEMGITHVLRGDDHINNTPRQLLIYQALDVTPPFFGH 225

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +P+I  PDK KLSKR    S+  Y  MGYLPEAL+N+LA L       D+E+  ++ L+ 
Sbjct: 226 VPMILGPDKKKLSKRHGALSVMAYKEMGYLPEALVNYLARLGWS--YKDEEIFSLEDLLQ 283

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLST-----TEFLSRVSQWMKEKDRLTQALT 358
            F L +L  +  VFD +KL WLN  +I+E          +     SQ +  +  L   + 
Sbjct: 284 KFSLDNLGASACVFDTEKLKWLNSHYIKESSPARLALILQQHLDASQPVPAQAYLENIIP 343

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L Q R +T+  + +M  F    D  L  +          E  + L+   E    ++ + +
Sbjct: 344 LLQPRASTMQEMAEMAHFFLVPDQELEMDQKAVDKFLTPEAREYLREIAEILAGMEEFDQ 403

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
           EN+E A++   + +    K I +PL +A+TG   S  +F+++++LGR     RLR 
Sbjct: 404 ENLEQAMKVYIEEKNIKFKAIAQPLRVALTGKTASPGIFETMQVLGRESCVNRLRR 459


>gi|301512875|ref|ZP_07238112.1| glutamyl-tRNA synthetase [Acinetobacter baumannii AB058]
          Length = 502

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 227/483 (46%), Positives = 307/483 (63%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAFYCFATAEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKLS +E+ R  +  + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLSQEEVARRLEAGEPHVIRMKVPEEGVCKFNDLLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPKHQLLYQYFGWEMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +Q ++ +F
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDERE-VFTLQDMMDNF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+      + L R+  W  ++  L +     Q RI 
Sbjct: 301 DIQRVSLGGPIFDVEKLNWLNGQWIKGLTPG-QLLDRLLTWKSDRSTLEEIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F     +TAE F+S  L  E++   L+      E    W  + +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQFAIWRLESQFTWNNDTVSQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A      L+  +   F+AI GS  S P+  S+  LG  + + RLRHA+ +V +  + 
Sbjct: 420 MDLANQMGIKLRDFMPTFFIAIAGSTSSTPVMQSMVTLGPDLTFARLRHALEIVGAPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 EVK 482


>gi|16799346|ref|NP_469614.1| glutamyl-tRNA synthetase [Listeria innocua Clip11262]
 gi|22257059|sp|Q92F38|SYE_LISIN RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|16412698|emb|CAC95502.1| gltX [Listeria innocua Clip11262]
          Length = 491

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 172/487 (35%), Positives = 273/487 (56%), Gaps = 16/487 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNVADGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M++LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL+K LA++C+C+ E LE  
Sbjct: 61  QMKNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQQLLDKGLAYKCYCTEEELEAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK IL+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L     E ++E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWS-PEGEEEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK-------- 350
           ++ I  FD   LSK+ A+FD  KL W+N +++++ L   + +      +++         
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKK-LPLNDVVELSLPHLQKAGVVSADLD 358

Query: 351 ----DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
               D + + ++L   +++  + +  +++  F     +T +  +   L  E +  ++   
Sbjct: 359 QAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEEKAVLAEETVPKVISAF 418

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
           ++E E + + +   +++A++ V +      K +  P+ +  TG  +   L  +IE+LG  
Sbjct: 419 KKELEALDVLEAAEVKSAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGLE 478

Query: 467 VVYFRLR 473
            V  RL 
Sbjct: 479 KVLNRLD 485


>gi|319891492|ref|YP_004148367.1| Glutamyl-tRNA synthetase [Staphylococcus pseudintermedius HKU10-03]
 gi|317161188|gb|ADV04731.1| Glutamyl-tRNA synthetase [Staphylococcus pseudintermedius HKU10-03]
          Length = 484

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 172/487 (35%), Positives = 268/487 (55%), Gaps = 16/487 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S++VRVR APSPTG  HIG A TALFNYL AK   G F++RIEDTDSKR+  + E++  
Sbjct: 1   MSNRVRVRYAPSPTGYLHIGNARTALFNYLFAKHYDGDFVIRIEDTDSKRNLADGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER  IYQP V+ LL +  A++C+ + E LE  R+
Sbjct: 61  DNLKWLGLDWDESVDKDKGYGPYRQSERGEIYQPLVEQLLAEDKAYKCYMTEEELEAERQ 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ +E ++   E +K  +R  VP   +  F D V G +    +
Sbjct: 121 EQIARGEMPRYGGKHAHLTEEERQQFEAEGRKPAIRFRVPQNKTYTFDDMVKGPVTFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
                V++K DG+PTY+ A  +DDH M+I+ V RG++ IS+ PK +++Y+ F +  P F 
Sbjct: 181 NFGDWVIVKKDGVPTYNFAVAVDDHYMEISDVIRGDDHISNTPKQLMIYETFGWEPPRFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+    +
Sbjct: 241 HMTLIVNEQRKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKDE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  F    LSK+ A FDKQKL+W+N ++++EK + T F   +                E
Sbjct: 300 FIKIFTEKRLSKSPAFFDKQKLEWINNQYMKEKDAETVFEMTLPHMIKAGLLPESPSEVE 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
            D   + + L Q +++    +  +++  F+ +  L   S +   L  E++  ++     +
Sbjct: 360 LDWGRKLVALYQEQMSYAGEIVPLSELFFRDEKELDEASQE--VLNGEQVPQLMTALYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L +++E+LG+  V 
Sbjct: 418 LEALENFEAAEIKKIIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTMEVLGQDKVL 477

Query: 470 FRLRHAI 476
            R++  +
Sbjct: 478 RRIQSLL 484


>gi|269103202|ref|ZP_06155899.1| glutamyl-tRNA synthetase [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163100|gb|EEZ41596.1| glutamyl-tRNA synthetase [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 474

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/488 (32%), Positives = 257/488 (52%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+ +A+M+ ++
Sbjct: 3   VKTRFAPSPTGFLHVGGARTALYSWLYAKHNNGEFVLRIEDTDLERSTQEAIDAIMEGME 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W  LNWDEG        PY Q++R + Y   V  LL +  A++C+C  E L+E+R  Q  
Sbjct: 63  WLELNWDEG--------PYYQTKRFDRYNAVVDQLLAEDKAYKCYCPKELLDEIREEQMA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
             +  RYD +  K+        + E     +R   P +G+ VF DK+ G +EI  + +D 
Sbjct: 115 AGVKPRYDANHPKI--IAANAAATEDSPFCIRFRNPKEGTVVFDDKIRGRIEIANSELDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   VIDD  M IT V RGE+ I++ P+ I +Y+    P+PEF H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVIDDWDMGITQVVRGEDHINNTPRQINIYKALGAPVPEFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLP+AL+N+L  L       D E+  MQ++I  F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDEGYLPQALLNYLVRLGWS--HGDQEIFSMQEMIDLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK--------DRLTQALT 358
           L  +SK+ + F+  KL WLN  +I+   +  E++++  QW  ++          +T  + 
Sbjct: 291 LESVSKSASAFNTDKLLWLNNHYIKT--AEPEYVAKYLQWHLDQKEISLENGPAITDVIK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L + + + ++        + K          + L+    + E +  W  
Sbjct: 349 LVGERCNTLVELAEQSRYFYQDFDAFEEGAAKKH--LRPVAKEALELALAKVEALTEWTT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           EN+   +  V +  E  +  +  PL +A+TG   S  +   ++++G+  V  R++ A+  
Sbjct: 407 ENLHAVIAQVCEELELGMGKVGMPLRVAVTGQGQSPSVDAVMQLIGKDRVVARIKMALEF 466

Query: 479 VSSLVQNH 486
           +++   N 
Sbjct: 467 IAAREANA 474


>gi|260550819|ref|ZP_05825026.1| glutamyl-tRNA synthetase [Acinetobacter sp. RUH2624]
 gi|260406129|gb|EEW99614.1| glutamyl-tRNA synthetase [Acinetobacter sp. RUH2624]
          Length = 502

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 228/483 (47%), Positives = 307/483 (63%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAFYCFATAEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKLS +E+ R  +  + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLSQEEVTRRLEAGEPHVIRMKVPEEGVCKFNDLLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPKHQLLYQYFGWEMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +Q ++ HF
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDERE-VFTLQDMMDHF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+      + L R+  W  +++ L       Q RI 
Sbjct: 301 DIQRVSLGGPIFDVEKLNWLNGQWIKGLTPG-QLLDRLLTWKSDRNTLEDIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F     +TAE F+S  L  E++   L+      E    W  + +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQFAIWRLESQFTWNNDTVSQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A      L+  +   F+AI GS  S P+  S+  LG  + + RLRHA+ +V +  + 
Sbjct: 420 MDLANQMGIKLRDFMPAFFIAIAGSTSSTPVMQSMVTLGPDLTFARLRHALEIVGAPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 EVK 482


>gi|108805643|ref|YP_645580.1| glutamyl-tRNA synthetase [Rubrobacter xylanophilus DSM 9941]
 gi|123367895|sp|Q1AS60|SYE2_RUBXD RecName: Full=Glutamyl-tRNA synthetase 2; AltName:
           Full=Glutamate--tRNA ligase 2; Short=GluRS 2
 gi|108766886|gb|ABG05768.1| glutamyl-tRNA synthetase [Rubrobacter xylanophilus DSM 9941]
          Length = 496

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/498 (34%), Positives = 268/498 (53%), Gaps = 16/498 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M +S +VRVR APSPTG  H+G   TALFN+L A++ GG FILRIEDTD +RST ES   
Sbjct: 1   MEASRQVRVRYAPSPTGRLHVGGVRTALFNWLFARKHGGVFILRIEDTDLERSTEESVEQ 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTER-LEE 119
           + +SL+W GL+WDEGPD+GG + PYRQ+ER  +Y+   + LLE   A+  F + E     
Sbjct: 61  LKRSLRWIGLDWDEGPDVGGPHAPYRQTERLELYRRAARRLLESGAAYYDFATPEELTRF 120

Query: 120 MRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEI 179
            +RA+ +   P    G   ++  +E  R  +  + H VR   P +G  VF+D + G +  
Sbjct: 121 RQRARAEGRPPIYTGGPYREMDPEEALRRVRMGEPHTVRFKTPREGRTVFEDIIRGPVGF 180

Query: 180 PWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIP 239
               ++  VLLKS G PTY+ A  +DD  M+ITHV RG++ IS+ P+ I++++     +P
Sbjct: 181 ENATIEDFVLLKSTGTPTYNFAAAVDDAEMQITHVIRGDDHISNTPRQIMIHRALGHELP 240

Query: 240 EFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            F H+P +  PD+ KLSKR    S+  ++  G LPEAL N+LALL    +  D+E+   +
Sbjct: 241 AFAHVPQVLGPDRKKLSKRHGAASVEDFAEQGILPEALFNYLALLGAGYA-ADEEIFAPE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +L   F L  +S   A+FD+QKL  +N  +IR   S  E     +               
Sbjct: 300 ELAERFRLEKVSGNPAIFDEQKLLAINAVYIRR-KSPEELAMLAAPMLSERGVADAGELE 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           ++  RL + + L + R+   + +P+   + +   L    E F+      E + + L    
Sbjct: 359 RDMPRLVRIMELLRERLQRTTDIPEAAGYFYGERLDYDREQFEKQ-FGKEFVRENLPELY 417

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
              + +  W  + IE+ +R +A  +EK  + ++ PL  A TG   S  LF+++E++GR  
Sbjct: 418 RRLKALPEWTADAIESCVRGLAAEKEKGARHLIHPLRFATTGRTVSAGLFETMELIGRER 477

Query: 468 VYFRLRHAIALVSSLVQN 485
              R+   +  + S  ++
Sbjct: 478 CLLRIADVLERLQSPERS 495


>gi|261211336|ref|ZP_05925624.1| glutamyl-tRNA synthetase [Vibrio sp. RC341]
 gi|260839291|gb|EEX65917.1| glutamyl-tRNA synthetase [Vibrio sp. RC341]
          Length = 474

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKAVNDAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 173 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLT--------QALT 358
           L+ +SK+ + F+  KL WLN  +I+   S  E++++  +W  +   +           + 
Sbjct: 291 LNAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFDHQGINKATGPALADVVK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 349 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLTLALSKIEALTEWNT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+A 
Sbjct: 407 EALHQVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIVRIKMALAF 466

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 467 IETREANE 474


>gi|258513617|ref|YP_003189839.1| glutamyl-tRNA synthetase [Desulfotomaculum acetoxidans DSM 771]
 gi|257777322|gb|ACV61216.1| glutamyl-tRNA synthetase [Desulfotomaculum acetoxidans DSM 771]
          Length = 485

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 174/488 (35%), Positives = 264/488 (54%), Gaps = 18/488 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S +RVR APSPTG  HIG A +ALFN+L A+   G F++RIEDTD +RS+  SE  ++ 
Sbjct: 1   MSGIRVRFAPSPTGPLHIGGARSALFNWLFARNNNGVFLVRIEDTDLERSSRASEENILN 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           SLKW G++WDEG ++GG  GPYRQ+ER  IY   ++ LL+   A+ C+CS E L   R  
Sbjct: 61  SLKWLGMDWDEGIEVGGENGPYRQTERLGIYHSCIKTLLDSGNAYYCYCSEEELAAERED 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
              R    RY G C  L++++  R   E +K V+R  VP        D+V G +      
Sbjct: 121 LMSRGELPRYLGKCRNLTAEDRCRYESEGRKPVLRFRVPVGQVITVNDQVRGNVSFECEG 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +   V+LKSD +PTY+ A V+DDH MKI+HV R EE +S+ P+ ILLYQ   + +P+F H
Sbjct: 181 IGDFVILKSDQIPTYNFAVVVDDHYMKISHVIRAEEHLSNTPRQILLYQALGWEVPQFAH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + LI   D+SK+SKR   TSI  Y ++GYLPEAL+NFLALL      + +E+  +  L  
Sbjct: 241 ISLILGQDRSKMSKRHGATSIEQYISLGYLPEALVNFLALLGWSPGGE-EEIFTLDLLKK 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKD 351
            F L  ++K  AVF+ +KL+WLNG +IR              +             ++  
Sbjct: 300 QFSLDRVAKNPAVFNMEKLNWLNGYYIRN-ADIDRITELAVPFLKSAGYLVGDVSQEQFS 358

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
            L + +++ +  I+ LS +P   D  FK  +     ++    L  E+   +L   +++  
Sbjct: 359 WLKKLMSVVRDYISCLSEVPLYADLFFKEKIIYDEAAWD--ILRQEQAPVVLSCLRDKIS 416

Query: 412 VIQ--IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            ++        I+  L+ + +      K++  P+ +A+TG  +   L+  I + GR V  
Sbjct: 417 SMEKDDITEGAIKKTLKAITKELGLGGKLVYVPIRIALTGKTHGPELYQVIPLFGREVTL 476

Query: 470 FRLRHAIA 477
            RL  ++ 
Sbjct: 477 ARLDDSLK 484


>gi|206603495|gb|EDZ39975.1| Glutamyl-tRNA synthetase [Leptospirillum sp. Group II '5-way CG']
          Length = 474

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 167/492 (33%), Positives = 258/492 (52%), Gaps = 30/492 (6%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ + +RVR APSPTG  H+G A TALFNYL A+   G F+LRIEDTD +RST ES  A+
Sbjct: 1   MTDAPIRVRFAPSPTGHLHLGGARTALFNYLFARHHQGTFVLRIEDTDRERSTKESIQAI 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
              L+W  ++WDEG        P+ QSER   Y     +LLE   A+RCFC+ + LE  R
Sbjct: 61  FDGLEWLSIDWDEG--------PFYQSERLEKYNDISNSLLESGKAYRCFCTPQELETRR 112

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           +    +  P +YDG C         R  Q Q  +V+R   P     + +D + G M    
Sbjct: 113 QEALSKGQPPKYDGRCRS-------RNDQPQGPYVIRFKNPETPEILVEDMIRGSMSFNG 165

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           N +D  VL++SDG PTY+ A V+DD  MKI+HV RG++ I++ P+ I L+Q     +P+F
Sbjct: 166 NLLDDWVLVRSDGYPTYNFAVVVDDIEMKISHVIRGDDHINNTPRQITLFQALGASLPKF 225

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+P+I   D++KLSKR   TS+  Y  MGYLP AL+N++A L       D E+   ++L
Sbjct: 226 AHIPMIHGSDRAKLSKRHGATSVMAYKDMGYLPHALVNYIARLGWS--HKDQEVFTKEEL 283

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTE-----------FLSRVSQWMKEK 350
           I +FDL  +  + A+F+ +KL WLN ++++   S                    +     
Sbjct: 284 IQYFDLDKVGSSPAIFNTEKLLWLNAQYMKNTPSEELSELVKPFLKPILHPIEYESPDSP 343

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
            RL++ + + +SR  TL  L          D   + E         +  + +L+  ++ F
Sbjct: 344 PRLSEIIEVWKSRSRTLQDLADSVHPFVDRDFSYSEEVLSKH--LTKTSVPLLQAFKDRF 401

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
           E +  W + ++E  +  + +     L  + +PL  A+TG   S  ++D + +LGR  V  
Sbjct: 402 EHLAQWNKPSLEHVIHAIGEEFGLKLSQLAQPLRAALTGQSVSPGIYDVLLLLGRLEVKQ 461

Query: 471 RLRHAIALVSSL 482
           R+++AI+    L
Sbjct: 462 RIQNAISKAGGL 473


>gi|116871620|ref|YP_848401.1| glutamyl-tRNA synthetase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123460672|sp|A0AF36|SYE_LISW6 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|116740498|emb|CAK19618.1| glutamyl-tRNA synthetase [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 491

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 170/487 (34%), Positives = 274/487 (56%), Gaps = 16/487 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNVADGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M++LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL++ LA++C+C+ E LE  
Sbjct: 61  QMKNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQQLLDEGLAYKCYCTEEELEAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+  N   RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANNEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK IL+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPT 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK-------- 350
           ++ I  FD   LSK+ A+FD  KL W+N +++++ L   + +      +++         
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKK-LPLNDVVELSLPHLQKAGVVSADLD 358

Query: 351 ----DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
               D + + ++L   +++  + +  +++  F     +T +  +   L  + +  ++   
Sbjct: 359 QAELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAEAITFDEEEKAVLAEDTVPTVISAF 418

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
           ++E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LGR 
Sbjct: 419 KKELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGRE 478

Query: 467 VVYFRLR 473
            V  R+ 
Sbjct: 479 KVLNRMD 485


>gi|147676628|ref|YP_001210843.1| glutamyl- and glutaminyl-tRNA synthetases [Pelotomaculum
           thermopropionicum SI]
 gi|238686638|sp|A5D5L8|SYE_PELTS RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|146272725|dbj|BAF58474.1| glutamyl- and glutaminyl-tRNA synthetases [Pelotomaculum
           thermopropionicum SI]
          Length = 480

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/480 (35%), Positives = 262/480 (54%), Gaps = 15/480 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  HIG A +ALFN+L A+R GGKFI+RIEDTD +RS+ +SE  ++ +L+
Sbjct: 2   VRVRFAPSPTGPLHIGGARSALFNWLFARRYGGKFIVRIEDTDLERSSRQSEENILAALR 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEG D GG   PYRQ+ER ++Y+ Y + LL+   A+RC+C+ E L   R A  +
Sbjct: 62  WLGLDWDEGVDAGGPCEPYRQTERLHLYRHYAEILLQSGAAYRCYCTEEELAAEREALME 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           +    RY G C  L+ QE  RL  E +K  VR  VP       +D V G++    N +  
Sbjct: 122 KGETPRYLGRCRDLTPQERARLEAEGRKAAVRFRVPRDRVIQVKDLVRGDVSFECNGMGD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +++KSDG+PTY+ A V+DDH M I+HV R EE + + P+ ILLYQ   +  PEF H+ L
Sbjct: 182 FIIMKSDGIPTYNFAVVVDDHTMAISHVIRAEEHLPNTPRQILLYQALGWDTPEFAHVSL 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D+SK+SKR   T++  Y   GYLPEA++NFLALL      +++ ++ +++L   F 
Sbjct: 242 ILGKDRSKMSKRHGATAVEQYREKGYLPEAVVNFLALLGWSPGGENE-VLSIEELKQQFS 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKDRLT 354
           L  +SK+ AVFD  KL+WLNG +IR + S          +             +E +R+ 
Sbjct: 301 LEKVSKSPAVFDLDKLNWLNGYYIR-QSSLERVAELAVPFLEKAGYIRAPLSPEEFERVK 359

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
             +   +  +  +  +       F  + +   +      +  +++  +L   +++     
Sbjct: 360 MMVASVRKYLNCMEEVIDHVKIYFTDNFN-NLDEDAREVMAGQQVPAVLAALKDKVASGG 418

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
                    AL+ V +      + I  P+ +A++G+ +   L   + ILG+  V  RL  
Sbjct: 419 KLTGAAARAALKEVGKELGVKGQQIFMPVRVAVSGNTHGPDLDQIMAILGKDEVVKRLSR 478


>gi|301022283|ref|ZP_07186180.1| glutamyl-tRNA synthetase [Escherichia coli MS 69-1]
 gi|300397610|gb|EFJ81148.1| glutamyl-tRNA synthetase [Escherichia coli MS 69-1]
          Length = 471

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 249/487 (51%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T+    + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATQLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|153839089|ref|ZP_01991756.1| glutamyl-tRNA synthetase [Vibrio parahaemolyticus AQ3810]
 gi|149747427|gb|EDM58387.1| glutamyl-tRNA synthetase [Vibrio parahaemolyticus AQ3810]
          Length = 474

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/486 (31%), Positives = 249/486 (51%), Gaps = 20/486 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ ++
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKNQGGEFVLRIEDTDLERNSQEAVDAILEGME 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   V  LL +  A++C+ S E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTQRFDRYNEMVDKLLAEDKAYKCYASKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +      +++    V+R   P +GS VF+D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKA--ANEAAKDGDPCVIRFRNPKEGSVVFEDQIRGRIEIRNDQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINIYEALGAPVPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y  MGYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDMGYLPAALNNYLVRLGWS--HGDQEIFSQEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLS---TTEFLSRVSQWMKEKDRLT---QALTLA 360
           L+ +SK+ + F+  KL WLN  +I+              + Q   +          + L 
Sbjct: 291 LNAVSKSASAFNTDKLQWLNNHYIKNSDPAYVAEHLQWHLDQQKLDVTNGPALTDVIKLV 350

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  TL  L +   + ++       E+  +         D L+    + E I  W  EN
Sbjct: 351 GERCHTLVELAEQIRYFYEDFSEF--EAGAAKKHLRGVAKDPLEVALAKVEAITEWTTEN 408

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           +   + +V    E  +  I  PL +A+TG   S  +   + ++G+     R++ A+  ++
Sbjct: 409 LHQMIADVCAELEIGMGKIGMPLRVAVTGGGQSPSVDAVMALIGKERCVARIKMALEFIA 468

Query: 481 SLVQNH 486
               N 
Sbjct: 469 EREANA 474


>gi|228989296|ref|ZP_04149287.1| Glutamyl-tRNA synthetase [Bacillus pseudomycoides DSM 12442]
 gi|228995479|ref|ZP_04155147.1| Glutamyl-tRNA synthetase [Bacillus mycoides Rock3-17]
 gi|229003102|ref|ZP_04160952.1| Glutamyl-tRNA synthetase [Bacillus mycoides Rock1-4]
 gi|228758148|gb|EEM07343.1| Glutamyl-tRNA synthetase [Bacillus mycoides Rock1-4]
 gi|228764208|gb|EEM13087.1| Glutamyl-tRNA synthetase [Bacillus mycoides Rock3-17]
 gi|228770374|gb|EEM18947.1| Glutamyl-tRNA synthetase [Bacillus pseudomycoides DSM 12442]
          Length = 491

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 174/488 (35%), Positives = 272/488 (55%), Gaps = 16/488 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           I   +VRVR APSPTG  HIG A TALFNYL A+   GKFI+RIEDTD KR+    E + 
Sbjct: 6   IMEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIEDTDVKRNVAGGEESQ 65

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           ++ LKW G++WDEG D+GG YGPYRQ+ER +IY+   ++LLE+ LA++C+ + E LE  R
Sbjct: 66  LKYLKWLGMDWDEGVDVGGEYGPYRQTERLDIYKKLYEDLLERGLAYKCYMTEEELEAER 125

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RY G+   L+ ++I++   E +   +R  VP      F+D V  E+    
Sbjct: 126 EGQIARGETPRYAGNHRDLTEEQIKQFEAEGRIPSIRFRVPADRDYTFKDVVKDEVAFHS 185

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           N     V++K DG+PTY+ A  +DDHLM+ITHV RG++ IS+ PK +++Y+ F + IP+F
Sbjct: 186 NDFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNTPKQMMIYEAFGWDIPQF 245

Query: 242 IHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            H+ LI N  + KLSKR       I  Y A+GYLPEA+ NF+ALL       ++E+    
Sbjct: 246 GHMTLIVNESRKKLSKRDESIIQFIEQYQALGYLPEAIFNFIALLGWS-PVGEEEIFSKD 304

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WMK 348
           + I  FD   LSK+ A+FD QKL W+N ++++++         +               +
Sbjct: 305 EFIEMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDAVVALSLPHLVKAGRVSENLSEQ 364

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           E+  +   + L   +++  + + ++++  FK  +    E      L  E++ ++L+    
Sbjct: 365 EQVWVRGVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEG--QEVLKGEQVPEVLRAFAA 422

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
             E +   +   I+ A++ V +      K +  P+ +A TG  +   L ++I +LG+  V
Sbjct: 423 GLEALDEVEPAAIKKAIKAVQKETGHKGKNLFMPIRVATTGQTHGPELPNAIALLGKEKV 482

Query: 469 YFRLRHAI 476
             R+R  I
Sbjct: 483 LNRIRKVI 490


>gi|28897536|ref|NP_797141.1| glutamyl-tRNA synthetase [Vibrio parahaemolyticus RIMD 2210633]
 gi|260364597|ref|ZP_05777199.1| glutamate--tRNA ligase [Vibrio parahaemolyticus K5030]
 gi|260878298|ref|ZP_05890653.1| glutamate--tRNA ligase [Vibrio parahaemolyticus AN-5034]
 gi|260898128|ref|ZP_05906624.1| glutamate--tRNA ligase [Vibrio parahaemolyticus Peru-466]
 gi|260901939|ref|ZP_05910334.1| glutamate--tRNA ligase [Vibrio parahaemolyticus AQ4037]
 gi|32130092|sp|Q87RL6|SYE_VIBPA RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|28805748|dbj|BAC59025.1| glutamyl-tRNA synthetase [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086117|gb|EFO35812.1| glutamate--tRNA ligase [Vibrio parahaemolyticus Peru-466]
 gi|308090142|gb|EFO39837.1| glutamate--tRNA ligase [Vibrio parahaemolyticus AN-5034]
 gi|308106760|gb|EFO44300.1| glutamate--tRNA ligase [Vibrio parahaemolyticus AQ4037]
 gi|308115107|gb|EFO52647.1| glutamate--tRNA ligase [Vibrio parahaemolyticus K5030]
 gi|328473468|gb|EGF44316.1| glutamyl-tRNA synthetase [Vibrio parahaemolyticus 10329]
          Length = 474

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/486 (31%), Positives = 251/486 (51%), Gaps = 20/486 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ ++
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKNQGGEFVLRIEDTDLERNSQEAVDAILEGME 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   V  LL +  A++C+ S E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTQRFDRYNEMVDKLLAEDKAYKCYASKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +      +++    V+R   P +GS VF+D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKA--ANEAAKDGDPCVIRFRNPKEGSVVFEDQIRGRIEIRNDQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINIYEALGAPVPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y  MGYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDMGYLPAALNNYLVRLGWS--HGDQEIFSQEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLS---TTEFLSRVSQWMKEKDR---LTQALTLA 360
           L+ +SK+ + F+  KL WLN  +I+              + Q   +      +T  + L 
Sbjct: 291 LNAVSKSASAFNTDKLQWLNNHYIKNSDPAYVAEHLQWHLDQQKLDVTNGPAITDVIKLV 350

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  TL  L +   + ++       E+  +         + L+    + E I  W  EN
Sbjct: 351 GERCHTLVELAEQIRYFYEDFSEF--EAGAAKKHLRGVAKEPLEVALAKVEAITEWTTEN 408

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           +   + +V    E  +  I  PL +A+TG   S  +   + ++G+     R++ A+  ++
Sbjct: 409 LHQMIADVCAELEIGMGKIGMPLRVAVTGGGQSPSVDAVMALIGKERCVARIKMALEFIA 468

Query: 481 SLVQNH 486
               N 
Sbjct: 469 EREANA 474


>gi|294791949|ref|ZP_06757097.1| glutamate--tRNA ligase [Veillonella sp. 6_1_27]
 gi|294457179|gb|EFG25541.1| glutamate--tRNA ligase [Veillonella sp. 6_1_27]
          Length = 489

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 168/486 (34%), Positives = 256/486 (52%), Gaps = 16/486 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +SS KV  R APSPTG  HIG A +ALFN+L+A++  G F+LRIEDTD  RST ESE  +
Sbjct: 1   MSSMKV--RFAPSPTGPFHIGGARSALFNWLLARKEKGTFVLRIEDTDLARSTRESEENI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             SL+W G+NWDEG D+GG  GPYRQ+ER ++Y+   Q LL++  A+ C+C+ E L+ +R
Sbjct: 59  KASLQWLGMNWDEGIDVGGNNGPYRQTERLDLYKEVTQRLLDEGKAYECYCTPEELDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           + Q  R    +Y+GHC  L  +   +   E +K  +RL VP   +  F D V G +    
Sbjct: 119 QDQMDRGETPKYNGHCEHLDEETKAKYIAEGRKPTIRLRVPLNKTYAFDDMVRGHVSFES 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           N V   V++KSDG+P Y+ A V+DDH+M ITHV R EE +S+ P+ + +Y+   + +P+F
Sbjct: 179 NGVGDFVIVKSDGIPVYNFAVVMDDHMMGITHVIRAEEHLSNTPRQMAIYEALGWKVPKF 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+ LI   D  K+SKR   TS+  Y  +GYLPEAL+NFLALL     E ++E     +L
Sbjct: 239 GHISLILGKDYKKMSKRHGATSVEQYKQLGYLPEALVNFLALLG-WAPEGEEEFFTQDEL 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WMKEK 350
           I  F +  ++K  AVFD  KL+ +N  +++       F   +                + 
Sbjct: 298 IQAFSMDRVAKNPAVFDIDKLNHINFHYMKNLSDEELFHLCLPHLKEVGLAPDSLNQVDI 357

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTA--ESFKSTALCPEEIIDILKTTQE 408
           D LT   +  +  I+  + +           + L    E      L  E    +L   + 
Sbjct: 358 DWLTLLCSTFRDHISYGAQIKDHVGLFMGETVFLEEGHEEELRAVLNEETAPTVLGAFRN 417

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
               +     E ++  ++ V +      K +  P+ +A+TG  +   L + + +LG+   
Sbjct: 418 ALAELDEITPEVVKATIKAVMKETSLKGKFVFMPIRVALTGQMHGPDLNNIVTLLGKEKC 477

Query: 469 YFRLRH 474
             RL +
Sbjct: 478 LHRLDN 483


>gi|284993718|ref|YP_003415486.1| hypothetical protein LM5923_0278 [Listeria monocytogenes 08-5923]
 gi|284059185|gb|ADB70124.1| hypothetical protein LM5923_0278 [Listeria monocytogenes 08-5923]
          Length = 491

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/486 (35%), Positives = 269/486 (55%), Gaps = 14/486 (2%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNIADGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M +LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL+K LA++C+C+ E L+  
Sbjct: 61  QMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQELLDKDLAYKCYCTEEELDVE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK IL+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WM 347
           ++ I  FD   LSK+ A+FD  KL W+N +++++          +               
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVVELSLPHLQKAGVVSAELNQ 359

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
            E D + + ++L   +++  + +  +++  F     +T +  ++  L  E +  ++   +
Sbjct: 360 AELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEETAVLAEETVPTVISAFK 419

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           +E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LGR  
Sbjct: 420 KELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGREK 479

Query: 468 VYFRLR 473
           V  RL 
Sbjct: 480 VLNRLD 485


>gi|325123736|gb|ADY83259.1| glutamyl-tRNA synthetase [Acinetobacter calcoaceticus PHEA-2]
          Length = 502

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 227/483 (46%), Positives = 305/483 (63%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAFYCFATAEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKLS +E+ R  +  + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLSQEEVTRRLEAGEPHVIRMKVPEEGICKFNDLLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPKHQLLYQYFGWEMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +Q ++ +F
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDERE-VFTLQDMMDNF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+      + L R+  W  ++  L       Q RI 
Sbjct: 301 DIQRVSLGGPIFDVEKLNWLNGQWIKGLTPG-QLLDRLLTWKSDRSTLEDIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F     +TAE F+S  L  E++   L+      E    W  + +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQFAIWRLEGQFTWNNDTVSQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A      L+  +   F+AI GS  S P+  S+  LG  + + RLRHA+ +V    + 
Sbjct: 420 MDLANQMGIKLRDFMPAFFIAIAGSTSSTPVMQSMVTLGPDLTFARLRHALEIVGGPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 EVK 482


>gi|293410803|ref|ZP_06654379.1| glutamyl-tRNA synthetase [Escherichia coli B354]
 gi|293415677|ref|ZP_06658320.1| glutamyl-tRNA synthetase [Escherichia coli B185]
 gi|331653831|ref|ZP_08354832.1| glutamate--tRNA ligase [Escherichia coli M718]
 gi|291433325|gb|EFF06304.1| glutamyl-tRNA synthetase [Escherichia coli B185]
 gi|291471271|gb|EFF13755.1| glutamyl-tRNA synthetase [Escherichia coli B354]
 gi|320180395|gb|EFW55326.1| glutamyl-tRNA synthetase [Shigella boydii ATCC 9905]
 gi|331048680|gb|EGI20756.1| glutamate--tRNA ligase [Escherichia coli M718]
 gi|332088198|gb|EGI93320.1| glutamyl-tRNA synthetase [Shigella boydii 5216-82]
 gi|332089687|gb|EGI94788.1| glutamyl-tRNA synthetase [Shigella dysenteriae 155-74]
          Length = 471

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|222530218|ref|YP_002574100.1| glutamyl-tRNA synthetase [Caldicellulosiruptor bescii DSM 6725]
 gi|222457065|gb|ACM61327.1| glutamyl-tRNA synthetase [Caldicellulosiruptor bescii DSM 6725]
          Length = 485

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 183/480 (38%), Positives = 268/480 (55%), Gaps = 15/480 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           +VR R APSPTG  HIG A TALFNYL AKR  GKFILRIEDTD +RS++ESE  +++SL
Sbjct: 2   EVRTRFAPSPTGHLHIGGARTALFNYLFAKRYAGKFILRIEDTDLERSSIESEKVIIESL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W G+ WDEG ++GG YGPYR +ER +IY+ YV  L EK  A+ C+C+ E LE  R+   
Sbjct: 62  RWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAYYCYCTEEELEAQRQELL 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RY G C  L+ ++  R  QE +K  VR  VP     V  D V G++E   + + 
Sbjct: 122 SKGQMPRYLGKCRNLTEEQKRRFEQEGRKPTVRFKVPEGVKIVVHDLVRGDVEFLSDDIG 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V++KSDG+PTY+ A VIDDHLMKI+HV RGEE +S+ P+ IL+Y    F +P+F H+ 
Sbjct: 182 DFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALGFGLPQFAHVS 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           LI   D++K+SKR   T +  Y   GYL E LINFLALL     ED + + DM+ LI +F
Sbjct: 242 LILGKDRTKMSKRHGSTWVEQYKEQGYLKEGLINFLALLGWSPPEDKE-IFDMKYLIENF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------EKDRL 353
            L  +SK  A+FD  KL+++N + I+   S  E       +              + + L
Sbjct: 301 SLERVSKNPAIFDIDKLNYINSQHIKL-KSLDELTQMCIPYFVEAGYIKEDEAKSKFEWL 359

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
            + +      +  LS +    D  F +++ +  E      L  + + D++   + +   +
Sbjct: 360 KKIVKSVYEGLDYLSQIKDRVDIFFNNEVKI-EEDEAKEVLKWDHVNDLINVFENKIRQM 418

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
                E I+   + + +      K +  P+ +A+TG  +   L + IEI+G+  +  RL 
Sbjct: 419 NELTPEAIKLLFKEIQKETGYKGKNLFMPIRVALTGKTHGPELVEIIEIVGKENILKRLE 478


>gi|170679600|ref|YP_001744592.1| glutamyl-tRNA synthetase [Escherichia coli SMS-3-5]
 gi|238688869|sp|B1LMJ5|SYE_ECOSM RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|170517318|gb|ACB15496.1| glutamyl-tRNA synthetase [Escherichia coli SMS-3-5]
          Length = 471

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 157/487 (32%), Positives = 249/487 (51%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQTCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|262166296|ref|ZP_06034033.1| glutamyl-tRNA synthetase [Vibrio mimicus VM223]
 gi|262026012|gb|EEY44680.1| glutamyl-tRNA synthetase [Vibrio mimicus VM223]
          Length = 474

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKAVNEAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 173 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L  +SK+ + F+  KL WLN  +I+   S  E++++  +W  +   + +         + 
Sbjct: 291 LGAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFDHQGINKATGPALAEVVK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 349 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+A 
Sbjct: 407 EALHQVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALAY 466

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 467 IETREANA 474


>gi|320185095|gb|EFW59875.1| glutamyl-tRNA synthetase [Shigella flexneri CDC 796-83]
          Length = 471

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 157/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVLDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +GR+    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGRTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|262280355|ref|ZP_06058139.1| glutamyl-tRNA synthetase [Acinetobacter calcoaceticus RUH2202]
 gi|262258133|gb|EEY76867.1| glutamyl-tRNA synthetase [Acinetobacter calcoaceticus RUH2202]
          Length = 502

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 226/483 (46%), Positives = 305/483 (63%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELIEKGHAFYCFATAEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKLS +E+ R  +  + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLSQEEVTRRLESGEPHVIRMKVPEEGICKFNDLLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKNDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPKHQLLYQYFGWEMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +Q ++ +F
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDEKE-VFTLQDMMDNF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+      + L R+  W  ++  L       Q RI 
Sbjct: 301 DIQRVSLGGPIFDVEKLNWLNGQWIKGLTPG-QLLDRLLTWKSDRSTLEDIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F     +TAE F+S  L  E++   L+      E    W  + +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQFAIWRLEGQFTWNNDTVSQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A   +  L+  +   F+AI GS  S P+  S+  LG  + + RLR A+ +V    + 
Sbjct: 420 MDLANQMDIKLRDFMPAFFIAIAGSTSSTPVMQSMVTLGPDLTFARLRRALEIVGGPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 EVK 482


>gi|167039498|ref|YP_001662483.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X514]
 gi|300915252|ref|ZP_07132567.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X561]
 gi|307725176|ref|YP_003904927.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X513]
 gi|238687612|sp|B0K5F4|SYE1_THEPX RecName: Full=Glutamyl-tRNA synthetase 1; AltName:
           Full=Glutamate--tRNA ligase 1; Short=GluRS 1
 gi|166853738|gb|ABY92147.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X514]
 gi|300888976|gb|EFK84123.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X561]
 gi|307582237|gb|ADN55636.1| glutamyl-tRNA synthetase [Thermoanaerobacter sp. X513]
          Length = 485

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 180/485 (37%), Positives = 271/485 (55%), Gaps = 16/485 (3%)

Query: 8   RVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKW 67
           RVR APSPTG  HIG   TALFNYL ++  G  F+LRIEDTD +RS+ E E  + + L+W
Sbjct: 5   RVRFAPSPTGAIHIGNIRTALFNYLFSRSEGATFVLRIEDTDLERSSKEFEELIFKELEW 64

Query: 68  CGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKR 127
            G+ WDEGPD  G YGPYRQSER  IY  + Q L+E+K A+RC+C+ E LEE RR   +R
Sbjct: 65  LGIEWDEGPDKPGPYGPYRQSERLEIYHKFAQKLIEEKKAYRCYCTPEELEEDRRKAVER 124

Query: 128 NIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQ 187
               RY G C  L+ ++ E   +E +K V+R  +P+     F+D + G++ I  + +   
Sbjct: 125 GDIPRYSGRCRYLTKEQEEAFIREGRKPVIRFIIPDDEVIEFEDMIKGKITIKSDTLGGD 184

Query: 188 V-LLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           + ++KSDGMPTY+ A VIDD LMKITHV RGE+ I + PK IL+Y+   F IP+F H PL
Sbjct: 185 MVIVKSDGMPTYNFAVVIDDALMKITHVIRGEDHIYNTPKQILIYKALGFEIPKFAHAPL 244

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD++KLSKR   T I  Y  +GYLPEA+ NFL+LL     ++ + +M  +++I  F+
Sbjct: 245 ILGPDRTKLSKRHGNTYIGQYRELGYLPEAMFNFLSLLSWSPEDNVE-IMSKEEIIKKFN 303

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-----------MKEKDRLTQ 355
              +  A  VFD +KL+W+N ++I++  S    +                     + L  
Sbjct: 304 FRRIHSANPVFDIEKLNWMNQQYIQK-SSIERIVDLAIPHLRRAGYIDGIDDMVYNWLKD 362

Query: 356 ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
            ++L +  +  ++ + +     F  ++  + E+ K   L       +L+  ++  E    
Sbjct: 363 VISLYKDGLQYVAQITEKAKMFFVEEVEYSDETVK--ILNSPNSKIVLEVVKKVIEEADE 420

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA 475
              E ++  L+ + +  +   K    P+ +AITG  +   L   I +LG+  V  RL+ A
Sbjct: 421 ITEEYVKDLLKKLQKETKVKGKEFFMPIRVAITGEDHGPELVKIIPLLGKDKVINRLKKA 480

Query: 476 IALVS 480
           I L+ 
Sbjct: 481 INLIK 485


>gi|332534868|ref|ZP_08410690.1| glutamyl-tRNA synthetase [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035667|gb|EGI72156.1| glutamyl-tRNA synthetase [Pseudoalteromonas haloplanktis ANT/505]
          Length = 494

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 210/482 (43%), Positives = 302/482 (62%), Gaps = 2/482 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           +R R+APSPTG+PH+GTAY ALFNY  AK+ GG+F+LRIEDTD  RST ESE A+M SL+
Sbjct: 3   IRTRVAPSPTGDPHLGTAYIALFNYCFAKQQGGEFVLRIEDTDQVRSTPESELAIMDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WD GPD+GG +GPYRQSER ++Y+ Y   L++   AF CF ++E L++MR  Q  
Sbjct: 63  WLGLEWDHGPDVGGEFGPYRQSERSDLYKKYAHQLVDDGKAFYCFATSEELDQMREEQMA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
             +  +YDG  L  + +EI+      K +V+R+ +P++G+  F D +  E+EIPW  VDM
Sbjct: 123 EGLRPKYDGRGLNHTDEEIKANLAAGKPYVIRMKIPSEGTFKFNDYLRDEIEIPWENVDM 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVLLK+DG PTY LANV+DDH M+I+H+ RGEEWI+S PK + LY+ F +  P   HLPL
Sbjct: 183 QVLLKADGFPTYFLANVVDDHHMQISHIFRGEEWINSAPKLLKLYEDFGWEAPVLGHLPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  MGYLPEA++N+L  +     ++ ++   + ++I +FD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYKEMGYLPEAVLNYLGRMGWSMPDEREK-FTLNEMIENFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD  KL WLNG WIRE L+  + + R   W    + L + L  A++RI T
Sbjct: 302 MKRVSLGGPVFDVDKLSWLNGMWIRENLTDEQLIQRFVDWKFNGEMLAKVLPEAKTRINT 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS + ++                 +       I   L+    + E ++ + +  I    +
Sbjct: 362 LSDMVELAGHFVGGIPTYDPALLTAGKADENVIRQALQFFVWQLEGLRSFDKPAIFAIAK 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            VA   E  +K  ++P+F+AITG   S  + D++EILG  +   RLR A+A +  + +  
Sbjct: 422 EVATFHELKIKDFLEPIFVAITGKTSSTSVLDAMEILGSDLSRARLRVALAHLG-ISKKQ 480

Query: 487 KK 488
            K
Sbjct: 481 AK 482


>gi|126668112|ref|ZP_01739074.1| glutamyl-tRNA synthetase [Marinobacter sp. ELB17]
 gi|126627382|gb|EAZ98017.1| glutamyl-tRNA synthetase [Marinobacter sp. ELB17]
          Length = 495

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 216/477 (45%), Positives = 309/477 (64%), Gaps = 2/477 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR RIAPSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST ESE  ++ +L+
Sbjct: 4   VRTRIAPSPTGDPHVGTAYVALFNLCFARQHGGQFILRIEDTDQARSTPESEQEILTALR 63

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GLNWDEGPD+GG +GPYRQSERK+ Y  Y ++L+    AF CF + E L+ +R  ++ 
Sbjct: 64  WLGLNWDEGPDVGGPHGPYRQSERKDSYAQYAEDLVTAGHAFYCFRTPEELDVIREERKA 123

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
             +     G+ L+LS +E+ R  +    +V+R+ VP+ G C   D + G +EI W  VD 
Sbjct: 124 AGLNPGIKGN-LELSPEEVHRRREAGDAYVIRMKVPDDGVCEVVDMLRGTIEIDWAQVDC 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           Q+LLKSDGMPTYHLANV+DDHLM+ITHV RGEEWI+S PKH LLY+YF + +P   HLPL
Sbjct: 183 QILLKSDGMPTYHLANVVDDHLMEITHVLRGEEWINSAPKHKLLYEYFGWDMPVLCHLPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI++Y  MG+LPEA+ N+L  +     ++ ++   + ++I  FD
Sbjct: 243 LRNPDKSKLSKRKNPTSINFYERMGFLPEAVTNYLGRMGWSMPDEREK-FTLDEMISDFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD +KL WLNG W+RE+LS  +FL R+SQW   ++ L   +   + R   
Sbjct: 302 IQRVSLGGPVFDVEKLRWLNGLWLREELSDEQFLQRMSQWWFNQNDLAALVPFVKGRADV 361

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
            S +  +  F+F   L LT ESF    L   ++  +L+ T  + E  + W ++NI   ++
Sbjct: 362 FSDVAPIAQFMFSGMLPLTPESFAHNKLEEGQVKRVLQFTLWQLEAQRHWSKDNIFADVK 421

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLV 483
            +A+  +  +   +  +F+AI G+  S  + DS+E LG  +   RLRH + ++    
Sbjct: 422 FLAKAMDLKMGDFMFAVFVAIAGTPNSWSVMDSMEQLGPDMTRARLRHGLEILGGFS 478


>gi|205372091|ref|ZP_03224908.1| glutamyl-tRNA synthetase [Bacillus coahuilensis m4-4]
          Length = 484

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 172/488 (35%), Positives = 270/488 (55%), Gaps = 18/488 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VRVR APSPTG  HIG A TALFNYL A+   GKFI+RIEDTD KR+    E + +Q
Sbjct: 1   MSEVRVRYAPSPTGHLHIGNARTALFNYLYARHHDGKFIIRIEDTDKKRNIEGGEESQLQ 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            L+W G++WDE  D  G +GPYRQSER +IY+   + L+ +  A+ C+C+ E LE  R A
Sbjct: 61  YLQWLGIDWDESVDKDGGFGPYRQSERNHIYKELYEQLVREGKAYYCYCTEEELEAEREA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q+      RY G C  L++++ ERL  E ++  +R  VP      F D V  E+    + 
Sbjct: 121 QQAAGQMPRYSGKCRHLTTEDRERLEAEGRQPSIRFAVPAGKVYRFDDMVKEEVAFESDG 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +   V++K DG PTY+ A  +DDHLMKI+H+ RG++ IS+ PK +++Y+ F +  P F H
Sbjct: 181 IGDFVIVKKDGTPTYNFAVAVDDHLMKISHILRGDDHISNTPKQMMIYEAFGWQAPVFGH 240

Query: 244 LPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           + LI N  + KLSKR       I  Y+ +GYLPEAL NF+ LL     + ++E+    + 
Sbjct: 241 MTLIVNESRKKLSKRDESIIQFIEQYAGLGYLPEALFNFIGLLGWS-PKGEEEIFSKDEF 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKE 349
           I  FD   LS + AVFD  KL W+N ++++  LS  E                      E
Sbjct: 300 ISIFDAERLSTSPAVFDTNKLAWMNNQYMKN-LSLDEVAELSLPHLIKAGKLEENPSETE 358

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
            +     ++L Q +++  + + ++++  FK+D+    E+     L  E++ ++++  +E+
Sbjct: 359 LEWAKGVISLYQEQMSYGAEIVELSEMFFKNDIEYNEEA--KAVLAEEQVPEVMRVFKEK 416

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E +       I+ A++ V +      K +  P+ +A+TG  +   L ++I +LG+  V 
Sbjct: 417 VEALTELDPAAIKAAIKEVQKETGHKGKKLFMPIRVAVTGQTHGPELPNAIALLGKEKVT 476

Query: 470 FRLRHAIA 477
            RL   ++
Sbjct: 477 LRLSSVLS 484


>gi|124516619|gb|EAY58127.1| Glutamyl-tRNA synthetase [Leptospirillum rubarum]
          Length = 474

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 161/491 (32%), Positives = 256/491 (52%), Gaps = 30/491 (6%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++ + +RVR APSPTG  H+G A TALFNYL A+   G F+LRIEDTD +RST ES  A+
Sbjct: 1   MTDAPIRVRFAPSPTGHLHLGGARTALFNYLFARHHHGTFVLRIEDTDRERSTKESIQAI 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
              L+W  ++WDEG        P+ QSER + Y+    +LLE   A+RCFC+ + LE  R
Sbjct: 61  FNGLEWLSIDWDEG--------PFYQSERLDKYKAVSDSLLESGKAYRCFCTPQELETRR 112

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           +    +  P +YDG C         R  Q Q  +V+R   P     + +D + G +    
Sbjct: 113 QEALAKGQPPKYDGRCRS-------RNDQPQGPYVIRFKNPEIPEILVEDMIRGSLSFNG 165

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           N +D  VL++SDG PTY+ A V+DD  M I+HV RG++ I++ P+ I L+Q     +P+F
Sbjct: 166 NLLDDWVLVRSDGYPTYNFAVVVDDIDMNISHVIRGDDHINNTPRQITLFQALGASLPKF 225

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+P+I   D++KLSKR   TS+  Y  MGYLP AL+N++A L       D E+   ++L
Sbjct: 226 AHIPMIHGSDRAKLSKRHGATSVMAYKDMGYLPHALVNYIARLGWS--HKDQEVFTKEEL 283

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTE-----------FLSRVSQWMKEK 350
           I  FDL  +  + A+F+ +KL WLN ++++   S                    +     
Sbjct: 284 IQFFDLDKVGSSPAIFNTEKLLWLNAQYMKNTPSDELSDLVKPFLKPVLHPIEYEAPDSP 343

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
             L++ + + +SR  TL  L          D   + +         +  + +L+  ++ F
Sbjct: 344 PTLSEIIEVWKSRSRTLQDLADSVYPFMDRDFSYSEDVLSKH--LTKTSVPLLQAFKDRF 401

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
           E +  W + ++E  +  + +     L  + +PL  A+TG   S  ++D + +LGR  V  
Sbjct: 402 EHLSQWDKPSLEHVIHELGEEFGLKLSQLAQPLRAALTGQSVSPGIYDVLLLLGRLEVKQ 461

Query: 471 RLRHAIALVSS 481
           R+++A++    
Sbjct: 462 RIQNALSKAGG 472


>gi|324112915|gb|EGC06891.1| glutamyl-tRNA synthetase [Escherichia fergusonii B253]
          Length = 471

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|93007205|ref|YP_581642.1| glutamyl-tRNA synthetase [Psychrobacter cryohalolentis K5]
 gi|122989806|sp|Q1Q845|SYE_PSYCK RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|92394883|gb|ABE76158.1| glutamyl-tRNA synthetase [Psychrobacter cryohalolentis K5]
          Length = 509

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 231/485 (47%), Positives = 319/485 (65%), Gaps = 9/485 (1%)

Query: 1   MISSS-------KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRS 53
           M+  S        VR RIAPSPTG PH+GTAY ALFN   AK  GG+FILRIEDTD  RS
Sbjct: 1   MMQPSTSTNSIRPVRTRIAPSPTGFPHVGTAYIALFNLAFAKAHGGEFILRIEDTDQTRS 60

Query: 54  TLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCS 113
           T +SE  ++ +L+W GL+W EGPDIGG + PYRQSER +IY+ + + L+E   AFRCFCS
Sbjct: 61  TEQSEKMILDALRWVGLDWAEGPDIGGPHAPYRQSERSDIYKKHAEQLIENDHAFRCFCS 120

Query: 114 TERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKV 173
           +E L+ MR  Q       RYDG C  L++++ E+L  E K HV+R+ VP +G C  QD +
Sbjct: 121 SEELDAMRAEQMANGETPRYDGRCAHLAAEKTEQLVAEGKPHVIRMRVPTEGVCQVQDML 180

Query: 174 YGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQY 233
            G +EIPW  VDMQVLLK+DGMPTYHLANV+DDHLM I+HV RGEEW++S PKH LLY+Y
Sbjct: 181 RGTVEIPWTQVDMQVLLKTDGMPTYHLANVVDDHLMDISHVMRGEEWLNSAPKHQLLYEY 240

Query: 234 FNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDD 293
           F + +P   H+PL++NPDKSKLSKR+NPTSI+YY   G LPEAL+N+L  +     ++ +
Sbjct: 241 FGWEMPVLCHMPLLRNPDKSKLSKRKNPTSITYYRDAGVLPEALLNYLGRMGYSMPDEAE 300

Query: 294 ELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRL 353
               ++++I  FD+  +S  G +FD +KL+WLN  W+R  L+  E  +++ +W    D+L
Sbjct: 301 -QFTLEEMIASFDIQRVSLGGPIFDIEKLNWLNSEWLRA-LTPEELKNKILEWASNSDKL 358

Query: 354 TQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVI 413
           T      Q RI  LS     + F F++   + AESF   +L PE+I+D+L+ +  + EV+
Sbjct: 359 TAIAAAIQPRIELLSDAVNWSGFYFQNLPDINAESFTHKSLTPEQIMDMLQLSLWQLEVL 418

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
             W  ENI   L+ +A H +  ++  + P F+AI GS  S P+ +S+ I+G  +   RLR
Sbjct: 419 PTWSEENIYATLKGLAAHLDIKMRDFMAPFFIAIAGSTSSTPVMNSMAIIGADMTLTRLR 478

Query: 474 HAIAL 478
           HA+ +
Sbjct: 479 HAVDV 483


>gi|169632236|ref|YP_001705972.1| glutamyl-tRNA synthetase [Acinetobacter baumannii SDF]
 gi|238688147|sp|B0VPF6|SYE_ACIBS RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|169151028|emb|CAO99674.1| glutamyl-tRNA synthetase [Acinetobacter baumannii]
          Length = 502

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 227/483 (46%), Positives = 306/483 (63%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAFYCFATAEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKLS +E+ R  +  + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLSQEEVARRLEAGEPHVIRMKVPEEGVCKFNDLLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPKHQLLYQYFGWEMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +Q ++ +F
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDERE-VFTLQDMMDNF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+      + L R+  W  ++  L       Q RI 
Sbjct: 301 DIQRVSLGGPIFDVEKLNWLNGQWIKGLTPG-QLLDRLLTWKSDRSTLEDIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F     +TAE F+S  L  E++   L+      E    W  + +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQFAIWRLESQFTWNNDTVGQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A      L+  +   F+AI GS  S P+  S+  LG  + + RLRHA+ +V +  + 
Sbjct: 420 MDLANQMGIKLRDFMPTFFIAIAGSTSSTPVMQSMVTLGPDLTFARLRHALEIVGAPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 EVK 482


>gi|170718923|ref|YP_001784092.1| glutamyl-tRNA synthetase [Haemophilus somnus 2336]
 gi|189082158|sp|B0USJ3|SYE_HAES2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|168827052|gb|ACA32423.1| glutamyl-tRNA synthetase [Haemophilus somnus 2336]
          Length = 480

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 159/482 (32%), Positives = 251/482 (52%), Gaps = 24/482 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
           ++KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++
Sbjct: 12  NTKVRTRFAPSPTGYLHVGGARTALYSWLYAKHNQGEFVLRIEDTDLERSTPEATAAILE 71

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            ++W  L W         +GPY Q++R   Y   +  ++E+ LA+RC+C+ ERLE++R +
Sbjct: 72  GMEWLNLAW--------EHGPYFQTKRFERYNQVIDQMIEQGLAYRCYCTKERLEDLRHS 123

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q +     RYD +CL  S   ++        HVVR   P +G+ VF D V G +EI    
Sbjct: 124 QEQNKQKPRYDRYCLHQSEYPVDA------PHVVRFKNPTEGTVVFDDAVRGRIEISNRE 177

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H
Sbjct: 178 LDDLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAH 237

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I 
Sbjct: 238 VSMINGDDGQKLSKRHGAVSVMQYRDEGYLPEALINYLVRLGWG--HGDQEIFSREEMIA 295

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKL------STTEFLSRVSQWMKEKDRLTQAL 357
            FD+H +SK+ + F+ +KL WLN  +IR              + +          L + +
Sbjct: 296 LFDIHSVSKSASAFNTEKLQWLNQHYIRSLPVEQVATHLEWHMKKHGIDYSNGPNLAEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++   +   ++         E I  L    E+   +  W 
Sbjct: 356 PVLSERCKTLKELAISSRYFYQDVENYDEKAVAKNF--KPEAIKPLAKLAEKLTALSDWT 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            ENI   +   AQ  +  +  +  P  LA+TG   S  +  + +++G+     R+ +AIA
Sbjct: 414 VENIHEVMSQTAQELDIGMGKVGMPFRLAVTGLGQSPSMDITAKLVGKDRTISRINNAIA 473

Query: 478 LV 479
            +
Sbjct: 474 FI 475


>gi|262170811|ref|ZP_06038489.1| glutamyl-tRNA synthetase [Vibrio mimicus MB-451]
 gi|261891887|gb|EEY37873.1| glutamyl-tRNA synthetase [Vibrio mimicus MB-451]
          Length = 474

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 154/488 (31%), Positives = 254/488 (52%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+  + +   ++E +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKI--KTVNEAAKEGEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 173 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L  +SK+ + F+  KL WLN  +I+   S  E++++  +W  +   + +         + 
Sbjct: 291 LGAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFDHQGINKATGPALAEVVK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 349 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+A 
Sbjct: 407 EALHQVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALAY 466

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 467 IETREANA 474


>gi|207857832|ref|YP_002244483.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|238690457|sp|B5R3U6|SYE_SALEP RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|206709635|emb|CAR33985.1| Glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 471

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 245/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERLE++R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLEQLREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SYEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSAITDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|148264346|ref|YP_001231052.1| glutamyl-tRNA synthetase [Geobacter uraniireducens Rf4]
 gi|189082156|sp|A5G3W1|SYE_GEOUR RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|146397846|gb|ABQ26479.1| glutamyl-tRNA synthetase [Geobacter uraniireducens Rf4]
          Length = 467

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 161/482 (33%), Positives = 251/482 (52%), Gaps = 24/482 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            ++VR+R APSPTG  H+G A TALFN+L+A++  G FILRIEDTD  RST ES +A++Q
Sbjct: 1   MTEVRLRFAPSPTGYLHVGGARTALFNWLLARKQKGTFILRIEDTDVARSTQESVDAILQ 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            ++W GL+WDEG        PY QS+R  +Y+ +VQ LL+   A++C+C+ E LE  R  
Sbjct: 61  GMEWLGLDWDEG--------PYYQSDRFPVYKEFVQKLLDSGKAYKCYCTPEELEAKREQ 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
                   +YDG C +             K HVVR   P++G   F D + G +    + 
Sbjct: 113 ALMDGRKPKYDGTCRE------LAGDVPGKPHVVRFRAPHEGVTAFDDLIKGRIAFNNDE 166

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  ++ +SDG PTY+   VIDD  M IT V RG++ +++ P+ ILLY+   +P+P F H
Sbjct: 167 LDDLIIQRSDGTPTYNFVVVIDDATMGITTVIRGDDHVNNTPRQILLYEALGYPVPHFAH 226

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +P+I   DK++LSKR   T +  Y  MGYLPEAL+N+L  L       D+E+   + LI 
Sbjct: 227 VPMILGADKARLSKRHGATGVMAYRDMGYLPEALVNYLVRLGWS--FGDEEIFSKEDLIE 284

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLST------TEFLSRVSQWMKEKDRLTQAL 357
            F +  + ++  VF+  KL WLN  +I+    +        FL            L   +
Sbjct: 285 KFSIEQVGRSAGVFNPDKLLWLNAHYIKTGDPSRLAGLLVPFLRERGVDPTGGPDLVAVV 344

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
              Q R  TL  +     F F+ D     ++ +       E+  + +    +F     + 
Sbjct: 345 KTLQERSRTLLEMADGALFYFRRDFSYDEKAVEK--FLTPEVSPLYELLIAKFASSADFT 402

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            ++IE   + + + +   L  + +P  +A+ G   +  +F+ +E+LG+     RL  A+A
Sbjct: 403 HQSIEQIFKEICEEKGLKLGQVAQPARIALCGGTVAPSIFEVMEVLGKEETNLRLEKALA 462

Query: 478 LV 479
            V
Sbjct: 463 FV 464


>gi|168465864|ref|ZP_02699734.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195631485|gb|EDX50045.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 471

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 154/487 (31%), Positives = 245/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERL+++R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLDQLREDQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSAITDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|15923518|ref|NP_371052.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu50]
 gi|15926205|ref|NP_373738.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus N315]
 gi|21282212|ref|NP_645300.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2]
 gi|49485392|ref|YP_042613.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|87161223|ref|YP_493216.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194290|ref|YP_499082.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148266987|ref|YP_001245930.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH9]
 gi|150393034|ref|YP_001315709.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1]
 gi|156978856|ref|YP_001441115.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3]
 gi|161508767|ref|YP_001574426.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141036|ref|ZP_03565529.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253315637|ref|ZP_04838850.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253731132|ref|ZP_04865297.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253732535|ref|ZP_04866700.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255005321|ref|ZP_05143922.2| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257795374|ref|ZP_05644353.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9781]
 gi|258408939|ref|ZP_05681220.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9763]
 gi|258420424|ref|ZP_05683367.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9719]
 gi|258439344|ref|ZP_05690276.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9299]
 gi|258444084|ref|ZP_05692421.1| glutamyl-tRNA synthetase [Staphylococcus aureus A8115]
 gi|258446352|ref|ZP_05694510.1| glutamyl-tRNA synthetase [Staphylococcus aureus A6300]
 gi|258448445|ref|ZP_05696560.1| glutamyl-tRNA synthetase/glutamate-tRNA(Gln) ligase [Staphylococcus
           aureus A6224]
 gi|258452740|ref|ZP_05700738.1| glutamyl-tRNA synthetase [Staphylococcus aureus A5948]
 gi|258453801|ref|ZP_05701775.1| glutamyl-tRNA synthetase [Staphylococcus aureus A5937]
 gi|262049570|ref|ZP_06022439.1| glutamyl-tRNA synthetase [Staphylococcus aureus D30]
 gi|262052416|ref|ZP_06024616.1| glutamyl-tRNA synthetase [Staphylococcus aureus 930918-3]
 gi|269202150|ref|YP_003281419.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus ED98]
 gi|282894961|ref|ZP_06303184.1| glutamyl-tRNA synthetase [Staphylococcus aureus A8117]
 gi|282924441|ref|ZP_06332113.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9765]
 gi|282928864|ref|ZP_06336455.1| glutamyl-tRNA synthetase [Staphylococcus aureus A10102]
 gi|284023537|ref|ZP_06377935.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus 132]
 gi|294850303|ref|ZP_06791037.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9754]
 gi|295406904|ref|ZP_06816707.1| glutamyl-tRNA synthetase [Staphylococcus aureus A8819]
 gi|296275773|ref|ZP_06858280.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MR1]
 gi|297246272|ref|ZP_06930121.1| glutamyl-tRNA synthetase [Staphylococcus aureus A8796]
 gi|54039656|sp|P67022|SYE_STAAW RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|54039658|sp|P99170|SYE_STAAN RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|54042027|sp|P67021|SYE_STAAM RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|56749396|sp|Q6GBW0|SYE_STAAS RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|118595557|sp|Q2FJB2|SYE_STAA3 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|123291868|sp|Q2G241|SYE_STAA8 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|166226857|sp|A7WYU4|SYE_STAA1 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|189082170|sp|A6TZ04|SYE_STAA2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|189082171|sp|A5IQ81|SYE_STAA9 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|189082172|sp|A8YZM5|SYE_STAAT RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|13700418|dbj|BAB41716.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus N315]
 gi|14246296|dbj|BAB56690.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu50]
 gi|21203648|dbj|BAB94348.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus MW2]
 gi|49243835|emb|CAG42260.1| putative glutamyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|87127197|gb|ABD21711.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87201848|gb|ABD29658.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|147740056|gb|ABQ48354.1| glutamyl-tRNA synthetase / glutamate--tRNA(Gln) ligase
           [Staphylococcus aureus subsp. aureus JH9]
 gi|149945486|gb|ABR51422.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus JH1]
 gi|156720991|dbj|BAF77408.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus Mu3]
 gi|160367576|gb|ABX28547.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253725097|gb|EES93826.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253729464|gb|EES98193.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257789346|gb|EEV27686.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9781]
 gi|257840290|gb|EEV64753.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9763]
 gi|257843614|gb|EEV68020.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9719]
 gi|257847681|gb|EEV71680.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9299]
 gi|257850754|gb|EEV74699.1| glutamyl-tRNA synthetase [Staphylococcus aureus A8115]
 gi|257854946|gb|EEV77891.1| glutamyl-tRNA synthetase [Staphylococcus aureus A6300]
 gi|257858314|gb|EEV81201.1| glutamyl-tRNA synthetase/glutamate-tRNA(Gln) ligase [Staphylococcus
           aureus A6224]
 gi|257859613|gb|EEV82463.1| glutamyl-tRNA synthetase [Staphylococcus aureus A5948]
 gi|257864057|gb|EEV86811.1| glutamyl-tRNA synthetase [Staphylococcus aureus A5937]
 gi|259159662|gb|EEW44706.1| glutamyl-tRNA synthetase [Staphylococcus aureus 930918-3]
 gi|259162310|gb|EEW46883.1| glutamyl-tRNA synthetase [Staphylococcus aureus D30]
 gi|262074440|gb|ACY10413.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus ED98]
 gi|269940100|emb|CBI48476.1| putative glutamyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282589472|gb|EFB94561.1| glutamyl-tRNA synthetase [Staphylococcus aureus A10102]
 gi|282592852|gb|EFB97856.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9765]
 gi|282762643|gb|EFC02780.1| glutamyl-tRNA synthetase [Staphylococcus aureus A8117]
 gi|285816227|gb|ADC36714.1| Glutamyl-tRNA synthetase; Glutamyl-tRNA(Gln) synthetase
           [Staphylococcus aureus 04-02981]
 gi|294822815|gb|EFG39250.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9754]
 gi|294968135|gb|EFG44161.1| glutamyl-tRNA synthetase [Staphylococcus aureus A8819]
 gi|297176870|gb|EFH36128.1| glutamyl-tRNA synthetase [Staphylococcus aureus A8796]
 gi|302750419|gb|ADL64596.1| putative glutamyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|312829023|emb|CBX33865.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus ECT-R
           2]
 gi|315128820|gb|EFT84819.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus CGS03]
 gi|315196661|gb|EFU27008.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus CGS01]
 gi|320141764|gb|EFW33592.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|329313248|gb|AEB87661.1| Glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329727916|gb|EGG64365.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus 21172]
 gi|329731018|gb|EGG67391.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus 21189]
 gi|329731959|gb|EGG68315.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus 21193]
          Length = 484

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 267/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTD KR+  + E +  
Sbjct: 1   MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER++IYQP +  LL +  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V G +    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ IS+ PK I++Y+ F +  P F 
Sbjct: 181 GIGDWVIVKKDGIPTYNFAVAIDDHYMQISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +               ++
Sbjct: 300 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + + L Q  ++    +  +++  FK    L  E  +   +  E++ +++     +
Sbjct: 360 LSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEE--EQQVINGEQVPELMTHLFSK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 NRLKQ 482


>gi|254230149|ref|ZP_04923544.1| glutamyl-tRNA synthetase [Vibrio sp. Ex25]
 gi|262394953|ref|YP_003286807.1| glutamyl-tRNA synthetase [Vibrio sp. Ex25]
 gi|151937342|gb|EDN56205.1| glutamyl-tRNA synthetase [Vibrio sp. Ex25]
 gi|262338547|gb|ACY52342.1| glutamyl-tRNA synthetase [Vibrio sp. Ex25]
          Length = 475

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/487 (31%), Positives = 251/487 (51%), Gaps = 21/487 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ ++
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKNQGGEFVLRIEDTDLERNSQEAVDAILEGME 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   V  LL +  A++C+ S E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTQRFDRYNEMVDKLLAEGKAYKCYASKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +      +++    V+R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKA--ANEAAKDGDPCVIRFRNPKEGSVVFDDQIRGRIEIRNDQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINIYEALGAPVPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y  MGYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDMGYLPAALNNYLVRLGWS--HGDQEIFSQEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLS---TTEFLSRVSQWMKEKDR---LTQALTLA 360
           L+ +SK+ + F+  KL WLN  +I+              + Q   +      +T  + L 
Sbjct: 291 LNAVSKSASAFNTDKLQWLNNHYIKNSDPAYVAEHLQWHLDQQKLDVTNGPAITDVIKLV 350

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  TL  L +   + ++       E+  +         + L+    + E +  W   N
Sbjct: 351 GERCNTLVELAEQIRYFYEDFSEF--EAGAAKKHLRGVAKEPLELALAKAEALTEWTTAN 408

Query: 421 IET-ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           I+   +  V +  E  +  I  PL +A+TG   S  +   +E++G+     R++ A+  +
Sbjct: 409 IKDGVIAAVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMELVGKERCVARIKMALEFI 468

Query: 480 SSLVQNH 486
           +    N 
Sbjct: 469 AEREANA 475


>gi|323170337|gb|EFZ55990.1| glutamyl-tRNA synthetase [Escherichia coli LT-68]
          Length = 471

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 247/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRYGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALDFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|170019311|ref|YP_001724265.1| glutamyl-tRNA synthetase [Escherichia coli ATCC 8739]
 gi|189082154|sp|B1IX65|SYE_ECOLC RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|169754239|gb|ACA76938.1| glutamyl-tRNA synthetase [Escherichia coli ATCC 8739]
          Length = 471

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 247/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMSQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALDFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|16802283|ref|NP_463768.1| glutamyl-tRNA synthetase [Listeria monocytogenes EGD-e]
 gi|224498917|ref|ZP_03667266.1| glutamyl-tRNA synthetase [Listeria monocytogenes Finland 1988]
 gi|224502468|ref|ZP_03670775.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL R2-561]
 gi|254828697|ref|ZP_05233384.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL N3-165]
 gi|254900582|ref|ZP_05260506.1| glutamyl-tRNA synthetase [Listeria monocytogenes J0161]
 gi|254913467|ref|ZP_05263479.1| glutamyl-tRNA synthetase [Listeria monocytogenes J2818]
 gi|254937952|ref|ZP_05269649.1| glutamyl-tRNA synthetase [Listeria monocytogenes F6900]
 gi|255026267|ref|ZP_05298253.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL J2-003]
 gi|255028573|ref|ZP_05300524.1| glutamyl-tRNA synthetase [Listeria monocytogenes LO28]
 gi|22257055|sp|Q8YAB3|SYE_LISMO RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|16409602|emb|CAD00764.1| gltX [Listeria monocytogenes EGD-e]
 gi|258601101|gb|EEW14426.1| glutamyl-tRNA synthetase [Listeria monocytogenes FSL N3-165]
 gi|258610562|gb|EEW23170.1| glutamyl-tRNA synthetase [Listeria monocytogenes F6900]
 gi|293591474|gb|EFF99808.1| glutamyl-tRNA synthetase [Listeria monocytogenes J2818]
          Length = 491

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/486 (35%), Positives = 269/486 (55%), Gaps = 14/486 (2%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  + +VRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD+KR+  + E +
Sbjct: 1   MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNIADGEES 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
            M +LKW G++WDEG D+ G YGPYRQSER++IY+P +Q LL+K LA++C+C+ E L+  
Sbjct: 61  QMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQELLDKDLAYKCYCTEEELDAE 120

Query: 121 RRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIP 180
           R  Q+      RY G C  L+ ++      +  K  +R  VP   +  F D V  ++   
Sbjct: 121 REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
            N +   V+ K DG+PTY+ A  +DDHLM+I+HV RG++ IS+ PK IL+Y  F +  P 
Sbjct: 181 SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI 240

Query: 241 FIHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           F H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+A+L      + +E+   
Sbjct: 241 FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGE-EEIFSK 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WM 347
           ++ I  FD   LSK+ A+FD  KL W+N +++++          +               
Sbjct: 300 EEFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVVELSLPHLQKAGVVSAELNQ 359

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
            E D + + ++L   +++  + +  +++  F     +T +  ++  L  E +  ++   +
Sbjct: 360 AELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEETAVLAEETVPTVISAFK 419

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           +E E +++ +   ++ A++ V +      K +  P+ +  TG  +   L  +IE+LGR  
Sbjct: 420 KELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGREK 479

Query: 468 VYFRLR 473
           V  RL 
Sbjct: 480 VLNRLD 485


>gi|284922361|emb|CBG35448.1| glutamyl-tRNA synthetase [Escherichia coli 042]
          Length = 471

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRHSHDHH-----ADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLTAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|167549572|ref|ZP_02343331.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205325426|gb|EDZ13265.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 471

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 245/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERLE++R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLEQLREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSAITDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|229470684|sp|B5RCP1|SYE_SALG2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
          Length = 471

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 245/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERLE++R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLEQLREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SYEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTLEPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSAITDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|225848764|ref|YP_002728928.1| glutamyl-tRNA synthetase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643579|gb|ACN98629.1| glutamyl-tRNA synthetase [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 478

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 173/479 (36%), Positives = 258/479 (53%), Gaps = 9/479 (1%)

Query: 8   RVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKW 67
           RVR APSPTG  H+G A TALFNYL AK   G  ILRIEDTD +RS  E E  +++ LKW
Sbjct: 3   RVRFAPSPTGYLHLGNARTALFNYLFAKHENGSLILRIEDTDLERSKKEYEEMLIEDLKW 62

Query: 68  CGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKR 127
            G+ WDEGPD+GG YGPYRQSER  IY  YV  LL+   A+ C+CS E LE+ R      
Sbjct: 63  LGIQWDEGPDVGGNYGPYRQSERLEIYYKYVDKLLKSGDAYYCYCSEEELEKEREKAIAE 122

Query: 128 NIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQ 187
             P RY G C  L+ +E      +  K VVR  VP++    F+D + G +EI        
Sbjct: 123 GRPYRYSGKCRNLTPEERADYEAQGIKPVVRFKVPDKTVI-FEDIIRGHVEIDTKEFGDF 181

Query: 188 VLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLI 247
           V+++ DGMP Y+   VIDD LM ITHV RGE+ +S+ PK I++Y+   F IP+F HLP+I
Sbjct: 182 VIVRQDGMPVYNFVVVIDDALMGITHVIRGEDHLSNTPKQIVIYEALGFNIPQFAHLPII 241

Query: 248 KNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDL 307
              D++KLSKR    S+      G+L EA+ N+L+LL  H  ++ + ++  +++I  F +
Sbjct: 242 LGEDRTKLSKRHGAVSVRALKDDGFLSEAVFNYLSLLGWHPKDERE-ILPKEEIIKQFRI 300

Query: 308 HHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDR------LTQALTLAQ 361
             ++K+ A+FD+ KL W+NG +IRE L   E   R  ++ +            + +   +
Sbjct: 301 EDVNKSPAIFDRTKLRWMNGVYIREILDLEELTKRSVEFFEGFGYKADFEFYKKVMEAIR 360

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
             I TL  + +     F  +   T E              +++   E+ + +    +E+ 
Sbjct: 361 DSIETLMDIKERAKVFFVDEFPFTDEIVAEVK-SDPNFYKVVEIFYEKVKGLDKLTKEDF 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           +T  + + +      K +  P+ +A+TG    + L   +E++G   V FRL+  +    
Sbjct: 420 KTITKEIQKEYGFKGKALFHPIRIALTGESSGVSLDLLVEVIGIERVKFRLKRFLEYFG 478


>gi|187731511|ref|YP_001881212.1| glutamyl-tRNA synthetase [Shigella boydii CDC 3083-94]
 gi|238691717|sp|B2TX02|SYE_SHIB3 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|187428503|gb|ACD07777.1| glutamyl-tRNA synthetase [Shigella boydii CDC 3083-94]
 gi|320173868|gb|EFW49048.1| glutamyl-tRNA synthetase [Shigella dysenteriae CDC 74-1112]
 gi|332093007|gb|EGI98073.1| glutamyl-tRNA synthetase [Shigella boydii 3594-74]
          Length = 471

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 157/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +GR+    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGRTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|167854519|ref|ZP_02477300.1| glutamyl-tRNA synthetase [Haemophilus parasuis 29755]
 gi|167854274|gb|EDS25507.1| glutamyl-tRNA synthetase [Haemophilus parasuis 29755]
          Length = 479

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 159/484 (32%), Positives = 250/484 (51%), Gaps = 28/484 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHNNGEFVLRIEDTDLERSTPEATAAIIEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+  A+RC+CS ERL+E+R  Q 
Sbjct: 74  EWLNLAW--------EHGPYFQTKRFDRYNQVIDQMIEEGTAYRCYCSKERLDELRANQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL   S +          HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLGDHSHDPSE------PHVVRFKNPTEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +     IP + H+ 
Sbjct: 180 DLIIRRTDGAPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAEIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFTREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------AL 357
           D+H +SK+ + F+ +KL WLN  ++R      +++++  +W      +           +
Sbjct: 298 DIHSVSKSASAFNTEKLQWLNQHYMRSL--PADYVAKYLEWHMNAQGIDFSQGAALAEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++       ++         E +  L    E+      W 
Sbjct: 356 PVLSERAKTLKELASQSRYFYQEFDSYDEKAVAKNF--KAEAVAPLAKLLEKLTACDDWS 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            ENI  A+   A   +  +  +  P  LA+TGS  S  +  + +++G+     R++ AIA
Sbjct: 414 VENIHDAMNQTAAELDIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGKERTLARIQKAIA 473

Query: 478 LVSS 481
            + +
Sbjct: 474 FIEA 477


>gi|153825317|ref|ZP_01977984.1| glutamyl-tRNA synthetase [Vibrio cholerae MZO-2]
 gi|149741001|gb|EDM55070.1| glutamyl-tRNA synthetase [Vibrio cholerae MZO-2]
          Length = 509

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/504 (30%), Positives = 254/504 (50%), Gaps = 34/504 (6%)

Query: 1   MISSSK----------VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDS 50
           M+SS +          V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD 
Sbjct: 22  MLSSQQKNLTKVIQMTVKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDL 81

Query: 51  KRSTLESENAVMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRC 110
           +RST  + +A+++ + W GL WDEG        PY Q++R + Y   +  LL +  A++C
Sbjct: 82  ERSTQAAVDAIIEGMTWLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKC 133

Query: 111 FCSTERLEEMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQ 170
           +   E L+E+R  Q       RYD +  K+ +          +   +R   P +GS VF 
Sbjct: 134 YAPKELLDEIRAEQEANKEMPRYDANHPKIKAVNDAAKE--GEPCCIRFRNPKEGSVVFD 191

Query: 171 DKVYGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILL 230
           D++ G +EI  + +D  ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +
Sbjct: 192 DQIRGRIEIRNDQLDDLIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINI 251

Query: 231 YQYFNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSE 290
           Y+     IP F H  +I   D +KLSKR    S+  Y   GYLPEAL+N+L  L      
Sbjct: 252 YKAMGATIPTFAHCAMILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--H 309

Query: 291 DDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK 350
            D E+    ++I+ F L  +SK+ + F+  KL WLN  +I+   S  E++++  +W  E 
Sbjct: 310 GDQEIFSRDEMINLFSLGAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFEN 367

Query: 351 DRLTQ--------ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDI 402
             + +         + L   R  TL  L Q + + ++      A++ K          + 
Sbjct: 368 QGINKATGPALAEVVKLVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEP 425

Query: 403 LKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEI 462
           L     + E +  W  E +   +  V +  E  +  I  PL +A+TG   S  +   + +
Sbjct: 426 LMLALSKIEALTEWNTEALHHVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNL 485

Query: 463 LGRSVVYFRLRHAIALVSSLVQNH 486
           +G+  V  R++ A+  + +   N 
Sbjct: 486 IGQERVIARIKMALEYIETREANA 509


>gi|229507709|ref|ZP_04397214.1| glutamyl-tRNA synthetase [Vibrio cholerae BX 330286]
 gi|229512096|ref|ZP_04401575.1| glutamyl-tRNA synthetase [Vibrio cholerae B33]
 gi|229513858|ref|ZP_04403320.1| glutamyl-tRNA synthetase [Vibrio cholerae TMA 21]
 gi|229519231|ref|ZP_04408674.1| glutamyl-tRNA synthetase [Vibrio cholerae RC9]
 gi|229528781|ref|ZP_04418171.1| glutamyl-tRNA synthetase [Vibrio cholerae 12129(1)]
 gi|229607213|ref|YP_002877861.1| glutamyl-tRNA synthetase [Vibrio cholerae MJ-1236]
 gi|229332555|gb|EEN98041.1| glutamyl-tRNA synthetase [Vibrio cholerae 12129(1)]
 gi|229343920|gb|EEO08895.1| glutamyl-tRNA synthetase [Vibrio cholerae RC9]
 gi|229349039|gb|EEO13996.1| glutamyl-tRNA synthetase [Vibrio cholerae TMA 21]
 gi|229352061|gb|EEO17002.1| glutamyl-tRNA synthetase [Vibrio cholerae B33]
 gi|229355214|gb|EEO20135.1| glutamyl-tRNA synthetase [Vibrio cholerae BX 330286]
 gi|229369868|gb|ACQ60291.1| glutamyl-tRNA synthetase [Vibrio cholerae MJ-1236]
          Length = 488

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 17  VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 76

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 77  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 128

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 129 NKEMPRYDANHPKIKAVNDAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 186

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 187 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 246

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 247 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 304

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L+ +SK+ + F+  KL WLN  +I+   S  E++++  +W  E   + +         + 
Sbjct: 305 LNAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFENQGINKATGPALAEVVK 362

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 363 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 420

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+  
Sbjct: 421 EALHHVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALEY 480

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 481 IETREANA 488


>gi|16130330|ref|NP_416899.1| glutamyl-tRNA synthetase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|30063801|ref|NP_837972.1| glutamyl-tRNA synthetase [Shigella flexneri 2a str. 2457T]
 gi|89109217|ref|AP_002997.1| glutamyl-tRNA synthetase [Escherichia coli str. K-12 substr. W3110]
 gi|157156721|ref|YP_001463736.1| glutamyl-tRNA synthetase [Escherichia coli E24377A]
 gi|157161871|ref|YP_001459189.1| glutamyl-tRNA synthetase [Escherichia coli HS]
 gi|170082012|ref|YP_001731332.1| glutamyl-tRNA synthetase [Escherichia coli str. K-12 substr. DH10B]
 gi|188492356|ref|ZP_02999626.1| glutamyl-tRNA synthetase [Escherichia coli 53638]
 gi|193062322|ref|ZP_03043417.1| glutamyl-tRNA synthetase [Escherichia coli E22]
 gi|209919884|ref|YP_002293968.1| glutamyl-tRNA synthetase [Escherichia coli SE11]
 gi|218696039|ref|YP_002403706.1| glutamyl-tRNA synthetase [Escherichia coli 55989]
 gi|238901566|ref|YP_002927362.1| glutamyl-tRNA synthetase [Escherichia coli BW2952]
 gi|253772695|ref|YP_003035526.1| glutamyl-tRNA synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254162389|ref|YP_003045497.1| glutamyl-tRNA synthetase [Escherichia coli B str. REL606]
 gi|256017443|ref|ZP_05431308.1| glutamyl-tRNA synthetase [Shigella sp. D9]
 gi|256021904|ref|ZP_05435769.1| glutamyl-tRNA synthetase [Escherichia sp. 4_1_40B]
 gi|260845044|ref|YP_003222822.1| glutamyl-tRNA synthetase [Escherichia coli O103:H2 str. 12009]
 gi|260856505|ref|YP_003230396.1| glutamyl-tRNA synthetase [Escherichia coli O26:H11 str. 11368]
 gi|260869100|ref|YP_003235502.1| glutamyl-tRNA synthetase [Escherichia coli O111:H- str. 11128]
 gi|293446767|ref|ZP_06663189.1| glutamyl-tRNA synthetase [Escherichia coli B088]
 gi|300817359|ref|ZP_07097576.1| glutamyl-tRNA synthetase [Escherichia coli MS 107-1]
 gi|300820932|ref|ZP_07101082.1| glutamyl-tRNA synthetase [Escherichia coli MS 119-7]
 gi|300903128|ref|ZP_07121063.1| glutamyl-tRNA synthetase [Escherichia coli MS 84-1]
 gi|300917974|ref|ZP_07134602.1| glutamyl-tRNA synthetase [Escherichia coli MS 115-1]
 gi|300921996|ref|ZP_07138141.1| glutamyl-tRNA synthetase [Escherichia coli MS 182-1]
 gi|300928563|ref|ZP_07144087.1| glutamyl-tRNA synthetase [Escherichia coli MS 187-1]
 gi|300951904|ref|ZP_07165711.1| glutamyl-tRNA synthetase [Escherichia coli MS 116-1]
 gi|300956152|ref|ZP_07168468.1| glutamyl-tRNA synthetase [Escherichia coli MS 175-1]
 gi|301025336|ref|ZP_07188897.1| glutamyl-tRNA synthetase [Escherichia coli MS 196-1]
 gi|301328902|ref|ZP_07221938.1| glutamyl-tRNA synthetase [Escherichia coli MS 78-1]
 gi|301648053|ref|ZP_07247818.1| glutamyl-tRNA synthetase [Escherichia coli MS 146-1]
 gi|307139044|ref|ZP_07498400.1| glutamyl-tRNA synthetase [Escherichia coli H736]
 gi|307315323|ref|ZP_07594896.1| glutamyl-tRNA synthetase [Escherichia coli W]
 gi|309794549|ref|ZP_07688972.1| glutamyl-tRNA synthetase [Escherichia coli MS 145-7]
 gi|331643022|ref|ZP_08344157.1| glutamate--tRNA ligase [Escherichia coli H736]
 gi|331669142|ref|ZP_08369990.1| glutamate--tRNA ligase [Escherichia coli TA271]
 gi|331678388|ref|ZP_08379063.1| glutamate--tRNA ligase [Escherichia coli H591]
 gi|332278444|ref|ZP_08390857.1| glutamyl-tRNA synthetase [Shigella sp. D9]
 gi|135107|sp|P04805|SYE_ECOLI RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|166979999|sp|A7ZPK7|SYE_ECO24 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|166980000|sp|A8A2Q2|SYE_ECOHS RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|229470615|sp|B1X9R9|SYE_ECODH RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|238064690|sp|B6I6U7|SYE_ECOSE RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|41596|emb|CAA45391.1| glutamyl-tRNA synthetase [Escherichia coli]
 gi|148256|gb|AAA65715.1| glutamyl-tRNA synthetase [Escherichia coli K-12]
 gi|1788743|gb|AAC75457.1| glutamyl-tRNA synthetase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|1799814|dbj|BAA16272.1| glutamyl-tRNA synthetase [Escherichia coli str. K12 substr. W3110]
 gi|30042056|gb|AAP17782.1| glutamate tRNA synthetase, catalytic subunit [Shigella flexneri 2a
           str. 2457T]
 gi|157067551|gb|ABV06806.1| glutamyl-tRNA synthetase [Escherichia coli HS]
 gi|157078751|gb|ABV18459.1| glutamyl-tRNA synthetase [Escherichia coli E24377A]
 gi|169889847|gb|ACB03554.1| glutamyl-tRNA synthetase [Escherichia coli str. K-12 substr. DH10B]
 gi|188487555|gb|EDU62658.1| glutamyl-tRNA synthetase [Escherichia coli 53638]
 gi|192931988|gb|EDV84587.1| glutamyl-tRNA synthetase [Escherichia coli E22]
 gi|209913143|dbj|BAG78217.1| glutamyl-tRNA synthase [Escherichia coli SE11]
 gi|218352771|emb|CAU98557.1| glutamyl-tRNA synthetase [Escherichia coli 55989]
 gi|238861344|gb|ACR63342.1| glutamyl-tRNA synthetase [Escherichia coli BW2952]
 gi|242378013|emb|CAQ32784.1| glutamyl-tRNA synthetase [Escherichia coli BL21(DE3)]
 gi|253323739|gb|ACT28341.1| glutamyl-tRNA synthetase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253974290|gb|ACT39961.1| glutamyl-tRNA synthetase [Escherichia coli B str. REL606]
 gi|253978457|gb|ACT44127.1| glutamyl-tRNA synthetase [Escherichia coli BL21(DE3)]
 gi|257755154|dbj|BAI26656.1| glutamyl-tRNA synthetase [Escherichia coli O26:H11 str. 11368]
 gi|257760191|dbj|BAI31688.1| glutamyl-tRNA synthetase [Escherichia coli O103:H2 str. 12009]
 gi|257765456|dbj|BAI36951.1| glutamyl-tRNA synthetase [Escherichia coli O111:H- str. 11128]
 gi|260448511|gb|ACX38933.1| glutamyl-tRNA synthetase [Escherichia coli DH1]
 gi|281601824|gb|ADA74808.1| Glutamyl-tRNA synthetase [Shigella flexneri 2002017]
 gi|291323597|gb|EFE63025.1| glutamyl-tRNA synthetase [Escherichia coli B088]
 gi|299880114|gb|EFI88325.1| glutamyl-tRNA synthetase [Escherichia coli MS 196-1]
 gi|300317007|gb|EFJ66791.1| glutamyl-tRNA synthetase [Escherichia coli MS 175-1]
 gi|300404854|gb|EFJ88392.1| glutamyl-tRNA synthetase [Escherichia coli MS 84-1]
 gi|300414832|gb|EFJ98142.1| glutamyl-tRNA synthetase [Escherichia coli MS 115-1]
 gi|300421614|gb|EFK04925.1| glutamyl-tRNA synthetase [Escherichia coli MS 182-1]
 gi|300448874|gb|EFK12494.1| glutamyl-tRNA synthetase [Escherichia coli MS 116-1]
 gi|300463435|gb|EFK26928.1| glutamyl-tRNA synthetase [Escherichia coli MS 187-1]
 gi|300526685|gb|EFK47754.1| glutamyl-tRNA synthetase [Escherichia coli MS 119-7]
 gi|300529985|gb|EFK51047.1| glutamyl-tRNA synthetase [Escherichia coli MS 107-1]
 gi|300844734|gb|EFK72494.1| glutamyl-tRNA synthetase [Escherichia coli MS 78-1]
 gi|301073846|gb|EFK88652.1| glutamyl-tRNA synthetase [Escherichia coli MS 146-1]
 gi|306905299|gb|EFN35841.1| glutamyl-tRNA synthetase [Escherichia coli W]
 gi|308122005|gb|EFO59267.1| glutamyl-tRNA synthetase [Escherichia coli MS 145-7]
 gi|309702691|emb|CBJ02020.1| glutamyl-tRNA synthetase [Escherichia coli ETEC H10407]
 gi|313650860|gb|EFS15260.1| glutamyl-tRNA synthetase [Shigella flexneri 2a str. 2457T]
 gi|315061731|gb|ADT76058.1| glutamyl-tRNA synthetase [Escherichia coli W]
 gi|315137033|dbj|BAJ44192.1| glutamyl-tRNA synthetase [Escherichia coli DH1]
 gi|315256417|gb|EFU36385.1| glutamyl-tRNA synthetase [Escherichia coli MS 85-1]
 gi|315615652|gb|EFU96284.1| glutamyl-tRNA synthetase [Escherichia coli 3431]
 gi|320199969|gb|EFW74558.1| glutamyl-tRNA synthetase [Escherichia coli EC4100B]
 gi|323156308|gb|EFZ42466.1| glutamyl-tRNA synthetase [Escherichia coli EPECa14]
 gi|323159448|gb|EFZ45431.1| glutamyl-tRNA synthetase [Escherichia coli E128010]
 gi|323177474|gb|EFZ63062.1| glutamyl-tRNA synthetase [Escherichia coli 1180]
 gi|323184294|gb|EFZ69670.1| glutamyl-tRNA synthetase [Escherichia coli 1357]
 gi|323377688|gb|ADX49956.1| glutamyl-tRNA synthetase [Escherichia coli KO11]
 gi|323936557|gb|EGB32845.1| glutamyl-tRNA synthetase [Escherichia coli E1520]
 gi|323941097|gb|EGB37283.1| glutamyl-tRNA synthetase [Escherichia coli E482]
 gi|323944895|gb|EGB40961.1| glutamyl-tRNA synthetase [Escherichia coli H120]
 gi|323961207|gb|EGB56819.1| glutamyl-tRNA synthetase [Escherichia coli H489]
 gi|323970905|gb|EGB66156.1| glutamyl-tRNA synthetase [Escherichia coli TA007]
 gi|324016798|gb|EGB86017.1| glutamyl-tRNA synthetase [Escherichia coli MS 117-3]
 gi|324118130|gb|EGC12028.1| glutamyl-tRNA synthetase [Escherichia coli E1167]
 gi|331039820|gb|EGI12040.1| glutamate--tRNA ligase [Escherichia coli H736]
 gi|331064336|gb|EGI36247.1| glutamate--tRNA ligase [Escherichia coli TA271]
 gi|331074848|gb|EGI46168.1| glutamate--tRNA ligase [Escherichia coli H591]
 gi|332100796|gb|EGJ04142.1| glutamyl-tRNA synthetase [Shigella sp. D9]
 gi|332344227|gb|AEE57561.1| glutamyl-tRNA synthetase GltX [Escherichia coli UMNK88]
 gi|332755043|gb|EGJ85408.1| glutamyl-tRNA synthetase [Shigella flexneri 4343-70]
 gi|332755447|gb|EGJ85811.1| glutamyl-tRNA synthetase [Shigella flexneri K-671]
 gi|332756219|gb|EGJ86570.1| glutamyl-tRNA synthetase [Shigella flexneri 2747-71]
 gi|332766213|gb|EGJ96423.1| glutamyl-tRNA synthetase [Shigella flexneri 2930-71]
 gi|333001537|gb|EGK21105.1| glutamyl-tRNA synthetase [Shigella flexneri VA-6]
 gi|333001697|gb|EGK21263.1| glutamyl-tRNA synthetase [Shigella flexneri K-218]
 gi|333016270|gb|EGK35601.1| glutamyl-tRNA synthetase [Shigella flexneri K-304]
          Length = 471

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 247/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALDFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|15642212|ref|NP_231845.1| glutamyl-tRNA synthetase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121726576|ref|ZP_01679825.1| glutamyl-tRNA synthetase [Vibrio cholerae V52]
 gi|147675108|ref|YP_001217731.1| glutamyl-tRNA synthetase [Vibrio cholerae O395]
 gi|153213798|ref|ZP_01949006.1| glutamyl-tRNA synthetase [Vibrio cholerae 1587]
 gi|153817099|ref|ZP_01969766.1| glutamyl-tRNA synthetase [Vibrio cholerae NCTC 8457]
 gi|153820833|ref|ZP_01973500.1| glutamyl-tRNA synthetase [Vibrio cholerae B33]
 gi|153829349|ref|ZP_01982016.1| glutamyl-tRNA synthetase [Vibrio cholerae 623-39]
 gi|227082338|ref|YP_002810889.1| glutamyl-tRNA synthetase [Vibrio cholerae M66-2]
 gi|254286477|ref|ZP_04961434.1| glutamyl-tRNA synthetase [Vibrio cholerae AM-19226]
 gi|254849344|ref|ZP_05238694.1| glutamyl-tRNA synthetase [Vibrio cholerae MO10]
 gi|9656771|gb|AAF95358.1| glutamyl-tRNA synthetase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121631029|gb|EAX63408.1| glutamyl-tRNA synthetase [Vibrio cholerae V52]
 gi|124115722|gb|EAY34542.1| glutamyl-tRNA synthetase [Vibrio cholerae 1587]
 gi|126512367|gb|EAZ74961.1| glutamyl-tRNA synthetase [Vibrio cholerae NCTC 8457]
 gi|126521625|gb|EAZ78848.1| glutamyl-tRNA synthetase [Vibrio cholerae B33]
 gi|146316991|gb|ABQ21530.1| glutamyl-tRNA synthetase [Vibrio cholerae O395]
 gi|148875190|gb|EDL73325.1| glutamyl-tRNA synthetase [Vibrio cholerae 623-39]
 gi|150423426|gb|EDN15370.1| glutamyl-tRNA synthetase [Vibrio cholerae AM-19226]
 gi|227010226|gb|ACP06438.1| glutamyl-tRNA synthetase [Vibrio cholerae M66-2]
 gi|227014110|gb|ACP10320.1| glutamyl-tRNA synthetase [Vibrio cholerae O395]
 gi|254845049|gb|EET23463.1| glutamyl-tRNA synthetase [Vibrio cholerae MO10]
          Length = 509

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 38  VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 97

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 98  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 149

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 150 NKEMPRYDANHPKIKAVNDAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 207

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 208 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 267

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 268 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 325

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L+ +SK+ + F+  KL WLN  +I+   S  E++++  +W  E   + +         + 
Sbjct: 326 LNAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFENQGINKATGPALAEVVK 383

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 384 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 441

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+  
Sbjct: 442 EALHHVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALEY 501

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 502 IETREANA 509


>gi|56412690|ref|YP_149765.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197361624|ref|YP_002141260.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|67461662|sp|Q5PNE5|SYE_SALPA RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|238689920|sp|B5BB76|SYE_SALPK RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|56126947|gb|AAV76453.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197093100|emb|CAR58539.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 471

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 245/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERLE++R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLEQLREDQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMSQSCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSAITDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|294793813|ref|ZP_06758950.1| glutamate--tRNA ligase [Veillonella sp. 3_1_44]
 gi|294455383|gb|EFG23755.1| glutamate--tRNA ligase [Veillonella sp. 3_1_44]
          Length = 489

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 168/486 (34%), Positives = 254/486 (52%), Gaps = 16/486 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +SS KV  R APSPTG  HIG A +ALFN+L+A++  G F+LRIEDTD  RST ESE  +
Sbjct: 1   MSSMKV--RFAPSPTGPFHIGGARSALFNWLLARKEKGTFVLRIEDTDLARSTRESEENI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             SL+W G+NWDEG D+GG  GPYRQ+ER ++Y+   Q LL++  A+ C+C+ E L+ +R
Sbjct: 59  KASLQWLGMNWDEGIDVGGNNGPYRQTERLDLYKEVTQRLLDEGKAYECYCTPEELDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           + Q  R    +Y+GHC  L  +   +   E +K  +RL VP   +  F D V G +    
Sbjct: 119 QDQMDRGETPKYNGHCEHLDEETKAKYIAEGRKPTIRLRVPLNKTYAFDDMVRGHVSFES 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           N V   V++KSDG+P Y+ A V+DDH+M ITHV R EE +S+ P+ + +Y+   + +P+F
Sbjct: 179 NGVGDFVIVKSDGIPVYNFAVVMDDHMMGITHVIRAEEHLSNTPRQMAIYEALGWEVPKF 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+ LI   D  K+SKR   TS+  Y  +GYLPEAL+NFLALL     E ++E     +L
Sbjct: 239 GHISLILGKDYKKMSKRHGATSVEQYKQLGYLPEALVNFLALLG-WAPEGEEEFFTQDEL 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-------WMKEKDRLT 354
           I  F +  ++K  AVFD  KL+ +N  +++       F   +                  
Sbjct: 298 IQAFSMDRVAKNPAVFDIDKLNHINFHYMKNLSDEELFHLCLPHLKEVGLAPDSLNQADI 357

Query: 355 QALTLA----QSRITTLSALPQMTDFLFKSDLHLTA--ESFKSTALCPEEIIDILKTTQE 408
             LTL     +  I+  + +           + L    E      L  E    +L   + 
Sbjct: 358 DWLTLLCSTFRDHISYGAQIKDHVGLFMGETVFLEEGHEEELRAVLNEETAPTVLGAFRN 417

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
               +     E ++  ++ V +      K +  P+ +A+TG  +   L + + +LG+   
Sbjct: 418 ALAELDEITPEVVKATIKAVMKETSLKGKFVFMPIRVALTGQMHGPDLNNIVTLLGKEKC 477

Query: 469 YFRLRH 474
             RL +
Sbjct: 478 LHRLDN 483


>gi|26248778|ref|NP_754818.1| glutamyl-tRNA synthetase [Escherichia coli CFT073]
 gi|215487659|ref|YP_002330090.1| glutamyl-tRNA synthetase [Escherichia coli O127:H6 str. E2348/69]
 gi|218690541|ref|YP_002398753.1| glutamyl-tRNA synthetase [Escherichia coli ED1a]
 gi|218700867|ref|YP_002408496.1| glutamyl-tRNA synthetase [Escherichia coli IAI39]
 gi|227887447|ref|ZP_04005252.1| glutamyl-tRNA synthetase [Escherichia coli 83972]
 gi|300940359|ref|ZP_07154951.1| glutamyl-tRNA synthetase [Escherichia coli MS 21-1]
 gi|300983943|ref|ZP_07176799.1| glutamyl-tRNA synthetase [Escherichia coli MS 45-1]
 gi|301049153|ref|ZP_07196133.1| glutamyl-tRNA synthetase [Escherichia coli MS 185-1]
 gi|306814509|ref|ZP_07448671.1| glutamyl-tRNA synthetase [Escherichia coli NC101]
 gi|312967689|ref|ZP_07781904.1| glutamyl-tRNA synthetase [Escherichia coli 2362-75]
 gi|331648061|ref|ZP_08349151.1| glutamate--tRNA ligase [Escherichia coli M605]
 gi|331658555|ref|ZP_08359499.1| glutamate--tRNA ligase [Escherichia coli TA206]
 gi|331684056|ref|ZP_08384652.1| glutamate--tRNA ligase [Escherichia coli H299]
 gi|29336536|sp|Q8FFC9|SYE_ECOL6 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|26109184|gb|AAN81386.1|AE016764_68 Glutamyl-tRNA synthetase [Escherichia coli CFT073]
 gi|215265731|emb|CAS10137.1| glutamyl-tRNA synthetase [Escherichia coli O127:H6 str. E2348/69]
 gi|218370853|emb|CAR18670.1| glutamyl-tRNA synthetase [Escherichia coli IAI39]
 gi|218428105|emb|CAV17829.1| glutamyl-tRNA synthetase [Escherichia coli ED1a]
 gi|222034134|emb|CAP76875.1| glutamyl-tRNA synthetase [Escherichia coli LF82]
 gi|227835797|gb|EEJ46263.1| glutamyl-tRNA synthetase [Escherichia coli 83972]
 gi|281179476|dbj|BAI55806.1| glutamyl-tRNA synthetase [Escherichia coli SE15]
 gi|300299057|gb|EFJ55442.1| glutamyl-tRNA synthetase [Escherichia coli MS 185-1]
 gi|300408443|gb|EFJ91981.1| glutamyl-tRNA synthetase [Escherichia coli MS 45-1]
 gi|300454831|gb|EFK18324.1| glutamyl-tRNA synthetase [Escherichia coli MS 21-1]
 gi|305851903|gb|EFM52355.1| glutamyl-tRNA synthetase [Escherichia coli NC101]
 gi|307554444|gb|ADN47219.1| glutamate tRNA synthetase, catalytic subunit [Escherichia coli ABU
           83972]
 gi|312287886|gb|EFR15791.1| glutamyl-tRNA synthetase [Escherichia coli 2362-75]
 gi|312946998|gb|ADR27825.1| glutamyl-tRNA synthetase [Escherichia coli O83:H1 str. NRG 857C]
 gi|315293484|gb|EFU52836.1| glutamyl-tRNA synthetase [Escherichia coli MS 153-1]
 gi|315298217|gb|EFU57481.1| glutamyl-tRNA synthetase [Escherichia coli MS 16-3]
 gi|320196249|gb|EFW70873.1| glutamyl-tRNA synthetase [Escherichia coli WV_060327]
 gi|323188291|gb|EFZ73584.1| glutamyl-tRNA synthetase [Escherichia coli RN587/1]
 gi|324009194|gb|EGB78413.1| glutamyl-tRNA synthetase [Escherichia coli MS 57-2]
 gi|330912194|gb|EGH40704.1| glutamyl-tRNA synthetase [Escherichia coli AA86]
 gi|331042921|gb|EGI15061.1| glutamate--tRNA ligase [Escherichia coli M605]
 gi|331054220|gb|EGI26247.1| glutamate--tRNA ligase [Escherichia coli TA206]
 gi|331079008|gb|EGI50210.1| glutamate--tRNA ligase [Escherichia coli H299]
          Length = 471

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLTAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|331663960|ref|ZP_08364870.1| glutamate--tRNA ligase [Escherichia coli TA143]
 gi|331059759|gb|EGI31736.1| glutamate--tRNA ligase [Escherichia coli TA143]
          Length = 471

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 247/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  + +   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRNKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|229524211|ref|ZP_04413616.1| glutamyl-tRNA synthetase [Vibrio cholerae bv. albensis VL426]
 gi|229337792|gb|EEO02809.1| glutamyl-tRNA synthetase [Vibrio cholerae bv. albensis VL426]
          Length = 488

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 17  VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 76

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 77  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 128

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 129 NKEMPRYDANHPKIKAVNDAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 186

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 187 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 246

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 247 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 304

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L+ +SK+ + F+  KL WLN  +I+   S  E++++  +W  E   + +         + 
Sbjct: 305 LNAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFENQGINKATGPALAEVVK 362

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 363 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 420

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+  
Sbjct: 421 EALHHVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALEY 480

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 481 IETREANA 488


>gi|15802940|ref|NP_288968.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 EDL933]
 gi|15832532|ref|NP_311305.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. Sakai]
 gi|168770973|ref|ZP_02795980.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4486]
 gi|168772762|ref|ZP_02797769.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4196]
 gi|168784414|ref|ZP_02809421.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4076]
 gi|168787317|ref|ZP_02812324.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC869]
 gi|195938752|ref|ZP_03084134.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4024]
 gi|208806319|ref|ZP_03248656.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4206]
 gi|208812101|ref|ZP_03253430.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4045]
 gi|208819547|ref|ZP_03259867.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4042]
 gi|209396142|ref|YP_002271884.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4115]
 gi|217327802|ref|ZP_03443885.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. TW14588]
 gi|254794360|ref|YP_003079197.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|261223151|ref|ZP_05937432.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261259296|ref|ZP_05951829.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. FRIK966]
 gi|291283635|ref|YP_003500453.1| Glutamyl-tRNA synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|331673878|ref|ZP_08374641.1| glutamate--tRNA ligase [Escherichia coli TA280]
 gi|22257053|sp|Q8XBN2|SYE_ECO57 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|238064689|sp|B5YZV2|SYE_ECO5E RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|12516778|gb|AAG57524.1|AE005471_1 glutamate tRNA synthetase, catalytic subunit [Escherichia coli
           O157:H7 str. EDL933]
 gi|13362748|dbj|BAB36701.1| glutamate tRNA synthetase catalytic subunit [Escherichia coli
           O157:H7 str. Sakai]
 gi|187771184|gb|EDU35028.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4196]
 gi|188998418|gb|EDU67429.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4076]
 gi|189360235|gb|EDU78654.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4486]
 gi|189372962|gb|EDU91378.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC869]
 gi|208726120|gb|EDZ75721.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4206]
 gi|208733378|gb|EDZ82065.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4045]
 gi|208739670|gb|EDZ87352.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4042]
 gi|209157542|gb|ACI34975.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC4115]
 gi|209764278|gb|ACI80451.1| glutamate tRNA synthetase catalytic subunit [Escherichia coli]
 gi|209764280|gb|ACI80452.1| glutamate tRNA synthetase catalytic subunit [Escherichia coli]
 gi|209764282|gb|ACI80453.1| glutamate tRNA synthetase catalytic subunit [Escherichia coli]
 gi|209764284|gb|ACI80454.1| glutamate tRNA synthetase catalytic subunit [Escherichia coli]
 gi|209764286|gb|ACI80455.1| glutamate tRNA synthetase catalytic subunit [Escherichia coli]
 gi|217320169|gb|EEC28594.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. TW14588]
 gi|254593760|gb|ACT73121.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. TW14359]
 gi|290763508|gb|ADD57469.1| Glutamyl-tRNA synthetase [Escherichia coli O55:H7 str. CB9615]
 gi|320191975|gb|EFW66620.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. EC1212]
 gi|320640919|gb|EFX10403.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. G5101]
 gi|320646438|gb|EFX15361.1| glutamyl-tRNA synthetase [Escherichia coli O157:H- str. 493-89]
 gi|320651707|gb|EFX20087.1| glutamyl-tRNA synthetase [Escherichia coli O157:H- str. H 2687]
 gi|320662992|gb|EFX30316.1| glutamyl-tRNA synthetase [Escherichia coli O55:H7 str. USDA 5905]
 gi|323977417|gb|EGB72503.1| glutamyl-tRNA synthetase [Escherichia coli TW10509]
 gi|326340208|gb|EGD64012.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. 1125]
 gi|326344209|gb|EGD67970.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. 1044]
 gi|331069151|gb|EGI40543.1| glutamate--tRNA ligase [Escherichia coli TA280]
          Length = 471

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|16765739|ref|NP_461354.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29140965|ref|NP_804307.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|161612840|ref|YP_001586805.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167993111|ref|ZP_02574206.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168234505|ref|ZP_02659563.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168242562|ref|ZP_02667494.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168261552|ref|ZP_02683525.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168817838|ref|ZP_02829838.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194445320|ref|YP_002041678.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448371|ref|YP_002046482.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194469719|ref|ZP_03075703.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194736951|ref|YP_002115484.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197251161|ref|YP_002147371.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197262511|ref|ZP_03162585.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|200386857|ref|ZP_03213469.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|238912833|ref|ZP_04656670.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289829285|ref|ZP_06546897.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|61247963|sp|P0A2K3|SYE_SALTY RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|61247964|sp|P0A2K4|SYE_SALTI RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|189082165|sp|A9N372|SYE_SALPB RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|238690014|sp|B5F0E6|SYE_SALA4 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|238690604|sp|B4TCE7|SYE_SALHS RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|238693570|sp|B4SZT6|SYE_SALNS RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|238693650|sp|B4TQE9|SYE_SALSV RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|16420958|gb|AAL21313.1| glutamate tRNA synthetase, catalytic subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29136590|gb|AAO68156.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|161362204|gb|ABX65972.1| hypothetical protein SPAB_00543 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403983|gb|ACF64205.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194406675|gb|ACF66894.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194456083|gb|EDX44922.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194712453|gb|ACF91674.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197214864|gb|ACH52261.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197240766|gb|EDY23386.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|199603955|gb|EDZ02500.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205328804|gb|EDZ15568.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205331587|gb|EDZ18351.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205338343|gb|EDZ25107.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205344830|gb|EDZ31594.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205349554|gb|EDZ36185.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|261247619|emb|CBG25446.1| GluRS [Salmonella enterica subsp. enterica serovar Typhimurium str.
           D23580]
 gi|267994520|gb|ACY89405.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301158970|emb|CBW18483.1| Glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312913405|dbj|BAJ37379.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320086907|emb|CBY96677.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321222882|gb|EFX47953.1| Glutamyl-tRNA synthetase ; unambiguous [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322614149|gb|EFY11084.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617450|gb|EFY14349.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322624920|gb|EFY21749.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322630470|gb|EFY27240.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322634650|gb|EFY31383.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322639361|gb|EFY36053.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322640010|gb|EFY36679.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646216|gb|EFY42731.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652158|gb|EFY48520.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656261|gb|EFY52557.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660338|gb|EFY56575.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665705|gb|EFY61888.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670057|gb|EFY66198.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672837|gb|EFY68947.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678802|gb|EFY74858.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683403|gb|EFY79417.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686616|gb|EFY82596.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323130747|gb|ADX18177.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323194497|gb|EFZ79691.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196507|gb|EFZ81656.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203614|gb|EFZ88637.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323206572|gb|EFZ91531.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323210420|gb|EFZ95308.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217128|gb|EGA01850.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219798|gb|EGA04279.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323232466|gb|EGA16569.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235502|gb|EGA19586.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323241338|gb|EGA25374.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245080|gb|EGA29082.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246231|gb|EGA30215.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323253178|gb|EGA37009.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255376|gb|EGA39145.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263420|gb|EGA46950.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264648|gb|EGA48151.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270980|gb|EGA54414.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|332989346|gb|AEF08329.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 471

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 245/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERLE++R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLEQLREDQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSAITDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|325496581|gb|EGC94440.1| glutamyl-tRNA synthetase [Escherichia fergusonii ECD227]
          Length = 471

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLTAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|49482757|ref|YP_039981.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257424641|ref|ZP_05601068.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257427309|ref|ZP_05603708.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257429945|ref|ZP_05606329.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257432647|ref|ZP_05609007.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257435551|ref|ZP_05611599.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus M876]
 gi|282903115|ref|ZP_06311006.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus C160]
 gi|282904905|ref|ZP_06312763.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282907855|ref|ZP_06315690.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282910168|ref|ZP_06317972.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282913360|ref|ZP_06321149.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus M899]
 gi|282915850|ref|ZP_06323615.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus D139]
 gi|282918315|ref|ZP_06326052.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus C427]
 gi|282923277|ref|ZP_06330957.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus C101]
 gi|283769683|ref|ZP_06342575.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus H19]
 gi|283957325|ref|ZP_06374778.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293500406|ref|ZP_06666257.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293509351|ref|ZP_06668062.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus M809]
 gi|293523938|ref|ZP_06670625.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus M1015]
 gi|295427065|ref|ZP_06819701.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|56749425|sp|Q6GJE1|SYE_STAAR RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|49240886|emb|CAG39553.1| putative glutamyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|257272211|gb|EEV04334.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275502|gb|EEV06975.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257279142|gb|EEV09743.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257282062|gb|EEV12197.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284742|gb|EEV14861.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus M876]
 gi|282314145|gb|EFB44535.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus C101]
 gi|282317449|gb|EFB47821.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus C427]
 gi|282320146|gb|EFB50491.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus D139]
 gi|282322392|gb|EFB52714.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus M899]
 gi|282325560|gb|EFB55868.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282328239|gb|EFB58517.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331730|gb|EFB61241.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282596070|gb|EFC01031.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus C160]
 gi|283459830|gb|EFC06920.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus H19]
 gi|283469820|emb|CAQ49031.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283790776|gb|EFC29591.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290920901|gb|EFD97962.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus M1015]
 gi|291095411|gb|EFE25672.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467448|gb|EFF09963.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus M809]
 gi|295128853|gb|EFG58483.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|302332241|gb|ADL22434.1| putative glutamyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|315193891|gb|EFU24285.1| putative glutamyl-tRNA synthetase [Staphylococcus aureus subsp.
           aureus CGS00]
          Length = 484

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 267/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTD KR+  + E +  
Sbjct: 1   MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER++IYQP +  LL +  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V G +    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ IS+ PK I++Y+ F +  P F 
Sbjct: 181 GIGDWVIVKKDGIPTYNFAVAIDDHYMEISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +               ++
Sbjct: 300 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + + L Q  ++    +  +++  FK    L  E  +   +  E++ +++     +
Sbjct: 360 LSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEE--EQQVINGEQVPELMTHLFSK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 NRLKQ 482


>gi|257464522|ref|ZP_05628893.1| glutamyl-tRNA synthetase [Actinobacillus minor 202]
 gi|257450182|gb|EEV24225.1| glutamyl-tRNA synthetase [Actinobacillus minor 202]
          Length = 479

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 161/484 (33%), Positives = 248/484 (51%), Gaps = 28/484 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHNNGEFVLRIEDTDLERSTPEATAAIIEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+  A+RC+CS ERL+E+R  Q 
Sbjct: 74  EWLNLAW--------EHGPYFQTKRFDRYNQVIDQMIEEGTAYRCYCSKERLDELRANQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL   S +          HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLGDHSHDPSE------PHVVRFKNPTEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +     IP + H+ 
Sbjct: 180 DLIIRRTDGAPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAEIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFSREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------AL 357
           D+H +SK+ + F+ +KL WLN  ++R      E +++   W      +           +
Sbjct: 298 DIHSVSKSASAFNTEKLQWLNQHYMRSL--PAEHVAKYLAWHMNDQNIDTANGPTLEEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++       ++         E +  L    E+      W 
Sbjct: 356 PVLSERAKTLKELASQSRYFYQEFDSYDEKAVAKNF--KAEAVAPLAKLLEKLTACDDWT 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            ENI  A+   A   E  +  +  P  LA+TGS  S  +  + +++G+     RL+ AI 
Sbjct: 414 VENIHDAMNQTAAELEIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGKERTLARLQKAID 473

Query: 478 LVSS 481
            +++
Sbjct: 474 FINA 477


>gi|82750235|ref|YP_415976.1| glutamyl-tRNA synthetase [Staphylococcus aureus RF122]
 gi|118595558|sp|Q2YSD3|SYE_STAAB RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|82655766|emb|CAI80166.1| glutamyl-tRNA synthetase [Staphylococcus aureus RF122]
          Length = 484

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 267/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTD KR+  + E +  
Sbjct: 1   MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER++IYQP +  LL +  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEVERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V G +    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ IS+ PK I++Y+ F +  P F 
Sbjct: 181 GIGDWVIVKKDGIPTYNFAVAIDDHYMEISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +               ++
Sbjct: 300 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + + L Q  ++    +  +++  FK    L  E  +   +  E++ +++     +
Sbjct: 360 LSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEE--EQQVINGEQVPELMTHLFSK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEVAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 NRLKQ 482


>gi|315640332|ref|ZP_07895449.1| glutamate--tRNA ligase [Enterococcus italicus DSM 15952]
 gi|315483994|gb|EFU74473.1| glutamate--tRNA ligase [Enterococcus italicus DSM 15952]
          Length = 485

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 170/489 (34%), Positives = 259/489 (52%), Gaps = 20/489 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + ++
Sbjct: 1   MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIADGEKSQLE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L W G++WDE P   G YGPYRQSERK IYQP +  LL   LA++C+C+ E LE  R A
Sbjct: 61  NLAWLGMDWDESPQTPGNYGPYRQSERKEIYQPLIDQLLASNLAYKCYCTEEELEAERDA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           QR       Y G C  LS ++         + V+R  VP      F D V GE+      
Sbjct: 121 QRAHGEMPHYGGKCANLSPEQQAAKEAAGLEPVIRFRVPKGNEYRFHDMVKGEIVFEAEN 180

Query: 184 V-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           V    V+ K DGMPTY+ A  +DDH+MKITHV RG++ I++ PK +++Y+ F +  PEF 
Sbjct: 181 VGGDFVIQKRDGMPTYNFAVAVDDHMMKITHVLRGDDHIANTPKQLMIYEAFGWTPPEFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
           H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       ++E+   +
Sbjct: 241 HMTLIINAETGKKLSKRDESILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEEEIFSKE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD   LSK+ A FD +KL+W+N  ++++ +           +             
Sbjct: 300 ELIKLFDYERLSKSPAAFDGKKLEWVNNTYMKK-MDVATLTDMCLPYLVKANELSEPITE 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           ++K  L + + L Q +++    +  ++   F+    L         L  E +  +L   +
Sbjct: 359 EKKQWLEKIVALYQPQMSYAQEIVSLSQLFFEEHPTLD--DAAKEVLAGETVPTVLAAFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           E+ E +       ++ A++ V +      K +  P+ +A++G  +   L ++IE+LG+  
Sbjct: 417 EQLEQMNTVDAPTVKAAIKAVQKETGVKGKNLFMPIRVAVSGQMHGPELPNTIELLGKEK 476

Query: 468 VYFRLRHAI 476
               L   +
Sbjct: 477 ALAHLNQVL 485


>gi|229522163|ref|ZP_04411580.1| glutamyl-tRNA synthetase [Vibrio cholerae TM 11079-80]
 gi|229341088|gb|EEO06093.1| glutamyl-tRNA synthetase [Vibrio cholerae TM 11079-80]
          Length = 488

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 17  VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 76

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 77  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 128

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 129 NKEMPRYDANHPKIKAVNEAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 186

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 187 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 246

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 247 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 304

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L+ +SK+ + F+  KL WLN  +I+   S  E++++  +W  E   + +         + 
Sbjct: 305 LNAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFENQGINKATGPALAEVVK 362

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 363 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 420

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+  
Sbjct: 421 EALHHVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALEY 480

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 481 IETREANA 488


>gi|218554939|ref|YP_002387852.1| glutamyl-tRNA synthetase [Escherichia coli IAI1]
 gi|218361707|emb|CAQ99304.1| glutamyl-tRNA synthetase [Escherichia coli IAI1]
          Length = 471

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 247/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKK--YLRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALDFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|170767218|ref|ZP_02901671.1| glutamyl-tRNA synthetase [Escherichia albertii TW07627]
 gi|170123552|gb|EDS92483.1| glutamyl-tRNA synthetase [Escherichia albertii TW07627]
          Length = 471

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPIYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQEKIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAISDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|15894277|ref|NP_347626.1| glutamyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824]
 gi|30316181|sp|Q97KC9|SYE_CLOAB RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|15023897|gb|AAK78966.1|AE007614_14 Glutamyl-tRNA synthetase [Clostridium acetobutylicum ATCC 824]
 gi|325508404|gb|ADZ20040.1| Glutamyl-tRNA synthetase [Clostridium acetobutylicum EA 2018]
          Length = 485

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 176/486 (36%), Positives = 270/486 (55%), Gaps = 9/486 (1%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++++++R R APSPTG  HIG   TAL+ YLIAK   GKFILRIEDTD +R   ++   +
Sbjct: 1   MAANEIRTRFAPSPTGYMHIGNLRTALYTYLIAKHEDGKFILRIEDTDQERYVEDALAVI 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
            ++L+  GL  DEGPD+GG  GPY QSERK +Y  Y + L+EK  A+ CFCS ERL+ ++
Sbjct: 61  YKTLEMTGLKHDEGPDVGGPVGPYVQSERKGLYLDYAKKLVEKGEAYYCFCSKERLDILK 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
                   P +YD HC  LS +E++        +V+R   P  GS  F D +YG + +  
Sbjct: 121 TNSEALKRPFKYDKHCANLSKEEVQEKLDAGVPYVIRQNNPTTGSTTFDDVIYGRISVDN 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +D  +L+KSDG PTY+ ANV+DDHLM ITHV RG E++SS PK+  LY+ F + +P +
Sbjct: 181 SELDDMILIKSDGYPTYNFANVVDDHLMGITHVVRGNEYLSSAPKYNRLYEAFGWNVPIY 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +H P I     SKLSKR    S       GYL EA++N++ALL  +    ++ ++ ++ +
Sbjct: 241 VHCPPIMKDAHSKLSKRNGDASFQDLIEKGYLKEAVLNYIALLGWNPEGTNE-ILSLEDM 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQAL---- 357
           +  FD  H++K+ AVFD  KL W+NG ++R+        + +S +     +    L    
Sbjct: 300 VKLFDYTHINKSPAVFDPVKLKWMNGEYVRKLSLDEFHKAALSYYDGVITKENIDLKKIS 359

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAE--SFKSTALCPEEIIDILKTTQEEFEVIQI 415
            L Q+R+   S +P+M    F        E  + K     PE  +D LK      E I+ 
Sbjct: 360 ELIQTRVEIFSDIPEM-VDFFNELPDYDIEMYTHKKMKTNPEISLDSLKNCLPVIENIED 418

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSL-PLFDSIEILGRSVVYFRLRH 474
           W  +NI+  + N  +       +++ PL  A++G K++    F+  +I+G+     R++ 
Sbjct: 419 WNLDNIQNTIMNYIKDLGVKNGVVLWPLRTALSGKKFTPGGAFEIADIIGKDESIRRIKI 478

Query: 475 AIALVS 480
            I  + 
Sbjct: 479 GIEKLE 484


>gi|325286232|ref|YP_004262022.1| glutamyl-tRNA synthetase [Cellulophaga lytica DSM 7489]
 gi|324321686|gb|ADY29151.1| glutamyl-tRNA synthetase [Cellulophaga lytica DSM 7489]
          Length = 503

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 179/507 (35%), Positives = 252/507 (49%), Gaps = 33/507 (6%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            SSKVRVR APSPTG  HIG   TALFNYL AK+ GG FILRIEDTD  R    +E  ++
Sbjct: 1   MSSKVRVRFAPSPTGPLHIGGVRTALFNYLFAKKNGGDFILRIEDTDQNRYVEGAEQYII 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            SL WCG+ +DEGP   G +GPYRQSERK++Y+ Y   L+    A+  F + E L+E R+
Sbjct: 61  DSLNWCGIAFDEGPGKEGKFGPYRQSERKHLYKEYADELIANGKAYYAFDTAESLDEHRK 120

Query: 123 AQRKRNIPSRYDGHCLKL-------SSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYG 175
                     Y+ H           S +E++      +  V+R   P        D + G
Sbjct: 121 NHEANGKTFIYNWHNRLKLNNSLALSKEEVDTKLANNEPFVIRFKTPENEKLELNDIIRG 180

Query: 176 EMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN 235
            M I  N +D +VL KSDGMPTYHLAN++DDHLM+ITHV RGEEW+ S+  H  LY  F 
Sbjct: 181 TMHIDTNVLDDKVLFKSDGMPTYHLANIVDDHLMEITHVIRGEEWLPSLALHKQLYDAFG 240

Query: 236 FPIPEFIHLPLIKNPDKSKLSKRRN------------PTSISYYSAMGYLPEALINFLAL 283
           +  PEF HLPLI  P       +R+                + Y   GY PEA++NFLAL
Sbjct: 241 WQAPEFAHLPLIMKPVGKGKLSKRDGEKLGFPVFPLSWKESTGYKEEGYFPEAVVNFLAL 300

Query: 284 LFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV 343
           L       + EL  ++QLI  F L  ++K+GA FD  K  W N ++++      E  + +
Sbjct: 301 LG-WNPGTEQELFSLEQLISEFSLERVNKSGARFDPDKTKWYNTQYLQA-KDNAEIATLL 358

Query: 344 SQWMKEKDRLTQAL----------TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTA 393
              +    + T  L           L + R T +  +  + D+ + +      ++ K   
Sbjct: 359 MPTILSHVQETHPLAKQETVERLVDLLKERATFVKDIWDLADYFYVAPKEYAPKAVKKQ- 417

Query: 394 LCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYS 453
              E   DIL       E I  +   N ET ++     +E S   ++ P  L + G    
Sbjct: 418 -WKEGTPDILNQLVSVLESITDFSSINTETIVKEWITDKELSFGKVMPPFRLVLVGDMKG 476

Query: 454 LPLFDSIEILGRSVVYFRLRHAIALVS 480
             +FD +E+LG+     R++ AI  ++
Sbjct: 477 PHVFDIVELLGKEETIKRIQTAIDKLA 503


>gi|320667738|gb|EFX34649.1| glutamyl-tRNA synthetase [Escherichia coli O157:H7 str. LSU-61]
          Length = 471

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 247/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTGKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + +       A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYDDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|242278147|ref|YP_002990276.1| glutamyl-tRNA synthetase [Desulfovibrio salexigens DSM 2638]
 gi|242121041|gb|ACS78737.1| glutamyl-tRNA synthetase [Desulfovibrio salexigens DSM 2638]
          Length = 464

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 163/481 (33%), Positives = 251/481 (52%), Gaps = 22/481 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +K   R APSPTG  HIG A TALF +L+AK  GG F+LRIEDTD +RS  E  +A++ 
Sbjct: 1   MAKTVTRFAPSPTGHLHIGGARTALFAWLLAKHDGGDFVLRIEDTDRERSKQEYTDAILD 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           S+KW G++W           P  QS+R ++Y  Y+  LL++  A+ C C+ E+++ MR  
Sbjct: 61  SMKWLGMDW--------NDEPVYQSDRFDLYNGYIDQLLDEGKAYWCDCTPEQVDAMREK 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             K     +YDG C +       +     +  VVR   P +G   F D + G + +    
Sbjct: 113 AMKEKRKPKYDGSCRE-------KNLGPGENRVVRFKAPLEGRTNFTDMIKGPISVENAE 165

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  +L +SDG PTY+LA V+DDH M +T V RG++ +++ P+ ILLYQ   + +P+F H
Sbjct: 166 MDDMILRRSDGSPTYNLAVVVDDHTMGVTSVLRGDDHVNNTPRQILLYQALGWDVPKFGH 225

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +P+I  PDK KLSKR    S+  Y  MGYLPEA++N+L  L       D E+   ++LI 
Sbjct: 226 VPMILGPDKKKLSKRHGALSVMEYEKMGYLPEAVVNYLVRLGWS--HGDQEIFSREELIE 283

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK----EKDRLTQALTL 359
            F+  +L  + +VFD +KLDW+N  +I+ K          +   +    E   L + + L
Sbjct: 284 LFNTDNLGNSPSVFDTKKLDWVNSEYIKAKAPADLIPGMRTFLPEGVEAEDAYLEKIIPL 343

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            Q R T    +  M DF       L  ++     +   E ++ILK      E    +  +
Sbjct: 344 LQPRSTNYKEMADMCDFFLVDSAALEYDAAAVEKVFKPEAVEILKELTARIEADAEFSHD 403

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSL-PLFDSIEILGRSVVYFRLRHAIAL 478
           ++E   +   + +E   K I +P+ LA+ G   S   L+D + +LG+     R+  A+ L
Sbjct: 404 SLEAVCKGFLEEKELKFKAIGQPVRLALCGRTQSPGGLYDLMLVLGKDETIARMNRAVTL 463

Query: 479 V 479
           V
Sbjct: 464 V 464


>gi|154249365|ref|YP_001410190.1| glutamyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1]
 gi|229470566|sp|A7HKV0|SYE1_FERNB RecName: Full=Glutamyl-tRNA synthetase 1; AltName:
           Full=Glutamate--tRNA ligase 1; Short=GluRS 1
 gi|154153301|gb|ABS60533.1| glutamyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1]
          Length = 469

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 182/479 (37%), Positives = 256/479 (53%), Gaps = 14/479 (2%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S+VRVR APSPTG  H+G A TALFNYL A++TGGKFILRIEDTD +RS    E  ++ 
Sbjct: 1   MSEVRVRFAPSPTGYLHVGGARTALFNYLYARKTGGKFILRIEDTDLERSEKVFEEQLIS 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +LKW GL WDEGPDIGG YGPYRQSER ++Y  Y Q L+E+  A+  +   E +E++R  
Sbjct: 61  ALKWLGLEWDEGPDIGGQYGPYRQSERVHLYHEYAQKLIEEGKAYEVYAYPEEIEQLREK 120

Query: 124 QRKRNIPSRYDGHC--LKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
                    Y         + +  +   ++  K  V  ++  +      D V GE+    
Sbjct: 121 LLSEGKAPHYTREMLEPYNTPERKKEYEEKGLKPAVYFSMLRKDYV-INDVVKGEVVFKA 179

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
            +V    LL+S+GMPTY+ A VIDD LMKITHV RG++ +S+  K + LY+ F +P P F
Sbjct: 180 GSVGDFALLRSNGMPTYNYACVIDDGLMKITHVLRGDDHLSNTVKQVALYEAFGWPTPVF 239

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+ +I  PD SKLSKR   TS+  + + GYLPEAL+NFLALL     E  + ++  Q+L
Sbjct: 240 GHVSMILGPDGSKLSKRHGATSVEEFKSRGYLPEALVNFLALLGWSHPEGKE-ILTKQEL 298

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTT--EFLSRVSQWMKEKDRLTQALTL 359
           I  F L  L K  A+F+ +KL W+N   IR K      +      Q   + +   + L  
Sbjct: 299 IESFSLERLVKNPAIFNPEKLKWMNSEHIRMKSMDELVKIAKPFLQKDVDDEYFAKILHA 358

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            + RI  LS LP++TD  F+    L  +          E I+       E + I+ W ++
Sbjct: 359 VKDRIEELSQLPELTDIFFEKPHQLPEK--------TPEAIETYTNLLSELKKIEKWDKD 410

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           +I  A +   +  +   K     L L +TG      L D +EILG+  V  R+   +  
Sbjct: 411 SIYAAFKTAMKSAKLKGKDFYMTLRLVLTGKTEGPELIDILEILGKDEVIERISLYLNK 469


>gi|227552723|ref|ZP_03982772.1| glutamate--tRNA ligase [Enterococcus faecium TX1330]
 gi|257886074|ref|ZP_05665727.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,231,501]
 gi|257888691|ref|ZP_05668344.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,141,733]
 gi|257897351|ref|ZP_05677004.1| glutamyl-tRNA synthetase [Enterococcus faecium Com12]
 gi|293378887|ref|ZP_06625042.1| glutamate--tRNA ligase [Enterococcus faecium PC4.1]
 gi|293553637|ref|ZP_06674261.1| glutamyl-tRNA synthetase [Enterococcus faecium E1039]
 gi|293572690|ref|ZP_06683658.1| glutamyl-tRNA synthetase [Enterococcus faecium E980]
 gi|227178123|gb|EEI59095.1| glutamate--tRNA ligase [Enterococcus faecium TX1330]
 gi|257821930|gb|EEV49060.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,231,501]
 gi|257824745|gb|EEV51677.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,141,733]
 gi|257833916|gb|EEV60337.1| glutamyl-tRNA synthetase [Enterococcus faecium Com12]
 gi|291602212|gb|EFF32440.1| glutamyl-tRNA synthetase [Enterococcus faecium E1039]
 gi|291607276|gb|EFF36630.1| glutamyl-tRNA synthetase [Enterococcus faecium E980]
 gi|292642428|gb|EFF60583.1| glutamate--tRNA ligase [Enterococcus faecium PC4.1]
          Length = 486

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/490 (34%), Positives = 260/490 (53%), Gaps = 20/490 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD KR+  + E + ++
Sbjct: 1   MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGDFIIRIEDTDQKRNIEDGEKSQLE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L W G++WDE P+  G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R A
Sbjct: 61  NLAWLGMDWDESPENPGEYGPYRQSERKEIYQPLIDQLLASNRAYKCYCTEEELEAEREA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           QR R     Y G C  L+ +E      +  + VVR  VP      F D V G +    + 
Sbjct: 121 QRARGEMPHYAGTCANLTPEEQAEKEAQGLESVVRFRVPRNTEYAFTDMVKGAISFESDN 180

Query: 184 V-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +    V+ K DGMPTY+ A  +DDHLMKITHV RG++ I++ PK +++Y+ F +  P F 
Sbjct: 181 IGGDFVIQKRDGMPTYNFAVAVDDHLMKITHVLRGDDHIANTPKQLMIYEAFGWTPPTFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
           H+ LI N +  K   +R+      I  Y  +GYLP+A+ NF+ALL       +DE+ + Q
Sbjct: 241 HMTLIINSETGKKLSKRDESILQFIEQYRELGYLPDAMFNFIALLGWS-PVGEDEIFEHQ 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD   LSK+ A FD +KL W+N  +I+  +    F      +             
Sbjct: 300 ELIKMFDPKRLSKSPAAFDAKKLQWVNNHYIKA-MDLDAFTDMCLPYLIADGRVAENPDE 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           K  + + + ++L Q +++  + +  ++   F     L         L  E +  +L   +
Sbjct: 359 KTIEWVKKIVSLYQPQMSYAAEIVDLSTLFFNEHPVLNE--AAKEVLAGETVPTVLHAFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
            + E +++     ++ A++ V +      K +  P+ +A++G  +   L ++IE+LGR  
Sbjct: 417 AQLEQMEVVDAPTVKAAIKAVQKETGVKGKNLFMPIRVAVSGQMHGPELPETIELLGREK 476

Query: 468 VYFRLRHAIA 477
               L   + 
Sbjct: 477 SLAHLNQVLN 486


>gi|297208759|ref|ZP_06925187.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|300912849|ref|ZP_07130291.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus TCH70]
 gi|304381874|ref|ZP_07364521.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|296886704|gb|EFH25609.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|300885953|gb|EFK81156.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus TCH70]
 gi|304339660|gb|EFM05607.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|320141608|gb|EFW33447.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           MRSA131]
          Length = 487

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 267/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTD KR+  + E +  
Sbjct: 4   MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF 63

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER++IYQP +  LL +  A++C+ + E LE  R 
Sbjct: 64  DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE 123

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V G +    N
Sbjct: 124 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN 183

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ IS+ PK I++Y+ F +  P F 
Sbjct: 184 GIGDWVIVKKDGIPTYNFAVAIDDHYMQISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG 243

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+   ++
Sbjct: 244 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKEE 302

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +               ++
Sbjct: 303 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEED 362

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + + L Q  ++    +  +++  FK    L  E  +   +  E++ +++     +
Sbjct: 363 LSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEE--EQQVINGEQVPELMTHLFSK 420

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 421 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 480

Query: 470 FRLRH 474
            RL+ 
Sbjct: 481 NRLKQ 485


>gi|310820671|ref|YP_003953029.1| glutamyl-tRNA synthetase [Stigmatella aurantiaca DW4/3-1]
 gi|309393743|gb|ADO71202.1| Glutamyl-tRNA synthetase [Stigmatella aurantiaca DW4/3-1]
          Length = 476

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/483 (32%), Positives = 255/483 (52%), Gaps = 17/483 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +S +RVR APSPTG  HIG A TALFNYL A+R GG FILRIEDTD +RST ES  A++
Sbjct: 1   MASALRVRFAPSPTGYLHIGGARTALFNYLYARRFGGTFILRIEDTDLERSTPESLKAIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW  + WDEGP+  G + PY Q++R + Y+ +   L+    A+RC+C+ E + E R 
Sbjct: 61  DGLKWLDIGWDEGPEKEGPHAPYFQTQRLDTYRDHCDQLIAAGKAYRCYCTQEEIRERRA 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
              K     +Y+G C +       R S  + K         +GS  F D V G++   ++
Sbjct: 121 QAEKEGRAYKYEGTCRERKDVPEGRPSVVRFKMP-----SVEGSVSFDDLVLGKITKEYS 175

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +D  V+L+ DG+P Y+   VIDDHLM IT V+RG+E ++S    ++LYQ   +  P F 
Sbjct: 176 DLDDWVMLRGDGIPLYNYGCVIDDHLMDITVVSRGQEHVNSTFPQLMLYQALGWEPPRFA 235

Query: 243 HLPLIKNPDKSKLSKRRNPTS-ISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           HLPLI  PD+ KLSKR++  + +  + A G LPEAL+NF+  L       ++E++  +Q+
Sbjct: 236 HLPLILGPDREKLSKRKHKEADVMLHKANGILPEALLNFVIRLGWS--HGNEEVISREQM 293

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTT-------EFLSRVSQWMKEKDRLT 354
           I  FD   +     V++  KL WLN  +++    +            +      +  RL 
Sbjct: 294 IEWFDFKDVGSTSGVWNPDKLLWLNQHYLKTLPPSDVAGRLAPFLAQQGQTLAPDDVRLE 353

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + +   + R  TL  +  M     K  + L  ++         + + +L+  +EE   + 
Sbjct: 354 RFVLAFRERAKTLVEMATMALPYLKQGVTLDEKAAAKH--LTADSLALLRQVREEIAALP 411

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            W    ++  ++ V++     +  + +P+ +A+TG+  S  + +++++LG+     RL  
Sbjct: 412 DWSVAALDAVIKTVSERAGVGMGKVAQPVRVAVTGNTTSPGIGETLQLLGKEEALRRLDA 471

Query: 475 AIA 477
           A+A
Sbjct: 472 ALA 474


>gi|206902005|ref|YP_002251003.1| glutamyl-tRNA synthetase [Dictyoglomus thermophilum H-6-12]
 gi|238064688|sp|B5YEP5|SYE_DICT6 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|206741108|gb|ACI20166.1| glutamyl-tRNA synthetase [Dictyoglomus thermophilum H-6-12]
          Length = 477

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 191/486 (39%), Positives = 281/486 (57%), Gaps = 20/486 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
            VRVRIAPSPTG  H+GTA+TALFN+L A+   G FILRIEDTD  RST E E  +++ L
Sbjct: 3   NVRVRIAPSPTGYLHVGTAHTALFNWLFARHNKGTFILRIEDTDLARSTKEYEENIIEGL 62

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           KW GL WDEG        PY Q++R ++Y+ Y   LL+K LA+ C+C+ E LEE R+   
Sbjct: 63  KWLGLYWDEG--------PYYQTQRLDLYRKYADELLKKGLAYYCYCTPEELEERRKEAL 114

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +  P RYD  CL LS +E  R  +E +K  +RL VP   +  F D + GE+E     + 
Sbjct: 115 AQKKPPRYDRKCLYLSDEERARYEREGRKPAIRLLVPEGKTV-FNDIIRGEIEFNNEDIG 173

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V++KSDG+PTY+ A VIDD+ M ITHV RGE+ IS+ PK + +Y  F +  PEF HLP
Sbjct: 174 DFVIMKSDGIPTYNFAVVIDDYTMGITHVIRGEDHISNTPKQLFIYNAFGWTPPEFAHLP 233

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L+  PD+SKLSKR   TS++ Y  MGYLP+AL+N+LALL     E++ E+  +++LI  F
Sbjct: 234 LLLGPDRSKLSKRHGVTSVTEYKKMGYLPQALVNYLALLG-WTPEENREIYTVEELIELF 292

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIRE---------KLSTTEFLSRVSQWMKEKDRLTQA 356
           DL  ++K   +FD  KL+W+N + IR               +      +    K+   + 
Sbjct: 293 DLRRVTKNPGIFDVTKLEWINTQHIRRLSLEELADLTYPFLKEAEWFKEENFNKEYYLKV 352

Query: 357 LTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIW 416
           L+L Q R+ TL+ + +  D+ F  DL    E+ K     P+  +  L+  ++ +  +  +
Sbjct: 353 LSLLQERLKTLAQIKEYADYFFVDDLDYDVETVKKVCKHPDTPL-YLEKIKDVWSQLSEF 411

Query: 417 KRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI 476
             EN+E +L+ +A+  +   K +V P+ +A+T       L++  E+LG+     RL   I
Sbjct: 412 TAENLEASLKKLAEENQIPTKNLVHPIRVALTNKTVGPGLYEIAEVLGKEKTLKRLEKFI 471

Query: 477 ALVSSL 482
             + +L
Sbjct: 472 QFLKTL 477


>gi|312973353|ref|ZP_07787525.1| glutamyl-tRNA synthetase [Escherichia coli 1827-70]
 gi|310331948|gb|EFP99183.1| glutamyl-tRNA synthetase [Escherichia coli 1827-70]
          Length = 471

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E S+  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVSMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALDFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|242372745|ref|ZP_04818319.1| glutamyl-tRNA synthetase [Staphylococcus epidermidis M23864:W1]
 gi|242349518|gb|EES41119.1| glutamyl-tRNA synthetase [Staphylococcus epidermidis M23864:W1]
          Length = 484

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 271/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTDSKR+  + E++  
Sbjct: 1   MSERIRVRYAPSPTGYLHIGNARTALFNYLFAKHYDGDFVVRIEDTDSKRNLEDGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER +IY P +Q LL++  A++C+ + E LEE R 
Sbjct: 61  DNLKWLGLDWDESIDKDKGYGPYRQSERADIYNPLIQQLLDEDKAYKCYMTEEELEEERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ ++ ++   E +K  +R  VP   +  F D V GE+    N
Sbjct: 121 GQIARGEMPRYGGQHAHLTEEQRQQFEAEGRKPSIRFRVPKDKTYTFNDMVKGEISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  +DDH MKI+ V RG++ +S+ PK +++Y+ F +  P F 
Sbjct: 181 NIGDWVIVKKDGVPTYNFAVAVDDHYMKISDVIRGDDHVSNTPKQLMIYEAFGWEPPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ LL      + +E+   ++
Sbjct: 241 HMALIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFITLLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKE 349
            I  FD   LSK+ A+FD+QKL W+N ++++ K + T F   +           +   ++
Sbjct: 300 FIKIFDEKRLSKSPAMFDRQKLAWVNNQYMKTKDTETVFELALPHLIKANLIPENPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
           KD   + + L Q  ++    +  +++  F     L  E  +   +  E++ +++     +
Sbjct: 360 KDWGRKLVALYQKEMSYAGEIVPLSEMFFHEMPELNEE--EQEVVNGEQVPELMNHLYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 SRLQK 482


>gi|298693859|gb|ADI97081.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 484

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 268/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTD KR+  + E +  
Sbjct: 1   MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER++IYQP +  LL +  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V G +    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ IS+ PK I++Y+ F +  P F 
Sbjct: 181 GIGDWVIVKKDGIPTYNFAVAIDDHYMEISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +           +   ++
Sbjct: 300 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEAPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + + L Q  ++    +  +++  FK    L  E  +   +  E++ +++     +
Sbjct: 360 LSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEE--EQQVINGEQVPELMTHLFSK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 NRLKQ 482


>gi|62180986|ref|YP_217403.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224583049|ref|YP_002636847.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|67461593|sp|Q57LU0|SYE_SALCH RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|62128619|gb|AAX66322.1| glutamate tRNA synthetase, catalytic subunit [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|224467576|gb|ACN45406.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322715467|gb|EFZ07038.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 471

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 244/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R   Y   +  +LE   A++C+CS ERLE++R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFERYNAVIDEMLEAGTAYKCYCSKERLEQLREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHDDDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSAITDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|213425516|ref|ZP_03358266.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 471

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 154/487 (31%), Positives = 243/487 (49%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERLE++R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLEQLREDQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS    D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQDGSVFLYDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSAITDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|151220702|ref|YP_001331524.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|172048773|sp|A6QEI0|SYE_STAAE RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|150373502|dbj|BAF66762.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus str.
           Newman]
          Length = 484

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 267/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTD KR+  + E +  
Sbjct: 1   MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER++IYQP +  LL +  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V G +    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ IS+ PK I++Y+ F +  P F 
Sbjct: 181 GIGDWVIVKKDGIPTYNFAVAIDDHYMQISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +               ++
Sbjct: 300 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + + L Q  ++    +  +++  FK    L  E  +   +  E++ +++     +
Sbjct: 360 LSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEE--EQQVINGEQVPELMTHLFSK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFESAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 NRLKQ 482


>gi|218548155|ref|YP_002381946.1| glutamyl-tRNA synthetase [Escherichia fergusonii ATCC 35469]
 gi|218355696|emb|CAQ88308.1| glutamyl-tRNA synthetase [Escherichia fergusonii ATCC 35469]
 gi|323967822|gb|EGB63234.1| glutamyl-tRNA synthetase [Escherichia coli M863]
 gi|327252040|gb|EGE63712.1| glutamyl-tRNA synthetase [Escherichia coli STEC_7v]
          Length = 471

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLTAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|270308530|ref|YP_003330588.1| glutamyl-tRNA synthetase [Dehalococcoides sp. VS]
 gi|270154422|gb|ACZ62260.1| glutamyl-tRNA synthetase [Dehalococcoides sp. VS]
          Length = 484

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 183/490 (37%), Positives = 266/490 (54%), Gaps = 18/490 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +++VRVR APSPTG PH+G   TA+FN+L A+  GGKFI+RIEDTD +R    +  +++
Sbjct: 1   MTNEVRVRYAPSPTGYPHLGNIRTAMFNWLFARHNGGKFIVRIEDTDRERYVEGAVESIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +SL W GL+WDEGPD GG Y PY QSER ++Y+   + L+ +  A+ C CS+ERL++MR 
Sbjct: 61  ESLNWLGLDWDEGPDKGGDYAPYYQSERLSLYRNAAEKLVAEGKAYYCHCSSERLDKMRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R                  +    ++K  V+R  +P  G   F D + GE+     
Sbjct: 121 DQIARK-------EPPGYDQCCRDLCLGQKKGAVIRFKIPRDGQTTFTDLIRGEVTFDNA 173

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
             D  V+LKSDG PTYHLA+V+DDH M+I+HV R EEW+ S PKH+LLY+   +  P + 
Sbjct: 174 KQDDFVILKSDGFPTYHLASVVDDHAMQISHVLRAEEWLPSTPKHLLLYRALGYNPPLYA 233

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           HLP+I  PD+SKLSKR   TS   Y   GYLPE ++NFL+LL     +D  EL    QLI
Sbjct: 234 HLPMILGPDRSKLSKRHGATSTIEYKQAGYLPETMVNFLSLLG-WAYDDKTELFSRNQLI 292

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKD----------R 352
            +F L  +SK  A+F+ +KLDW+NG +IR   +       +    K++            
Sbjct: 293 EYFCLEKVSKTAAIFNYEKLDWMNGMYIRTLSAPDLAGRAIPFLEKDERIAASGRLNLDY 352

Query: 353 LTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEV 412
            T+ + L Q R+  L+ L ++  F++   +           L  E  +  LK        
Sbjct: 353 TTKVMPLIQERVKKLNELAELCWFIYSDCISYDPALLIDKKLTKETSLFALKAANNRLAA 412

Query: 413 IQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRL 472
           +  +   ++E  +R +A   E     +   L  A TG   + PLF ++E+LGR     R+
Sbjct: 413 LANFDAASMEEHIRPLAAELELKPGQLFGMLRTASTGQLVAPPLFQTMEVLGRERCLGRI 472

Query: 473 RHAIALVSSL 482
             AIA +S +
Sbjct: 473 ALAIAKLSEM 482


>gi|297590583|ref|ZP_06949222.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus MN8]
 gi|297576882|gb|EFH95597.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus MN8]
 gi|312439054|gb|ADQ78125.1| glutamate--tRNA ligase [Staphylococcus aureus subsp. aureus TCH60]
          Length = 487

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 267/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTD KR+  + E +  
Sbjct: 4   MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF 63

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER++IYQP +  LL +  A++C+ + E LE  R 
Sbjct: 64  DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE 123

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V G +    N
Sbjct: 124 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN 183

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ IS+ PK I++Y+ F +  P F 
Sbjct: 184 GIGDWVIVKKDGIPTYNFAVAIDDHYMEISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG 243

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+   ++
Sbjct: 244 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKEE 302

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +               ++
Sbjct: 303 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEED 362

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + + L Q  ++    +  +++  FK    L  E  +   +  E++ +++     +
Sbjct: 363 LSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEE--EQQVINGEQVPELMTHLFSK 420

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 421 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 480

Query: 470 FRLRH 474
            RL+ 
Sbjct: 481 NRLKQ 485


>gi|91211740|ref|YP_541726.1| glutamyl-tRNA synthetase [Escherichia coli UTI89]
 gi|117624613|ref|YP_853526.1| glutamyl-tRNA synthetase [Escherichia coli APEC O1]
 gi|218559351|ref|YP_002392264.1| glutamyl-tRNA synthetase [Escherichia coli S88]
 gi|237704924|ref|ZP_04535405.1| glutamyl-tRNA synthetase [Escherichia sp. 3_2_53FAA]
 gi|123266021|sp|Q1R8W9|SYE_ECOUT RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|166200173|sp|A1ADS2|SYE_ECOK1 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|91073314|gb|ABE08195.1| glutamyl-tRNA synthetase [Escherichia coli UTI89]
 gi|115513737|gb|ABJ01812.1| glutamyl-tRNA synthetase [Escherichia coli APEC O1]
 gi|218366120|emb|CAR03865.1| glutamyl-tRNA synthetase [Escherichia coli S88]
 gi|226901290|gb|EEH87549.1| glutamyl-tRNA synthetase [Escherichia sp. 3_2_53FAA]
 gi|294493891|gb|ADE92647.1| glutamyl-tRNA synthetase [Escherichia coli IHE3034]
 gi|307626025|gb|ADN70329.1| glutamyl-tRNA synthetase [Escherichia coli UM146]
 gi|315288153|gb|EFU47553.1| glutamyl-tRNA synthetase [Escherichia coli MS 110-3]
 gi|323949555|gb|EGB45443.1| glutamyl-tRNA synthetase [Escherichia coli H252]
 gi|323955832|gb|EGB51589.1| glutamyl-tRNA synthetase [Escherichia coli H263]
          Length = 471

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 157/487 (32%), Positives = 249/487 (51%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLTAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +     H
Sbjct: 465 AERENQH 471


>gi|225181300|ref|ZP_03734745.1| glutamyl-tRNA synthetase [Dethiobacter alkaliphilus AHT 1]
 gi|225168080|gb|EEG76886.1| glutamyl-tRNA synthetase [Dethiobacter alkaliphilus AHT 1]
          Length = 487

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 175/486 (36%), Positives = 264/486 (54%), Gaps = 13/486 (2%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
            VRVR APSPTG  HIG A +ALFN+L A+R  G  I+R+EDTD  RSTLE E  ++ SL
Sbjct: 3   NVRVRFAPSPTGPLHIGGARSALFNWLFARRYNGTMIVRVEDTDLDRSTLEYEELILDSL 62

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W G++WDEG  +GG  GPYRQ ER +IYQPYV  LLE   A+ C+CS E LE  R+   
Sbjct: 63  RWLGIDWDEGITVGGDNGPYRQRERLDIYQPYVDKLLESGQAYHCYCSEEELEAERQELS 122

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RY G C  LS ++ E       K VVR  VP     V  D V G +    + + 
Sbjct: 123 AKGELPRYLGKCRDLSIKDKEEKCALGVKPVVRFRVPEGQQIVVDDMVRGRVSFDSDGIG 182

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             +++KSDG+PTY+ A V+DD LMK++H+ RGEE +S+ P+ ILLY+   F +P F H+ 
Sbjct: 183 DYIIVKSDGIPTYNFAVVLDDALMKVSHILRGEEHLSNTPRQILLYEALAFELPRFAHIS 242

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           LI   D+SK+SKR   TS+  Y   GYLPEAL+NFLALL      + +E+  +++L   F
Sbjct: 243 LILGEDRSKMSKRHGATSVVQYRNQGYLPEALVNFLALLGWSPEGE-EEIFSIEELTRLF 301

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKEKDRLT 354
            L  +SK+ AVF+  KL W+N  +I+E+     F   +           +   ++ D L 
Sbjct: 302 SLERVSKSPAVFNFAKLKWMNSHYIKEESVERIFPLCLPHLQQAGLAAENPTAEDLDWLK 361

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCP-EEIIDILKTTQEEFEVI 413
           Q +   + ++   + + +     F  +  L  E   + A+   E    ++   +++   +
Sbjct: 362 QVVGAVKDKLEYAAQITEHAAAFFGEEPELDQEDEDAKAVLALETSPAVIAAFRQKALEL 421

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
           Q W  E ++  L+ + + +    K +   + +A++G      L   + +LG   V  RL 
Sbjct: 422 QEWDGETVKAILKGIGKEQGVKGKALFMTVRVAVSGRSQGPDLNALLTLLGPQQVARRLE 481

Query: 474 HAIALV 479
           + +  +
Sbjct: 482 YTLKQL 487


>gi|198243251|ref|YP_002216487.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|238690353|sp|B5FQB0|SYE_SALDC RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|197937767|gb|ACH75100.1| glutamyl-tRNA synthetase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
          Length = 471

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 244/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARHHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R   Y   +  +LE   A++C+CS ERLE++R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFERYNAVIDEMLEAGTAYKCYCSKERLEQLREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SYEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPMYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSAITDWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALGFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|262404554|ref|ZP_06081109.1| glutamyl-tRNA synthetase [Vibrio sp. RC586]
 gi|262349586|gb|EEY98724.1| glutamyl-tRNA synthetase [Vibrio sp. RC586]
          Length = 474

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKAVNEAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 173 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L  +SK+ + F+  KL WLN  +I+   S  E++++  +W  +   + +         + 
Sbjct: 291 LGAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFDHQGINKATGPALAEVVK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 349 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+A 
Sbjct: 407 EALHQVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALAY 466

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 467 IETREVNA 474


>gi|257871412|ref|ZP_05651065.1| glutamyl-tRNA synthetase [Enterococcus gallinarum EG2]
 gi|257805576|gb|EEV34398.1| glutamyl-tRNA synthetase [Enterococcus gallinarum EG2]
          Length = 485

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 166/489 (33%), Positives = 265/489 (54%), Gaps = 20/489 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL A+   G+FI+RIEDTD KR+  + E + ++
Sbjct: 1   MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGEFIIRIEDTDQKRNIEDGEKSQLE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L W G++WDE P   G YGPYRQSER  +YQP +  LL    A++C+C+ E LE  R  
Sbjct: 61  NLAWLGIDWDESPANPGEYGPYRQSERGELYQPLIDQLLASNRAYKCYCTEEELEAEREE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           QR+R     Y G C  L+ +E      +  + V+R  VP      F D V GE+    + 
Sbjct: 121 QRERGEMPHYGGKCANLTPEEQAEKEAQGIQPVIRFRVPRNTEYKFHDMVKGEIVFESDN 180

Query: 184 V-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           V    V+ K DGMPTY+ A  +DDH MKITHV RG++ I++ PK +++Y+ F +  P+F 
Sbjct: 181 VGGDFVIQKRDGMPTYNFAVAVDDHHMKITHVLRGDDHIANTPKQLMIYEAFGWQAPQFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
           H+ LI N +  K   +R+      I  Y  +GYLPEA+ NF+ALL       +DEL    
Sbjct: 241 HMTLIINSETGKKLSKRDESILQFIEQYRELGYLPEAMFNFIALLGWS-PVGEDELFSQS 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD   LSK+ A FD +KL+W+N  ++R ++   +       +            +
Sbjct: 300 ELIQMFDPERLSKSPAAFDAKKLEWVNNHYMR-QMDLDQLTEMCLPYLIKAGRIEEEPSV 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           ++++ L + ++L Q +++  + + ++++  F     L   +     L  E +  +L   +
Sbjct: 359 EKREWLKKIVSLYQPQMSYAAQIVEVSELFFNEHPELD--AAAQEVLAGETVPTVLNAFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
           E+   +       ++ A++ + +      K +  P+ +A++G  +   L D++E+LG+  
Sbjct: 417 EKLTAMTTVDAPTVKAAIKEIQKETGIKGKNLFMPIRVAVSGQTHGPELPDTVELLGKEK 476

Query: 468 VYFRLRHAI 476
               L + +
Sbjct: 477 ALDHLNNVL 485


>gi|255747087|ref|ZP_05421032.1| glutamyl-tRNA synthetase [Vibrio cholera CIRS 101]
 gi|262161369|ref|ZP_06030479.1| glutamyl-tRNA synthetase [Vibrio cholerae INDRE 91/1]
 gi|262167760|ref|ZP_06035462.1| glutamyl-tRNA synthetase [Vibrio cholerae RC27]
 gi|262192123|ref|ZP_06050284.1| glutamyl-tRNA synthetase [Vibrio cholerae CT 5369-93]
 gi|172044573|sp|P0C6Q1|SYE_VIBCH RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|172047752|sp|A5F649|SYE_VIBC3 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|255735489|gb|EET90889.1| glutamyl-tRNA synthetase [Vibrio cholera CIRS 101]
 gi|262023825|gb|EEY42524.1| glutamyl-tRNA synthetase [Vibrio cholerae RC27]
 gi|262028680|gb|EEY47334.1| glutamyl-tRNA synthetase [Vibrio cholerae INDRE 91/1]
 gi|262031972|gb|EEY50549.1| glutamyl-tRNA synthetase [Vibrio cholerae CT 5369-93]
 gi|327484733|gb|AEA79140.1| Glutamyl-tRNA synthetase [Vibrio cholerae LMA3894-4]
          Length = 474

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKAVNDAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 173 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L+ +SK+ + F+  KL WLN  +I+   S  E++++  +W  E   + +         + 
Sbjct: 291 LNAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFENQGINKATGPALAEVVK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 349 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+  
Sbjct: 407 EALHHVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALEY 466

Query: 479 VSSLVQNH 486
           + +   N 
Sbjct: 467 IETREANA 474


>gi|299768531|ref|YP_003730557.1| glutamyl-tRNA synthetase [Acinetobacter sp. DR1]
 gi|298698619|gb|ADI89184.1| glutamyl-tRNA synthetase [Acinetobacter sp. DR1]
          Length = 502

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 227/483 (46%), Positives = 304/483 (62%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNMCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAFYCFATAEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKLS +E+ R  +  + HV+R+ VP +G C F D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLSQEEVTRRLEAGEPHVIRMKVPEEGICKFNDLLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKNDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPKHQLLYQYFGWEMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +Q ++  F
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDERE-VFTLQDMMDSF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+      + L R+  W  ++  L       Q RI 
Sbjct: 301 DIQRVSLGGPIFDVEKLNWLNGQWIKGLTPG-QLLDRLLTWKSDRSTLEDIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F     +TAE F+S  L  E++   L+      E    W  + +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPQITAEMFESKKLTQEQVRQSLQFAIWRLEGQFTWNNDTVSQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A   E  L+  +   F+AI GS  S P+  S+  LG  + + RLR A+ +V    + 
Sbjct: 420 MDLANQMEIKLRDFMPAFFIAIAGSTSSTPVMQSMVTLGPDLTFARLRRALEVVGGPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 EVK 482


>gi|113460601|ref|YP_718666.1| glutamyl-tRNA synthetase [Haemophilus somnus 129PT]
 gi|123131985|sp|Q0I297|SYE_HAES1 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|112822644|gb|ABI24733.1| glutamyl-tRNA synthetase [Haemophilus somnus 129PT]
          Length = 480

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/482 (32%), Positives = 251/482 (52%), Gaps = 24/482 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
           ++KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++
Sbjct: 12  NTKVRTRFAPSPTGYLHVGGARTALYSWLYAKHNQGEFVLRIEDTDLERSTPEATAAILE 71

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            ++W  L W         +GPY Q++R   Y   +  ++E+ LA+RC+C+ ERLE++R +
Sbjct: 72  GMEWLNLAW--------EHGPYFQTKRFERYNQVIDQMIEQGLAYRCYCTKERLEDLRHS 123

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q +     RYD +CL  S   ++        HVVR   P +G+ VF D V G +EI    
Sbjct: 124 QEQNKQKPRYDRYCLHQSEYPVDA------PHVVRFKNPTEGTVVFDDAVRGRIEISNRE 177

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H
Sbjct: 178 LDDLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAH 237

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           + +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I 
Sbjct: 238 VSMINGDDGQKLSKRHGAVSVMQYRDEGYLPEALINYLVRLGWG--HGDQEIFSREEMIA 295

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKL------STTEFLSRVSQWMKEKDRLTQAL 357
            FD+H +SK+ + F+ +KL WLN  ++R              + +          L + +
Sbjct: 296 LFDIHSVSKSASAFNTEKLQWLNQHYMRSLPVEQVATHLEWHMKKHGIDYSNGPNLAEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++   +   ++         E I  L    E+   +  W 
Sbjct: 356 PVLSERCKTLKELAISSRYFYQDVENYDEKAVAKNF--KPEAIKPLAKLAEKLTALSDWT 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            ENI   +   AQ  +  +  +  P  LA+TG   S  +  + +++G+     R+ +AIA
Sbjct: 414 VENIHEVMSQTAQELDIGMGKVGMPFRLAVTGLGQSPSMDITAKLVGKDRTISRINNAIA 473

Query: 478 LV 479
            +
Sbjct: 474 FI 475


>gi|283832200|ref|ZP_06351941.1| glutamate--tRNA ligase [Citrobacter youngae ATCC 29220]
 gi|291071838|gb|EFE09947.1| glutamate--tRNA ligase [Citrobacter youngae ATCC 29220]
          Length = 471

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 156/487 (32%), Positives = 245/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERL+ +R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLDVLREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C               +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----GHEHHAADEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+ +KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTEKLQWLNHHYINALAPEYVATHLQWHIEQENIDTRVGPQLSELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAISEWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G+S    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKSRSVERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|323439797|gb|EGA97514.1| glutamyl-tRNA synthetase [Staphylococcus aureus O11]
 gi|323443101|gb|EGB00721.1| glutamyl-tRNA synthetase [Staphylococcus aureus O46]
          Length = 484

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 172/485 (35%), Positives = 268/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTD KR+  + E +  
Sbjct: 1   MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D G  YGPYRQSER++IYQP +  LL +  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLDWDESVDKGNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V G +    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ IS+ PK I++Y+ F +  P F 
Sbjct: 181 GIGDWVIVKKDGIPTYNFAVAIDDHYMEISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +               ++
Sbjct: 300 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + + L Q  ++    +  +++  FK    L  E  +   +  E++ +++     +
Sbjct: 360 LSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEE--EQQVINGEQVPELMTHLFSK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKVVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 NRLKQ 482


>gi|269965438|ref|ZP_06179557.1| Glutamyl-tRNA synthetase [Vibrio alginolyticus 40B]
 gi|269829917|gb|EEZ84147.1| Glutamyl-tRNA synthetase [Vibrio alginolyticus 40B]
          Length = 475

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 153/487 (31%), Positives = 251/487 (51%), Gaps = 21/487 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ ++
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKNQGGEFVLRIEDTDLERNSQEAVDAILEGME 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   V  LL +  A++C+ S E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTQRFDRYNEMVDKLLAEDKAYKCYASKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +      +++    V+R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKA--ANEAAKDGDPCVIRFRNPKEGSVVFDDQIRGRIEIRNDQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINIYEALGAPVPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y  MGYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDMGYLPAALNNYLVRLGWS--HGDQEIFSQEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLS---TTEFLSRVSQWMKEKDR---LTQALTLA 360
           L+ +SK+ + F+  KL WLN  +I+              + Q   +      +T  + L 
Sbjct: 291 LNAVSKSASAFNTDKLQWLNNHYIKNSDPAYVAEHLQWHLDQQKLDVTNGPAITDVIKLV 350

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  TL  L +   + ++       E+  +         + L+    + E +  W   N
Sbjct: 351 GERCNTLVELAEQIRYFYEDFSEF--EAGAAKKHLRGVAKEPLELALAKVEALTEWTTAN 408

Query: 421 IET-ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           I+   +  V +  E  +  I  PL +A+TG   S  +   +E++G+     R++ A+  +
Sbjct: 409 IKDGVIAAVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMELVGKERCIARIKMALEFI 468

Query: 480 SSLVQNH 486
           +    N 
Sbjct: 469 AEREANA 475


>gi|115377729|ref|ZP_01464921.1| glutamyl-tRNA synthetase [Stigmatella aurantiaca DW4/3-1]
 gi|115365279|gb|EAU64322.1| glutamyl-tRNA synthetase [Stigmatella aurantiaca DW4/3-1]
          Length = 499

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/483 (32%), Positives = 255/483 (52%), Gaps = 17/483 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +S +RVR APSPTG  HIG A TALFNYL A+R GG FILRIEDTD +RST ES  A++
Sbjct: 24  MASALRVRFAPSPTGYLHIGGARTALFNYLYARRFGGTFILRIEDTDLERSTPESLKAIL 83

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW  + WDEGP+  G + PY Q++R + Y+ +   L+    A+RC+C+ E + E R 
Sbjct: 84  DGLKWLDIGWDEGPEKEGPHAPYFQTQRLDTYRDHCDQLIAAGKAYRCYCTQEEIRERRA 143

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
              K     +Y+G C +       R S  + K         +GS  F D V G++   ++
Sbjct: 144 QAEKEGRAYKYEGTCRERKDVPEGRPSVVRFKMP-----SVEGSVSFDDLVLGKITKEYS 198

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +D  V+L+ DG+P Y+   VIDDHLM IT V+RG+E ++S    ++LYQ   +  P F 
Sbjct: 199 DLDDWVMLRGDGIPLYNYGCVIDDHLMDITVVSRGQEHVNSTFPQLMLYQALGWEPPRFA 258

Query: 243 HLPLIKNPDKSKLSKRRNPTS-ISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           HLPLI  PD+ KLSKR++  + +  + A G LPEAL+NF+  L       ++E++  +Q+
Sbjct: 259 HLPLILGPDREKLSKRKHKEADVMLHKANGILPEALLNFVIRLGWS--HGNEEVISREQM 316

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTT-------EFLSRVSQWMKEKDRLT 354
           I  FD   +     V++  KL WLN  +++    +            +      +  RL 
Sbjct: 317 IEWFDFKDVGSTSGVWNPDKLLWLNQHYLKTLPPSDVAGRLAPFLAQQGQTLAPDDVRLE 376

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + +   + R  TL  +  M     K  + L  ++         + + +L+  +EE   + 
Sbjct: 377 RFVLAFRERAKTLVEMATMALPYLKQGVTLDEKAAAKH--LTADSLALLRQVREEIAALP 434

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            W    ++  ++ V++     +  + +P+ +A+TG+  S  + +++++LG+     RL  
Sbjct: 435 DWSVAALDAVIKTVSERAGVGMGKVAQPVRVAVTGNTTSPGIGETLQLLGKEEALRRLDA 494

Query: 475 AIA 477
           A+A
Sbjct: 495 ALA 497


>gi|226953726|ref|ZP_03824190.1| glutamyl-tRNA synthetase [Acinetobacter sp. ATCC 27244]
 gi|226835514|gb|EEH67897.1| glutamyl-tRNA synthetase [Acinetobacter sp. ATCC 27244]
          Length = 502

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 224/483 (46%), Positives = 304/483 (62%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNLCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAFYCFATAEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKL+ +E+++     + HV+R+ VP  G C   D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLTQEEVQQRLAAGEPHVIRMKVPEDGICKINDMLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKTDGLPTYHLANVVDDHLMQITHVLRGEEWLPSAPKHQLLYQYFGWDMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +Q +I +F
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDERE-VFTLQDMIENF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL+WLNG+WI+      + L R+  W  ++  L       Q RI 
Sbjct: 301 DVQRVSLGGPIFDVEKLNWLNGQWIKGLTPG-QLLDRLLSWKSDRQTLEDIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F     ++ E F+S  L  E++   L+      E    W  + +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPQISKEQFESKKLTEEQVRQSLQFAIWRLESQFTWNNDTVSQTL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A   E  L+  +   F+AI GS  S P+  ++  LG  + + RLRHA+ +V S  + 
Sbjct: 420 MDLANQMEIKLRDFMPAFFIAIAGSTSSTPVMQAMVTLGPDLTFARLRHALEIVGSPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 ELK 482


>gi|295695282|ref|YP_003588520.1| glutamyl-tRNA synthetase [Bacillus tusciae DSM 2912]
 gi|295410884|gb|ADG05376.1| glutamyl-tRNA synthetase [Bacillus tusciae DSM 2912]
          Length = 502

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/490 (33%), Positives = 262/490 (53%), Gaps = 15/490 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++   VRVR APSPTG  H+G   TAL N+L A+ TGG+ +LRI+DTD  RS+      +
Sbjct: 3   MTDGSVRVRFAPSPTGALHLGGVRTALLNWLFARHTGGRMVLRIDDTDLARSSEAHLRQI 62

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           ++  +W GL+ DEG + GGA+GPYRQS+R  IY+ ++ +L+ + LA+ C+CS E L+  R
Sbjct: 63  LEGFRWLGLSLDEGIEEGGAFGPYRQSQRLEIYRRHLDHLIRRSLAYPCYCSAEELKASR 122

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            +  K     RY G C  L+  E        ++ V RL V    S V  D V G +E   
Sbjct: 123 ESALKEGRTPRYPGTCRHLTPGERAAREAAGQRPVYRLRVDRDQSVVVDDLVRGRVEFAP 182

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +D  V+ KSDG PTYH A V+DD  M ITHV R EE +S+ P+H++L+Q     +P F
Sbjct: 183 DQLDDFVIFKSDGWPTYHFATVVDDLEMGITHVIRAEEHLSNTPRHVVLFQLLGGRVPAF 242

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+P+I  PD++KLSKR   TS+  + ++G+LP+AL+N+  LL     ++ +E++ + + 
Sbjct: 243 AHVPMILAPDRTKLSKRHGATSVDEFRSLGFLPQALVNYCLLLGWSPGDE-EEIISLDKA 301

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ------ 355
           +  F +  + K  A++D +KL+W+NG ++R  +   +       + +E   ++       
Sbjct: 302 VARFSIDRIVKHAAIYDLRKLEWINGHYLRT-MPLDKVWEYARPFFEEAGFVSPKATEAE 360

Query: 356 ------ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                  L   + R+ TL        + ++       +  +   L   E  D+L+  ++ 
Sbjct: 361 LQAALARLDAVRERVHTLVEAVDAVSYFYRPVTEYDPKGVRK-YLQRPETADLLQEARKV 419

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E  + W    +ET  R++  +R      ++ P  LA+TG      LF+ + +LGR    
Sbjct: 420 LEGAESWDAATLETLYRDLIANRGIKGGELIHPTRLALTGRTVGPGLFEVMALLGREATL 479

Query: 470 FRLRHAIALV 479
            RL  AI  +
Sbjct: 480 DRLAQAIQYL 489


>gi|311029025|ref|ZP_07707115.1| glutamyl-tRNA synthetase [Bacillus sp. m3-13]
          Length = 483

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 173/484 (35%), Positives = 261/484 (53%), Gaps = 18/484 (3%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  HIG A TALFNYL A+   GKFI+RIEDTD KR+    E + ++ LK
Sbjct: 3   VRVRYAPSPTGHLHIGNARTALFNYLFARSQNGKFIIRIEDTDKKRNIAGGEESQLKYLK 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G++WDE  D+GG YGPYRQSER  IY  +   LLEK LA++C+C+ E LE  R  Q  
Sbjct: 63  WLGMDWDESVDVGGEYGPYRQSERNEIYTKFYNELLEKNLAYKCYCTEEELEAEREEQIA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           R     Y G    L+ +E +    E ++  +R  VP      F D V G++    + +  
Sbjct: 123 RGENPNYSGKHSNLTVEEQKAFEAEGREPSIRFRVPKGKEIKFNDMVKGDVSFESDGIGD 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            V++K DG PTY+ A  +DDHLM+I+HV RG++ IS+ PK I++++   + +P F H+ L
Sbjct: 183 FVIVKKDGTPTYNFAVAVDDHLMQISHVLRGDDHISNTPKQIMIFEALGWDVPVFGHMTL 242

Query: 247 IKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHH 304
           I N  + KLSKR       I  Y  +GYLPEAL NF+ALL       ++E+    Q I  
Sbjct: 243 IVNESRKKLSKRDESIIQFIEQYEELGYLPEALFNFIALLGWS-PVGEEEVFSKDQFIEI 301

Query: 305 FDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKDR 352
           FD   LSK+ AVFD  KL W+N ++I+  +     +                    +K  
Sbjct: 302 FDTARLSKSPAVFDTNKLTWMNNQYIKT-MELDRLVDMSLPHLVKAGRLEETMTEDQKVW 360

Query: 353 LTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEV 412
             + + L Q +++  + + ++T+  F++ +    E+     L  E++ +++     E E 
Sbjct: 361 AKELIGLYQEQMSFGAEIVELTEMFFQTHIEYDEEA--KAVLAEEQVPEVMAAFHHELET 418

Query: 413 IQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRL 472
           ++ +  ++I+ A + V +      K +  P+ +A TG  +   L  +I +LG+  V  RL
Sbjct: 419 MEDFSVDHIKAATKAVQKATGHKGKKLFMPIRVATTGQTHGRDLPQTIHLLGKETVLARL 478

Query: 473 RHAI 476
              I
Sbjct: 479 SKLI 482


>gi|69245495|ref|ZP_00603459.1| Glutamyl-tRNA synthetase bacterial/mitochondrial [Enterococcus
           faecium DO]
 gi|257879801|ref|ZP_05659454.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,230,933]
 gi|257882527|ref|ZP_05662180.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,231,502]
 gi|257891642|ref|ZP_05671295.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,231,410]
 gi|257894119|ref|ZP_05673772.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,231,408]
 gi|258614227|ref|ZP_05711997.1| glutamyl-tRNA synthetase [Enterococcus faecium DO]
 gi|260559475|ref|ZP_05831656.1| glutamyl-tRNA synthetase [Enterococcus faecium C68]
 gi|261206626|ref|ZP_05921324.1| glutamyl-tRNA synthetase [Enterococcus faecium TC 6]
 gi|289564987|ref|ZP_06445441.1| glutamyl-tRNA synthetase [Enterococcus faecium D344SRF]
 gi|293564122|ref|ZP_06678528.1| glutamyl-tRNA synthetase [Enterococcus faecium E1162]
 gi|293570058|ref|ZP_06681138.1| glutamyl-tRNA synthetase [Enterococcus faecium E1071]
 gi|294614956|ref|ZP_06694847.1| glutamyl-tRNA synthetase [Enterococcus faecium E1636]
 gi|294618276|ref|ZP_06697858.1| glutamyl-tRNA synthetase [Enterococcus faecium E1679]
 gi|294623058|ref|ZP_06701945.1| glutamyl-tRNA synthetase [Enterococcus faecium U0317]
 gi|314940065|ref|ZP_07847248.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0133a04]
 gi|314942528|ref|ZP_07849367.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0133C]
 gi|314949366|ref|ZP_07852707.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0082]
 gi|314952826|ref|ZP_07855798.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0133A]
 gi|314993741|ref|ZP_07859086.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0133B]
 gi|314994806|ref|ZP_07859938.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0133a01]
 gi|68195746|gb|EAN10183.1| Glutamyl-tRNA synthetase bacterial/mitochondrial [Enterococcus
           faecium DO]
 gi|257814029|gb|EEV42787.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,230,933]
 gi|257818185|gb|EEV45513.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,231,502]
 gi|257828002|gb|EEV54628.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,231,410]
 gi|257830498|gb|EEV57105.1| glutamyl-tRNA synthetase [Enterococcus faecium 1,231,408]
 gi|260074574|gb|EEW62895.1| glutamyl-tRNA synthetase [Enterococcus faecium C68]
 gi|260079119|gb|EEW66812.1| glutamyl-tRNA synthetase [Enterococcus faecium TC 6]
 gi|289163194|gb|EFD11040.1| glutamyl-tRNA synthetase [Enterococcus faecium D344SRF]
 gi|291587430|gb|EFF19314.1| glutamyl-tRNA synthetase [Enterococcus faecium E1071]
 gi|291592242|gb|EFF23860.1| glutamyl-tRNA synthetase [Enterococcus faecium E1636]
 gi|291595492|gb|EFF26803.1| glutamyl-tRNA synthetase [Enterococcus faecium E1679]
 gi|291597531|gb|EFF28695.1| glutamyl-tRNA synthetase [Enterococcus faecium U0317]
 gi|291604040|gb|EFF33568.1| glutamyl-tRNA synthetase [Enterococcus faecium E1162]
 gi|313590990|gb|EFR69835.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0133a01]
 gi|313591841|gb|EFR70686.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0133B]
 gi|313595060|gb|EFR73905.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0133A]
 gi|313598749|gb|EFR77594.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0133C]
 gi|313640665|gb|EFS05245.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0133a04]
 gi|313644197|gb|EFS08777.1| glutamyl-tRNA synthetase [Enterococcus faecium TX0082]
          Length = 486

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 172/490 (35%), Positives = 260/490 (53%), Gaps = 20/490 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD KR+  + E + ++
Sbjct: 1   MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGDFIIRIEDTDQKRNIEDGEKSQLE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L W G+NWDE P+  G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R A
Sbjct: 61  NLAWLGMNWDESPENPGEYGPYRQSERKEIYQPLIDQLLASNRAYKCYCTEEELEAEREA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           QR R     Y G C  L+ +E      +  + VVR  VP      F D V G +    + 
Sbjct: 121 QRARGEMPHYAGTCANLTPEEQAEKEAQGLESVVRFRVPRNTEYAFTDMVKGAISFESDN 180

Query: 184 V-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +    V+ K DGMPTY+ A  +DDHLMKITHV RG++ I++ PK +++Y+ F +  P F 
Sbjct: 181 IGGDFVIQKRDGMPTYNFAVAVDDHLMKITHVLRGDDHIANTPKQLMIYEAFGWTPPTFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
           H+ LI N +  K   +R+      I  Y  +GYLP+A+ NF+ALL       +DE+ + Q
Sbjct: 241 HMTLIINSETGKKLSKRDESILQFIEQYRELGYLPDAMFNFIALLGWS-PVGEDEIFEHQ 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD   LSK+ A FD +KL W+N  +I+  +    F      +             
Sbjct: 300 ELIKMFDPKRLSKSPAAFDAKKLQWVNNHYIKA-MDLDAFTDMCLPYLIADGRVAENPDE 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           K  + + + ++L Q +++  + +  ++   F     L         L  E +  +L   +
Sbjct: 359 KTIEWVKKIVSLYQPQMSYAAEIVDLSTLFFNEHPVLNE--AAKEVLAGETVPTVLHAFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
            + E +++     ++ A++ V +      K +  P+ +A++G  +   L ++IE+LGR  
Sbjct: 417 AQLEQMEVVDAPTVKAAIKAVQKETGVKGKNLFMPIRVAVSGQMHGPELPETIELLGREK 476

Query: 468 VYFRLRHAIA 477
               L   + 
Sbjct: 477 SLAHLNQVLN 486


>gi|304405642|ref|ZP_07387301.1| glutamyl-tRNA synthetase [Paenibacillus curdlanolyticus YK9]
 gi|304345681|gb|EFM11516.1| glutamyl-tRNA synthetase [Paenibacillus curdlanolyticus YK9]
          Length = 486

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 170/485 (35%), Positives = 266/485 (54%), Gaps = 18/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + +VRVR APSPTG  HIG A TALFNYL A+  GGKFI+RIEDTD KR+    E + +
Sbjct: 1   MTQEVRVRYAPSPTGHLHIGNARTALFNYLYARSLGGKFIIRIEDTDVKRNVAGGEESQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           + L+W G++WDE  D+GG YGPYRQ+ER +IY+ Y Q LL++  A+RC+C+ E LE+ R 
Sbjct: 61  KYLQWLGIDWDESIDVGGGYGPYRQTERLDIYREYWQTLLDQGRAYRCYCTEEELEQERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G   +L+ ++ +    E +   +R  V    +  F D V GE+     
Sbjct: 121 EQTARGETPRYSGRHRELTEEQRQAFEAEGRVPSIRFRVQEGKTYKFNDMVKGEISFESE 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A VIDD+LM+I+HV RGE+ IS+ P+ +++Y+   +  P+F 
Sbjct: 181 GMGDFVIVKKDGIPTYNFAVVIDDYLMRISHVLRGEDHISNTPRQLMIYEALGWEPPQFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ALL      + + +   ++
Sbjct: 241 HMTLIVNETRKKLSKRDESIIQFIEQYDQLGYLPEALFNFIALLGWSPEGEQE-MFTREE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
           LI  F+   LSK+ AVFD  KL W+N  ++++       ++     +++           
Sbjct: 300 LISVFNAARLSKSPAVFDTNKLAWMNNEYVKK-TDIDRLVNLCLPHLQKAGRVSAELDAA 358

Query: 350 -KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
               +T  + L Q +I   S +  +T+  F+  +    E   +  L  E++  +L     
Sbjct: 359 AHAWVTDLVQLYQDKIRFASEIVPLTELFFRDAVE--DEGDAAAVLAEEQVPAVLGAFLA 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E    +  ++++  ++ V Q      K +  P+  A+TG  +   L  +I +LG+  V
Sbjct: 417 QVEAAAAFGADDMKAMIKAVQQETGNKGKALFMPIRAALTGQTHGPDLNQTIALLGKDKV 476

Query: 469 YFRLR 473
             RL+
Sbjct: 477 ASRLK 481


>gi|254514690|ref|ZP_05126751.1| glutamyl-tRNA synthetase [gamma proteobacterium NOR5-3]
 gi|219676933|gb|EED33298.1| glutamyl-tRNA synthetase [gamma proteobacterium NOR5-3]
          Length = 493

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 212/487 (43%), Positives = 305/487 (62%), Gaps = 2/487 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R+APSPTG+PH+GTAY ALFN   A+  GG+F+LRIEDTD  RST  SE A++ SL+
Sbjct: 3   VRTRVAPSPTGDPHVGTAYIALFNLCFARAHGGQFVLRIEDTDQARSTASSEQAILNSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEGPDIGG +GPYRQSER  IY  Y Q L++   AF C+   E L+E+R  +R 
Sbjct: 63  WLGLDWDEGPDIGGEHGPYRQSERMEIYGAYAQQLVDAGKAFVCYRRPEELDELRETRRA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDK-VYGEMEIPWNAVD 185
               +      L L  +E+ + S   + +V+R+ VP +         + GE+E+ W+ VD
Sbjct: 123 EGNSTALKHSDLILPQEEVSKRSAAGEPYVIRMMVPEEPGVCRIQDLLRGEIELDWSMVD 182

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
            Q+LLKSDGMPTYHLANV+DDHLM+I+HV RGEEWI+S PKH LLY+YF + +P   HLP
Sbjct: 183 AQILLKSDGMPTYHLANVVDDHLMQISHVIRGEEWINSAPKHQLLYEYFGWEMPMLCHLP 242

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI YY  MG+LPEAL N+L  +     ++ ++   +Q++   F
Sbjct: 243 LLRNPDKSKLSKRKNPTSILYYQRMGFLPEALCNYLGRMGWSMPDEREK-FSLQEMQASF 301

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           D+  +S  G +FD +KL WLNG WIRE L+  +   R+ +W    + L   L   Q R+ 
Sbjct: 302 DIQRVSLGGPIFDVEKLRWLNGMWIREDLTQEQLAQRLVEWAFNAENLAAVLPHLQQRME 361

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       FL   +L L A  F+   + PE+++  L+      E +  W R+ +  A+
Sbjct: 362 ILSDFAPQASFLVSGELTLNAAQFEGLGMEPEQLLKTLQFALWTLEGLSEWDRDTVWGAM 421

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
           + +A  +   ++  + PLF+A++GS+ S+ + D++ +LG  +   R+RHAI  +  + + 
Sbjct: 422 KGLADKQGIKVRDFLAPLFIAVSGSRTSISVVDAMSLLGPDMSRARVRHAIDTLGGVSKK 481

Query: 486 HKKKELK 492
             K+  K
Sbjct: 482 AGKRFEK 488


>gi|282850305|ref|ZP_06259684.1| glutamate--tRNA ligase [Veillonella parvula ATCC 17745]
 gi|282579798|gb|EFB85202.1| glutamate--tRNA ligase [Veillonella parvula ATCC 17745]
          Length = 491

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 169/486 (34%), Positives = 257/486 (52%), Gaps = 16/486 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +SS KV  R APSPTG  HIG A +ALFN+L+A++  G F+LRIEDTD  RST ESE  +
Sbjct: 1   MSSMKV--RFAPSPTGPFHIGGARSALFNWLLARKEKGTFVLRIEDTDLARSTRESEENI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             SL+W G+NWDEG D+GG  GPYRQ+ER ++Y+   Q LL++  A+ C+C+ E L+ +R
Sbjct: 59  KASLQWLGMNWDEGIDVGGNNGPYRQTERLDLYKEVTQRLLDEGKAYECYCTPEELDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           + Q  R    +Y+GHC  L  +   +   E +K  +RL VP   +  F D V G +    
Sbjct: 119 QDQMDRGETPKYNGHCEHLDEETKAKYIAEGRKPTIRLRVPLNKTYAFDDMVRGHVSFES 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           N V   V++KSDG+P Y+ A V+DDH+M ITHV R EE +S+ P+ + +Y+   + +P+F
Sbjct: 179 NGVGDFVIVKSDGIPVYNFAVVMDDHMMGITHVIRAEEHLSNTPRQMAIYEALGWEVPKF 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+ LI   D  K+SKR   TS+  Y  +GYLPEAL+NFLALL     E ++E     +L
Sbjct: 239 GHISLILGKDYKKMSKRHGATSVEQYKQLGYLPEALVNFLALLG-WAPEGEEEFFTQDEL 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WMKEK 350
           I  F +  ++K  AVFD  KL+ +N  +++       F   +                + 
Sbjct: 298 IQAFSMDRVAKNPAVFDIDKLNHINFHYMKNLSDEELFHLCLPHLKEVGLAPDSLNQADI 357

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTA--ESFKSTALCPEEIIDILKTTQE 408
           D LT   +  +  I+  + +           + L    E      L  E    +L   + 
Sbjct: 358 DWLTLLCSTFRDHISYGAQIKDHVGLFMSETVFLEEGHEEELRAVLNEETAPTVLGAFRN 417

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
               +     E ++T ++ V +      K +  P+ +A+TG  +   L + + +LG+   
Sbjct: 418 ALAELDEITPEVVKTTIKAVMKETALKGKFVFMPIRVALTGQMHGPDLNNIVTLLGKEKC 477

Query: 469 YFRLRH 474
             RL +
Sbjct: 478 LHRLDN 483


>gi|330445334|ref|ZP_08308986.1| glutamyl-tRNA synthetase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489525|dbj|GAA03483.1| glutamyl-tRNA synthetase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 474

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 158/488 (32%), Positives = 258/488 (52%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST E+ +A+M+ ++
Sbjct: 3   VKTRFAPSPTGFLHVGGARTALYSWLYAKHMGGEFVLRIEDTDLERSTQEAIDAIMEGME 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W  LNWDEG        PY Q++R + Y   V  LL +  A++C+C  E L+E+R  Q  
Sbjct: 63  WLELNWDEG--------PYYQTKRFDRYNEVVDQLLAEDKAYKCYCPKELLDEIREEQMA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
             +  RYD +  K+        + E     +R   P +G+ VF DK+ G +EI  + +D 
Sbjct: 115 AGVKPRYDANHPKV--VAANAAATEDSPFCIRFRNPKEGTVVFDDKIRGRIEIANSELDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   VIDD  M IT V RGE+ I++ P+ I +Y+    P+PEF H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVIDDWDMGITQVVRGEDHINNTPRQINIYEALGAPVPEFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLP+AL+N+L  L       D E+  +Q++I  F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDEGYLPQALLNYLVRLGWS--HGDQEIFSLQEMIDLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEK--------DRLTQALT 358
           L  +SK+ + F+  KL WLN  +I+   +  E++++  QW  ++          + + + 
Sbjct: 291 LESVSKSASAFNTDKLLWLNNHYIKT--AEPEYVAKYLQWHLDQKEISLENGPAIAEVIK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L + + + ++       E+  +         + L+    + E +  W  
Sbjct: 349 LVGERCNTLIELAEQSRYFYQDFNEF--EAGAAKKHLRPVAKEALELALAKVEALDEWTT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           EN+   +  V +  E  +  +  PL +A+TG   S  +   ++++G+  V  R++ A+A 
Sbjct: 407 ENLHGVIAQVCEELELGMGKVGMPLRVAVTGQGQSPSVDAVMQLIGKERVVARIKMALAY 466

Query: 479 VSSLVQNH 486
           +     N 
Sbjct: 467 IEEREANA 474


>gi|257899913|ref|ZP_05679566.1| glutamyl-tRNA synthetase [Enterococcus faecium Com15]
 gi|257837825|gb|EEV62899.1| glutamyl-tRNA synthetase [Enterococcus faecium Com15]
          Length = 486

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/490 (34%), Positives = 259/490 (52%), Gaps = 20/490 (4%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVRVR APSPTG  HIG A TALFNYL A+   G FI+RIEDTD KR+  + E + ++
Sbjct: 1   MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGDFIIRIEDTDQKRNIEDGEKSQLE 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +L W G++WDE P+  G YGPYRQSERK IYQP +  LL    A++C+C+ E LE  R A
Sbjct: 61  NLAWLGMDWDESPENPGEYGPYRQSERKEIYQPLIDQLLASNRAYKCYCTEEELEAEREA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           QR R     Y G C  L+ +E      +  + VVR  VP      F D V G +    + 
Sbjct: 121 QRVRGEMPHYAGTCANLTPEEQAEKEAQGLESVVRFRVPRNTEYAFTDMVKGAISFESDN 180

Query: 184 V-DMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +    V+ K DGMPTY+ A  +DDHLMKITHV RG++ I++ PK +++Y+ F +  P F 
Sbjct: 181 IGGDFVIQKRDGMPTYNFAVAVDDHLMKITHVLRGDDHIANTPKQLMIYEAFGWTPPTFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP---TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
           H+ LI N +  K   +R+      I  Y  +GYLP+A+ NF+ALL       +DE+   Q
Sbjct: 241 HMTLIINSETGKKLSKRDESILQFIEQYRELGYLPDAMFNFIALLGWS-PVGEDEIFAHQ 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------M 347
           +LI  FD   LSK+ A FD +KL W+N  +I+  +    F      +             
Sbjct: 300 ELIKMFDPKRLSKSPAAFDAKKLQWVNNHYIKA-MDLDAFTDMCLPYLIADGRVAENPDE 358

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           K  + + + ++L Q +++  + +  ++   F     L         L  E +  +L   +
Sbjct: 359 KTIEWVKKIVSLYQPQMSYAAEIVDLSTLFFNEHPVLNE--AAKEVLAGETVPTVLHAFK 416

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
            + E +++     ++ A++ V +      K +  P+ +A++G  +   L ++IE+LGR  
Sbjct: 417 AQLEQMEVVDAPTVKAAIKAVQKETGVKGKNLFMPIRVAVSGQMHGPELPETIELLGREK 476

Query: 468 VYFRLRHAIA 477
               L   + 
Sbjct: 477 SLAHLNQVLN 486


>gi|290770198|gb|ADD61956.1| putative protein [uncultured organism]
          Length = 482

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 184/484 (38%), Positives = 271/484 (55%), Gaps = 9/484 (1%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            +KVR R APSPTG  HIG   TALF YLIAK+ GG FILRIEDTD +R    +   + +
Sbjct: 1   MNKVRTRFAPSPTGYMHIGNLRTALFTYLIAKQNGGDFILRIEDTDQERYVDGAVEVIYK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
           +LK  GLNWDEGPDIGG  GPY QS+R  +++ Y + L+EK  A+ CFC  ERLEE+R  
Sbjct: 61  TLKDVGLNWDEGPDIGGPVGPYIQSQRMGMFKKYAEELVEKGEAYYCFCDKERLEEVRAI 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q    I   YD HC  LS +EI+        +V+R  +P +G   F D++YG++ +  + 
Sbjct: 121 QEASGIAPMYDRHCRNLSPEEIKEKLDAGVPYVIRQKIPTEGEVTFHDELYGDITVDCST 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D Q+L+K+DGMPTY+ ANV+DDHLM ITHV RG E+++S PK+ LLY+ F + IP +IH
Sbjct: 181 LDDQILIKTDGMPTYNFANVVDDHLMGITHVVRGNEYLASAPKYNLLYKAFGWEIPTYIH 240

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +  I    + KLSKR    S       GYL EA+IN++ALL     + ++E+  +++L+ 
Sbjct: 241 VEHIMKDKQHKLSKRDGDASYEDLMKKGYLKEAVINYIALLG-WAPKGENEIFSLEELVK 299

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQAL----TL 359
            FD+H LSK+ A+FD  KL  +NG++I+           +    +   R    L     L
Sbjct: 300 EFDIHGLSKSPAIFDPAKLKAINGKYIKAMTPEKFAEYAIPYIKQSVHRDDVDLNEVAKL 359

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTA--ESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            Q+R    + +P+M      +         + K     PE  ++ LK      E ++ W 
Sbjct: 360 LQARTELFTEIPEM-VDFIDALPEYDIVLYTHKKMKTNPENSLESLKAVLPVLEGVEDWT 418

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLF-DSIEILGRSVVYFRLRHAI 476
            ENI  AL ++         I++ PL +A++G  ++     +   ++G+     R+R  I
Sbjct: 419 EENIHDALFDLIGKLGVKNGIVLWPLRVAVSGKAFTPGGGVEISYLIGKEDTLARIRKGI 478

Query: 477 ALVS 480
             +S
Sbjct: 479 EKLS 482


>gi|153004131|ref|YP_001378456.1| glutamyl-tRNA synthetase [Anaeromyxobacter sp. Fw109-5]
 gi|166200158|sp|A7H9S6|SYE_ANADF RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|152027704|gb|ABS25472.1| glutamyl-tRNA synthetase [Anaeromyxobacter sp. Fw109-5]
          Length = 471

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/482 (33%), Positives = 257/482 (53%), Gaps = 20/482 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K RVR APSPTG  HIG A TALFN+L A+R GG F+LRIEDTD +RST  + +A+   L
Sbjct: 3   KPRVRFAPSPTGYLHIGGARTALFNWLWARRNGGTFVLRIEDTDRERSTQAAVDAIFDGL 62

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GL+WDEGPD+GG +GPY Q++R  IY+ + + L+ +  A+ C+C+ + L+  R+   
Sbjct: 63  RWLGLDWDEGPDVGGPHGPYFQTQRLEIYKTHAEKLIREGKAYACYCTKDVLDAQRKQAE 122

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RY G C +L            + HV+R  VP  GS  F D V G +E P+  + 
Sbjct: 123 AEKRQFRYPGTCRELP-------YDPSRPHVIRFRVPQTGSKTFVDLVKGPIETPYEVLQ 175

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
            +V+L+ DG+P Y+   V+DD  M I  VARG++ +++  + IL+Y+   +P P F HLP
Sbjct: 176 DEVILRGDGVPLYNFGAVVDDVTMAINLVARGDDHVNNTARQILMYEALGYPAPRFAHLP 235

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   DK++LSKR   TS++ Y  MGYLPEA++N+L  L       D EL    +L+  F
Sbjct: 236 MILGADKTRLSKRHGATSVTAYRDMGYLPEAVVNYLVRLGWS--HGDQELFTRDELVRFF 293

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK-------EKDRLTQALT 358
           D   +     VF++ K+ W+N  W+++ LS  E   R   + +       +  +L     
Sbjct: 294 DFKDVGATAGVFNQDKMAWVNHEWLKK-LSDEELARRALPYFQAAGLPAADDAKLRHVCA 352

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           +A+ R  T     Q   + +     +  +         ++   IL+  +     ++  + 
Sbjct: 353 VARERARTFGEYVQQFRYFYA---PVQLDPKAKDKFLTQDTRPILEAIRAGIAALEALET 409

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
             +E    + A  R   L  + +P+ +A+TG   S  ++D ++ILG+     RL  A+ +
Sbjct: 410 AALEKLFHDEAAKRGLGLGKVAQPVRVALTGGTASPGMYDVLQILGKDEALRRLDDALRI 469

Query: 479 VS 480
           + 
Sbjct: 470 IG 471


>gi|262373651|ref|ZP_06066929.1| glutamyl-tRNA synthetase [Acinetobacter junii SH205]
 gi|262311404|gb|EEY92490.1| glutamyl-tRNA synthetase [Acinetobacter junii SH205]
          Length = 502

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 224/483 (46%), Positives = 305/483 (63%), Gaps = 2/483 (0%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL
Sbjct: 2   KVRTRIAPSPTGFPHVGTAYIALFNLCFAKQHGGEFILRIEDTDQLRSTPESEKMILDSL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GLNW EGPD+GG + PYRQSER  IY+ Y   L+EK  AF CF + E L++MR  Q+
Sbjct: 62  RWLGLNWSEGPDVGGPHAPYRQSERMGIYKQYALELVEKGHAFYCFATAEELDQMRAEQQ 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG  LKL+ +E++R     + HV+R+ VP +G C   D + GE+EIPW  VD
Sbjct: 122 ARGETPKYDGRGLKLTQEEVQRRLAAGEPHVIRMKVPEEGVCKINDLLRGEVEIPWAQVD 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
           MQVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+P
Sbjct: 182 MQVLLKTDGLPTYHLANVVDDHLMEITHVLRGEEWLPSAPKHQLLYQYFGWDMPTLCHMP 241

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           L++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ + +  +Q +I +F
Sbjct: 242 LLRNPDKSKLSKRKNPTSINYYRDIGVLPEALLNYLGRMGWSMPDERE-VFTLQDMIENF 300

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRIT 365
           ++  +S  G +FD +KL+WLNG+WI+      + L+R+  W  ++  L       Q RI 
Sbjct: 301 NVQRVSLGGPIFDVEKLNWLNGQWIKSLTPG-QLLARLLTWKSDRQTLEDIAAAIQPRIN 359

Query: 366 TLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETAL 425
            LS       F F     +  E F+S  L  E++   L+      E    W  E +   L
Sbjct: 360 LLSEAVNWAGFYFNHMPQINKEQFESKKLTEEQVRQSLQFAIWRLESQFTWNNETVSQIL 419

Query: 426 RNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQN 485
            ++A   E  L+  +   F+AI GS  S P+  ++  LG  + + RLRHA+ +V +  + 
Sbjct: 420 MDLANQMEIKLRDFMPAFFIAIAGSTSSTPVMQAMVTLGPDLTFARLRHALEIVGAPSKK 479

Query: 486 HKK 488
             K
Sbjct: 480 ELK 482


>gi|320160387|ref|YP_004173611.1| glutamyl-tRNA synthetase [Anaerolinea thermophila UNI-1]
 gi|319994240|dbj|BAJ63011.1| glutamyl-tRNA synthetase [Anaerolinea thermophila UNI-1]
          Length = 497

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 188/495 (37%), Positives = 271/495 (54%), Gaps = 17/495 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
           S  VRVR APSPTG  H+G+  TAL+NYL+A++TGG+FILRIEDTD KR    +E  ++ 
Sbjct: 5   SKPVRVRFAPSPTGRMHLGSGRTALYNYLLARKTGGQFILRIEDTDQKRYVPTAEQELID 64

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            + W GL WDEGPD+GG YGPYRQSERK IY  Y + L+E   A+ CFC+ ERLE++R+ 
Sbjct: 65  GMHWLGLQWDEGPDVGGPYGPYRQSERKEIYLHYARQLVESGHAYYCFCTPERLEKVRQE 124

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q+ R     YDG C  +   E  R     ++HV+R   P +G  V +D + GE+ +    
Sbjct: 125 QQARKEQPHYDGTCRHIDPDEAARRVARGERHVIRFKTPREGVTVVRDLLRGEITVENRL 184

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  V++KSDG+  YHLA ++DDHLMKITHV RG EW+ + P H L+ + F +  PEFIH
Sbjct: 185 IDDYVIVKSDGLALYHLAAMVDDHLMKITHVFRGAEWLPTFPLHALIIRAFGWQEPEFIH 244

Query: 244 LPLIKNPDKSKLSKRRNPTSIS---------YYSAMGYLPEALINFLALLFVHKSEDDDE 294
           L +   P       +R    +           +  +GYLPEA++N++AL+     +  + 
Sbjct: 245 LSVFLKPSGKGKMSKREAADLMKDGYSIFVTDFKDLGYLPEAVVNWIALMGWSYDDHTE- 303

Query: 295 LMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ------WMK 348
              M  LI  F L  L+ + A  +  KLD  NG  IR  LS  +   RV        +  
Sbjct: 304 FFTMPDLIEKFSLEGLNPSPAAINFTKLDHFNGLHIR-HLSLPDLAQRVKPFLVSAGYAV 362

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           + ++L     L Q R+TTL  +  M  F FK ++     +     L P E + + + +  
Sbjct: 363 DDEKLLHIAPLIQPRLTTLDDVVSMAGFFFKDEVEPDPAALVPKGLTPAEAVQVARRSLA 422

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
             E +     E  E  +R + +    S   +   L +A+TG   S PLF+S+EI+GR   
Sbjct: 423 VLEGLPEVSPEVAEPPMRALVEELGLSAGQVFGILRVAVTGQTVSPPLFESMEIIGRETC 482

Query: 469 YFRLRHAIALVSSLV 483
             R+R AI L+ ++V
Sbjct: 483 LKRVRRAIELLEAMV 497


>gi|323705639|ref|ZP_08117213.1| glutamyl-tRNA synthetase [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535116|gb|EGB24893.1| glutamyl-tRNA synthetase [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 485

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 173/486 (35%), Positives = 261/486 (53%), Gaps = 17/486 (3%)

Query: 8   RVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKW 67
           RVR APSPTG  HIG   TALFNYL ++  G K ILRIEDTD  RS+ + E  + + L W
Sbjct: 4   RVRFAPSPTGAIHIGNIRTALFNYLFSRSEGAKLILRIEDTDLTRSSKDFEKLIFKELSW 63

Query: 68  CGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKR 127
            G+ WDEGPD  G YGPYRQSER +IY  Y + L+++  A+RC+C+ E L++ R    KR
Sbjct: 64  LGIEWDEGPDKPGEYGPYRQSERLHIYNEYAEKLIKEGKAYRCYCTPEELDKDREESVKR 123

Query: 128 NIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQ 187
               RY G C  L+ ++ E   ++ +K  +R  +P+  +  F D + G++EI  + +   
Sbjct: 124 GDIPRYSGRCRHLTKEQEEEYLRQGRKPSIRFIIPDDVTISFDDMIKGKIEINSDTLGGD 183

Query: 188 V-LLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           + ++KSDGMPTY+ A V+DD LMKITHV RGE+ I + PK +L+Y+   F  P F H PL
Sbjct: 184 MIIVKSDGMPTYNFAVVVDDTLMKITHVIRGEDHIYNTPKQLLIYEALGFKPPVFAHAPL 243

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD++KLSKR   T I  Y  MGYLPEA+ NFL+LL     ++ +  M   ++I  F+
Sbjct: 244 ILGPDRTKLSKRHGNTYIGQYREMGYLPEAMFNFLSLLSWSPDDNVEL-MSKDEIIKKFN 302

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKEKDRLT 354
            + +  A  VFD +KL+W+N  +I+        +                    + + L 
Sbjct: 303 FNKIHSANPVFDIEKLNWMNQHYIQ-MSPIERIVDLSLPHLKEAGYIGENVDEAKYEWLK 361

Query: 355 QALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQ 414
           + ++L +  +  ++ L       F  D    +E      L   +  ++L   +EE E + 
Sbjct: 362 KVVSLFKDGLHYVAELKDKAKMFFVDDFEYNSE--VKETLLSSDAKNVLTAFKEEIENMD 419

Query: 415 IWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
               E I+  L+ + +      K    P+  A+TG  +   L   I +LG+  +  R+  
Sbjct: 420 EVTEEGIKELLKMLQKKIGVKGKAFFMPIRFALTGQDHGPELVMIIPLLGKHKILQRIDK 479

Query: 475 AIALVS 480
           A+ L+S
Sbjct: 480 ALKLIS 485


>gi|297582424|ref|YP_003698204.1| glutamyl-tRNA synthetase [Bacillus selenitireducens MLS10]
 gi|297140881|gb|ADH97638.1| glutamyl-tRNA synthetase [Bacillus selenitireducens MLS10]
          Length = 484

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 164/487 (33%), Positives = 269/487 (55%), Gaps = 16/487 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S+ +RVR APSPTG  HIG A +ALFNYL A+  GGKFI+RIEDTD  R+   +   +M
Sbjct: 1   MSNDIRVRFAPSPTGHLHIGGARSALFNYLFARNQGGKFIVRIEDTDQARNVETATEKLM 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +S+KW G++WDE  D+GG + PYR  ER ++Y  YV  LL++  AF C+ + E LE  R 
Sbjct: 61  ESMKWLGIDWDESVDVGGPHAPYRSMERLDLYNRYVDQLLKEGKAFHCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            QRKR     Y G    L+ ++      E KK VVR  VP     V  D V G++    +
Sbjct: 121 EQRKRGETPMYSGRDRHLTDEQKRAYEAEGKKPVVRFMVPKGQEIVVDDAVRGKVTFDSD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++++DG+PTY+ A  +DDH M I+HV RGEE +S+ P  ++LY+   F  P F 
Sbjct: 181 GIGDFVIVRTDGIPTYNFAVTVDDHTMGISHVIRGEEHLSNAPLQVMLYEALGFETPTFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H  LI N D+ K+SKR       +  Y  +GY+PEA++NF+ALL      + + +M   +
Sbjct: 241 HASLILNEDRQKMSKRDESIIQFVEQYRDLGYMPEAIVNFIALLGWSPGGEQE-IMTKNE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFL---------SRVSQWMKEKD 351
           LI  F L  + KA AVFD +KL W+N ++++E                  ++ + M ++ 
Sbjct: 300 LIEAFSLDRVVKAPAVFDTKKLSWMNNQYMKEADDDQVVWLAQPHLQKAGKLPEMMSDEQ 359

Query: 352 RLTQA--LTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
           +      + L + ++   + +  +T+  F+ ++    ++     L  E++ ++L+   + 
Sbjct: 360 KQWAYDLIVLHKEKMDCGADIVPLTELFFQDEIEYDEDA--KAILGEEQVPEVLEAFLKN 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            + ++ ++   I+ A+++V +      K +  P+ +A++G ++   L   I +LGR+VV 
Sbjct: 418 LDSLEEFEAAAIKKAMKDVQKSTGHKGKKLFMPIRVAVSGQQHGPDLPQMIALLGRTVVT 477

Query: 470 FRLRHAI 476
            RL+  +
Sbjct: 478 TRLKGLL 484


>gi|303252096|ref|ZP_07338265.1| glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307248298|ref|ZP_07530323.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|302649078|gb|EFL79265.1| glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|306855168|gb|EFM87346.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
          Length = 479

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/484 (33%), Positives = 247/484 (51%), Gaps = 28/484 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHFNGEFVLRIEDTDLERSTPEATAAILEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+ LA+RC+CS ERLE +R  Q 
Sbjct: 74  EWLNLAW--------EHGPYYQTKRFDRYNQVIDQMIEQGLAYRCYCSKERLENLRHEQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL    Q  +        HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLAHHDQPTDA------PHVVRFKNPQEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H+ 
Sbjct: 180 DLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFSREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------AL 357
           D+H +SK+ + F+  KL WLN  ++R      E +++   W      +           +
Sbjct: 298 DIHSVSKSASAFNTDKLQWLNQHYMRSL--PAEHVAKYLAWHMNDQVIDTSNGPALEEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++       ++         E +  L    E+   +  W 
Sbjct: 356 PVLSERAKTLKELAAASRYFYQEFDGYDEKAAAKNF--KAEAVAPLAKLLEKLTALTDWS 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E I  A+   A   E  +  +  P  LA+TGS  S  +  + +++GR     R++ AI 
Sbjct: 414 VEAIHDAMNATAADLEIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGRERTLARIQKAIE 473

Query: 478 LVSS 481
            + +
Sbjct: 474 FIQA 477


>gi|307261751|ref|ZP_07543417.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306868569|gb|EFN00380.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
          Length = 479

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/484 (33%), Positives = 247/484 (51%), Gaps = 28/484 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHFNGEFVLRIEDTDLERSTPEATAAILEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+ LA+RC+CS ERLE +R  Q 
Sbjct: 74  EWLNLAW--------EHGPYYQTKRFDRYNQVIDQMIEQGLAYRCYCSKERLENLRHEQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL    Q  +        HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLAHHDQPTDA------PHVVRFKNPQEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H+ 
Sbjct: 180 DLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFSREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------AL 357
           D+H +SK+ + F+  KL WLN  ++R      E +++   W      +           +
Sbjct: 298 DIHSVSKSASAFNTDKLQWLNQHYMRSL--PAEHVAKYLAWHMNDQAVDTSNGPALEEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++       ++         E +  L    E+   +  W 
Sbjct: 356 PVLSERAKTLKELAAASRYFYQEFDGYDEKAAAKNF--KAEAVAPLAKLLEKLTALTDWS 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E I  A+   A   E  +  +  P  LA+TGS  S  +  + +++GR     R++ AI 
Sbjct: 414 VEAIHDAMNATAADLEIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGRERTLARIQKAIE 473

Query: 478 LVSS 481
            + +
Sbjct: 474 FIQA 477


>gi|323465337|gb|ADX77490.1| glutamyl-tRNA synthetase [Staphylococcus pseudintermedius ED99]
          Length = 484

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 172/487 (35%), Positives = 267/487 (54%), Gaps = 16/487 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S++VRVR APSPTG  HIG A TALFNYL AK   G F++RIEDTDSKR+  + E++  
Sbjct: 1   MSNRVRVRYAPSPTGYLHIGNARTALFNYLFAKHYDGDFVIRIEDTDSKRNLADGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
             LKW GL+WDE  D    YGPYRQSER  IYQP V+ LL +  A++C+ + E LE  R+
Sbjct: 61  DKLKWLGLDWDESVDKDKGYGPYRQSERGEIYQPLVEQLLAEDKAYKCYMTEEELEAERQ 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ +E ++   E +K  +R  VP   +  F D V G +    +
Sbjct: 121 EQIARGEMPRYGGKHAHLTEEERQQFEAEGRKPAIRFRVPQNKTYTFDDMVKGPVTFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
                V++K DG+PTY+ A  +DDH M+I+ V RG++ IS+ PK +++Y+ F +  P F 
Sbjct: 181 NFGDWVIVKKDGVPTYNFAVAVDDHYMEISDVIRGDDHISNTPKQLMIYETFGWEPPRFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N  + KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+    +
Sbjct: 241 HMTLIVNEQRKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKDE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  F    LSK+ A FDKQKL+W+N ++++EK + T F   +                E
Sbjct: 300 FIKIFTEKRLSKSPAFFDKQKLEWINNQYMKEKDAETVFEMTLPHMIKAGLLPESPSEAE 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
            D   + + L Q +++    +  +++  F+ +  L   S +   L  E++  ++     +
Sbjct: 360 LDWGRKLVALYQEQMSYAGEIVPLSELFFRDEKELDEASQE--VLNGEQVPQLMTALYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L +++E+LG+  V 
Sbjct: 418 LEALENFEAAEIKKIIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTMEVLGQDKVL 477

Query: 470 FRLRHAI 476
            R++  +
Sbjct: 478 RRIQSLL 484


>gi|46143501|ref|ZP_00135119.2| COG0008: Glutamyl- and glutaminyl-tRNA synthetases [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 479

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/484 (33%), Positives = 247/484 (51%), Gaps = 28/484 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHFNGEFVLRIEDTDLERSTPEATAAILEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+ LA+RC+CS ERLE +R  Q 
Sbjct: 74  EWLNLAW--------EHGPYYQTKRFDRYNQVIDQMIEQGLAYRCYCSKERLENLRHEQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL    Q  +        HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLAHHDQPTDA------PHVVRFKNPQEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H+ 
Sbjct: 180 DLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFSREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------AL 357
           D+H +SK+ + F+  KL WLN  ++R      E +++   W      +           +
Sbjct: 298 DIHSVSKSASAFNTDKLQWLNQHYMRSL--PAEHVAKYLAWHMNDQAIDTSSGPALEEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++       ++         E +  L    E+   +  W 
Sbjct: 356 PVLSERAKTLKELAAASRYFYQEFDGYDEKAAAKNF--KAEAVAPLAKLLEKLTALTDWS 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E I  A+   A   E  +  +  P  LA+TGS  S  +  + +++GR     R++ AI 
Sbjct: 414 VEAIHDAMNATAADLEIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGRERTLARIQKAIE 473

Query: 478 LVSS 481
            + +
Sbjct: 474 FIQA 477


>gi|258422626|ref|ZP_05685532.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9635]
 gi|257847198|gb|EEV71206.1| glutamyl-tRNA synthetase [Staphylococcus aureus A9635]
          Length = 484

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 267/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTD KR+  + E +  
Sbjct: 1   MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER++IYQP +  LL +  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V G +    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ IS+ PK I++Y+ F +  P F 
Sbjct: 181 GIGDWVIVKKDGIPTYNFAVAIDDHYMEISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +               ++
Sbjct: 300 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + + L Q  ++    +  +++  FK    L  E  +   +  E++ +++     +
Sbjct: 360 LSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEE--EQQVINGEQVPELMMHLFSK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 NRLKQ 482


>gi|260061293|ref|YP_003194373.1| glutamyl-tRNA synthetase [Robiginitalea biformata HTCC2501]
 gi|88785425|gb|EAR16594.1| glutamyl-tRNA synthetase [Robiginitalea biformata HTCC2501]
          Length = 506

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 170/509 (33%), Positives = 258/509 (50%), Gaps = 30/509 (5%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
               VRVR APSPTG  HIG   TALFNYL AK+ GG FILRIEDTD  R    +E  ++
Sbjct: 1   MKQPVRVRFAPSPTGPLHIGGVRTALFNYLFAKKHGGDFILRIEDTDQNRFVKGAEEYIV 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +SL+W G+ +DEGP   G YGPYRQSERK+ Y+ + + L++   A+  F   E L+  R 
Sbjct: 61  ESLEWLGIPFDEGPGKEGGYGPYRQSERKDRYREFAEQLVQSGWAYYAFDRPEALDAHRA 120

Query: 123 AQRKRNIPSRYDGHCLK-------LSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYG 175
              K+     Y+ H  +       +S + ++     +  +V+R   P   +  FQD + G
Sbjct: 121 DHEKKGKTFIYNWHNREKLDNSLGMSPEALQFRLDAEDPYVIRFQWPKDQTLEFQDLIRG 180

Query: 176 EMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN 235
           ++ I  N +D +VL KSDGMPTYHLAN++DDHLM+ITHV RGEEW+ S+  HI LY+ F 
Sbjct: 181 DIRIDTNTLDDKVLFKSDGMPTYHLANIVDDHLMEITHVIRGEEWLPSLALHIQLYRAFG 240

Query: 236 FPIPEFIHLPLIKNPDKSKLSKRRN------------PTSISYYSAMGYLPEALINFLAL 283
           +  P+F HLPLI  P       +R+                + Y   GY PEA++NFLAL
Sbjct: 241 WEAPQFAHLPLIMKPTGKGKLSKRDGEKMGFPVFPLEWKDSAGYRESGYFPEAVLNFLAL 300

Query: 284 LFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLS-- 341
           L       + EL  +++LI  FDL  ++K+GA FD  K  W N +++++K          
Sbjct: 301 LG-WNPGTEQELFSLEELIEAFDLERVNKSGARFDPDKTRWYNHQYLQQKSPAELVPEFR 359

Query: 342 ------RVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALC 395
                        E   L + + L + R   L  + +   + F+       ++ +     
Sbjct: 360 RVLEGRHPFPDSLEDAYLERVVALLRERADFLKDIWEQGSYFFRQPEAYDEKAVRKQ--W 417

Query: 396 PEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLP 455
            E    ++    +  E    +  E++ET++++       S   ++ PL L + G+     
Sbjct: 418 KEGTPQVMARLADLLETRDDFSSEHLETSVKDWIGASGLSFGQVMPPLRLVLVGAMQGPH 477

Query: 456 LFDSIEILGRSVVYFRLRHAIALVSSLVQ 484
           LFD + ++G+     R+R AI  +    +
Sbjct: 478 LFDIMGLIGKDETVGRIRLAIDRLGGSPK 506


>gi|74312942|ref|YP_311361.1| glutamyl-tRNA synthetase [Shigella sonnei Ss046]
 gi|118595555|sp|Q3YZD6|SYE_SHISS RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|73856419|gb|AAZ89126.1| glutamate tRNA synthetase, catalytic subunit [Shigella sonnei
           Ss046]
 gi|323168977|gb|EFZ54655.1| glutamyl-tRNA synthetase [Shigella sonnei 53G]
          Length = 471

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 247/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGRSPALDVTVHAIGKTRSIERINKALDFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|165976693|ref|YP_001652286.1| glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|190150595|ref|YP_001969120.1| glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|307250525|ref|ZP_07532469.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|307263939|ref|ZP_07545542.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|238687574|sp|B0BQK7|SYE_ACTPJ RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|238692399|sp|B3H248|SYE_ACTP7 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|165876794|gb|ABY69842.1| glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|189915726|gb|ACE61978.1| glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|306857418|gb|EFM89530.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|306870701|gb|EFN02442.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 479

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/484 (33%), Positives = 247/484 (51%), Gaps = 28/484 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHFNGEFVLRIEDTDLERSTPEATAAILEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+ LA+RC+CS ERLE +R  Q 
Sbjct: 74  EWLNLAW--------EHGPYYQTKRFDRYNQVIDQMIEQGLAYRCYCSKERLENLRHEQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL    Q  +        HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLAHHDQPTDA------PHVVRFKNPQEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H+ 
Sbjct: 180 DLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFSREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------AL 357
           D+H +SK+ + F+  KL WLN  ++R      E +++   W      +           +
Sbjct: 298 DIHSVSKSASAFNTDKLQWLNQHYMRSL--PAEHVAKYLAWHMNDQAIDTSNGPALEEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++       ++         E +  L    E+   +  W 
Sbjct: 356 PVLSERAKTLKELAAASRYFYQEFDGYDEKAAAKNF--KAEAVAPLAKLLEKLTALTDWS 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E I  A+   A   E  +  +  P  LA+TGS  S  +  + +++GR     R++ AI 
Sbjct: 414 VEAIHDAMNATAADLEIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGRERTLARIQKAIE 473

Query: 478 LVSS 481
            + +
Sbjct: 474 FIQA 477


>gi|163758948|ref|ZP_02166035.1| glutamyl-tRNA synthetase [Hoeflea phototrophica DFL-43]
 gi|162284238|gb|EDQ34522.1| glutamyl-tRNA synthetase [Hoeflea phototrophica DFL-43]
          Length = 485

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 279/484 (57%), Positives = 364/484 (75%), Gaps = 2/484 (0%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           ++++  RVRIAPSPTGEPH+GTAY ALFNYL AK+ GG F+LRIEDTD+ RSTLE E  V
Sbjct: 1   MANTAPRVRIAPSPTGEPHVGTAYIALFNYLFAKKHGGTFVLRIEDTDATRSTLEYEQKV 60

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           + +LKWCGL W EGPD+GGAYGPYRQSERK+IY+PYV+ +++    FRCFC+ +RL+EMR
Sbjct: 61  LDALKWCGLEWSEGPDVGGAYGPYRQSERKDIYRPYVEKIVDNGHGFRCFCTPQRLDEMR 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQR    P +YDGHCLKL+++E+ +  +  + HVVR+ +P +GSC F D VYG +EIPW
Sbjct: 121 EAQRAAGKPPKYDGHCLKLTAEEVTKRVESGEPHVVRMKIPTEGSCKFVDGVYGAVEIPW 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           +AVDMQVLLK+DGMPTYH+ANV+DDHLMKITHVARGEEW++SVPKHIL+YQY     P F
Sbjct: 181 DAVDMQVLLKADGMPTYHMANVVDDHLMKITHVARGEEWLASVPKHILIYQYLGLEPPVF 240

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           +HL L++N DKSKLSKR+NPTSI YY+A+GYLPEAL+NFL L F+ +  + +EL+DM +L
Sbjct: 241 MHLSLMRNADKSKLSKRKNPTSIPYYAALGYLPEALMNFLGLFFI-QIAEGEELLDMDEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQ 361
           +  FD  +LSKAGA+FD QKLDWLNGRW+REKLS  +FL+RV  W  + DRL   L LAQ
Sbjct: 300 VERFDPENLSKAGAIFDIQKLDWLNGRWLREKLSEEQFLTRVQSWAMQDDRLISGLRLAQ 359

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEI-IDILKTTQEEFEVIQIWKREN 420
           SRI T   LP +T FL KSDL L A SF        +  ++I++      E +  W  E 
Sbjct: 360 SRIQTFGDLPDLTGFLLKSDLGLKATSFDGLKKLDYDACLEIIREVAPALEAMPDWTAEA 419

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           IE  LR +++   + L++++ PLF+A++GS  SLPLFDS+ ILGR++V  RL+ A  +++
Sbjct: 420 IEAELRELSESSGRKLRVMLPPLFVAMSGSPRSLPLFDSMAILGRAMVRQRLKAADQVLT 479

Query: 481 SLVQ 484
           +   
Sbjct: 480 AATN 483


>gi|223042881|ref|ZP_03612929.1| glutamyl-tRNA synthetase [Staphylococcus capitis SK14]
 gi|314932751|ref|ZP_07840120.1| glutamate--tRNA ligase [Staphylococcus caprae C87]
 gi|222443735|gb|EEE49832.1| glutamyl-tRNA synthetase [Staphylococcus capitis SK14]
 gi|313654432|gb|EFS18185.1| glutamate--tRNA ligase [Staphylococcus caprae C87]
          Length = 484

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 171/485 (35%), Positives = 273/485 (56%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTDSKR+  + E++  
Sbjct: 1   MSERIRVRYAPSPTGYLHIGNARTALFNYLFAKHYDGDFVVRIEDTDSKRNLEDGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    +GPYRQSER +IY P +Q LL++  A++C+ + E LEE R 
Sbjct: 61  DNLKWLGLDWDESIDKDKGFGPYRQSERADIYNPLIQQLLDEDRAYKCYMTEEELEEERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    LS ++ ++   E +K  +R  VP   +  F+D V GE+    N
Sbjct: 121 AQIARGEMPRYGGQHAHLSEEQRKQFEAEGRKPSIRFRVPKDKTYSFKDMVKGEISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  +DDH MKI+ V RG++ +S+ PK +++Y+ F +  P F 
Sbjct: 181 NMGDWVIVKKDGVPTYNFAVAVDDHYMKISDVIRGDDHVSNTPKQLMIYEAFGWEPPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ LL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFITLLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKE 349
            I  FD   LSK+ A+FD+QKL W+N ++++ K + T F   +           +   ++
Sbjct: 300 FIKIFDEKRLSKSPAMFDRQKLAWVNNQYMKTKDTDTVFELALPHLIKANLIPENPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
           K+   + + L Q  ++    +  +++  F     L  E  +   +  E++ +++     +
Sbjct: 360 KEWGRKLVALYQKEMSYAGEIVPLSEMFFHEMPELGEE--EQEVINGEQVPELMNHLYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 SRLQK 482


>gi|156933034|ref|YP_001436950.1| glutamyl-tRNA synthetase [Cronobacter sakazakii ATCC BAA-894]
 gi|166200174|sp|A7MKV5|SYE_ENTS8 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|156531288|gb|ABU76114.1| hypothetical protein ESA_00841 [Cronobacter sakazakii ATCC BAA-894]
          Length = 471

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 243/487 (49%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNQGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +L    A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDEMLAAGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQDGSVVFDDQIRGPIEFSNLELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALGAPVPLYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFSREEMIKFF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 ALDAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   +  W  E
Sbjct: 347 LGERCKTLKEMAQTCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLSALTDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G+S    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPGLDVTVHAIGKSRSVERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|157144672|ref|YP_001451991.1| glutamyl-tRNA synthetase [Citrobacter koseri ATCC BAA-895]
 gi|166200169|sp|A8ADJ2|SYE_CITK8 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|157081877|gb|ABV11555.1| hypothetical protein CKO_00396 [Citrobacter koseri ATCC BAA-895]
          Length = 471

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 157/487 (32%), Positives = 246/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----GHEHHSDDEPCVVRFANPQDGSVIFDDQIRGSIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLNAVSKSASAFNTDKLLWLNHHYINSLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITEWSAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G+S    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKSRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|82777801|ref|YP_404150.1| glutamyl-tRNA synthetase [Shigella dysenteriae Sd197]
 gi|309784874|ref|ZP_07679507.1| glutamyl-tRNA synthetase [Shigella dysenteriae 1617]
 gi|118595554|sp|Q32DE6|SYE_SHIDS RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|81241949|gb|ABB62659.1| glutamate tRNA synthetase, catalytic subunit [Shigella dysenteriae
           Sd197]
 gi|308927244|gb|EFP72718.1| glutamyl-tRNA synthetase [Shigella dysenteriae 1617]
          Length = 471

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 247/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYD  C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDDRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|146298767|ref|YP_001193358.1| glutamyl-tRNA synthetase [Flavobacterium johnsoniae UW101]
 gi|187470990|sp|A5FL73|SYE_FLAJO RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|146153185|gb|ABQ04039.1| glutamyl-tRNA synthetase [Flavobacterium johnsoniae UW101]
          Length = 501

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 169/505 (33%), Positives = 267/505 (52%), Gaps = 32/505 (6%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S +VRVR APSPTG  HIG   TALFNYL AK+  G F LRIEDTD  R    +E  +M
Sbjct: 1   MSKQVRVRFAPSPTGPLHIGGVRTALFNYLFAKKHNGVFYLRIEDTDQTRFVPGAEAYIM 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++L+W G++ +E       +GPYRQS+RK++YQ Y   L+    A+  F + E L+  R+
Sbjct: 61  EALEWLGISPEETVGKNEKFGPYRQSDRKDLYQKYADQLINSGWAYYAFDTPEALDAHRK 120

Query: 123 AQRKRNIPSRYDGHCLK-------LSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYG 175
                     Y+ H  +       +S++E  +     + +V+R   P   +   +D + G
Sbjct: 121 QHEAEGKTFIYNHHNREKLDTSLVISAEETAKRIANGEHYVIRFKTPVDETLHLKDIIRG 180

Query: 176 EMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN 235
           +++   N +D +VL KSDGMPTYHLAN++DDHLM+ +HV RGEEW+ S+P H+LLY+ F 
Sbjct: 181 DVKFETNLLDDKVLFKSDGMPTYHLANIVDDHLMETSHVIRGEEWLPSMPLHVLLYRAFG 240

Query: 236 FPIPEFIHLPLIKNPDKSKLSKRRNPTSISY----------------YSAMGYLPEALIN 279
           +  PEF HLPLI  P  +    +R+   + +                Y   G+ PEA++N
Sbjct: 241 WDAPEFAHLPLILKPVGNGKLSKRDGDKLGFPVFPLEWKTEEGVSSGYREKGFFPEAVVN 300

Query: 280 FLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTE- 338
           FLALL       D EL  +++L+  FDL+ + KAGA FD +K  W N +++ ++      
Sbjct: 301 FLALLG-WNDGTDKELFSLEELVEAFDLNRVHKAGAKFDPEKNKWFNHQYLIKQNDADLA 359

Query: 339 --FLSRVSQWMKEKD--RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTAL 394
             F + + +          T+ ++L + R   +S    +TDF F++         K++  
Sbjct: 360 KSFSTILEEKGFSTPLEVTTRIVSLIKERAHFVSEFWDLTDFFFQAPSSYDE---KASKN 416

Query: 395 CPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSL 454
             EE   ++K      E I+ +   NIET ++      E  +  +++P  L++ G+    
Sbjct: 417 WKEETPALMKELISVLENIEDFTSANIETIVKEWLTKNEIGMGKVMQPFRLSLVGALKGP 476

Query: 455 PLFDSIEILGRSVVYFRLRHAIALV 479
            LFD +EI+G+     R++ AI+ +
Sbjct: 477 HLFDIVEIIGKEETVSRIQKAISAL 501


>gi|269798078|ref|YP_003311978.1| glutamyl-tRNA synthetase [Veillonella parvula DSM 2008]
 gi|269094707|gb|ACZ24698.1| glutamyl-tRNA synthetase [Veillonella parvula DSM 2008]
          Length = 489

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 168/486 (34%), Positives = 257/486 (52%), Gaps = 16/486 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +SS KV  R APSPTG  HIG A +ALFN+L+A++  G F+LRIEDTD  RST ESE  +
Sbjct: 1   MSSMKV--RFAPSPTGPFHIGGARSALFNWLLARKEKGTFVLRIEDTDLTRSTRESEENI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             SL+W G+NWDEG D+GG  GPYRQ+ER ++Y+   Q LL++  A+ C+C+ E L+ +R
Sbjct: 59  KASLQWLGMNWDEGIDVGGNNGPYRQTERLDLYKEVTQRLLDEGKAYECYCTPEELDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           + Q +R    +Y+GHC  L  +   +   E +K  +RL VP   +  F D V G +    
Sbjct: 119 QDQMERGETPKYNGHCEHLDEETKAKYIAEGRKPTIRLRVPLNKTYAFDDMVRGHVSFES 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           N V   V++KSDG+P Y+ A V+DDH+M ITHV R EE +S+ P+ + +Y+   + +P+F
Sbjct: 179 NGVGDFVIVKSDGIPVYNFAVVMDDHMMGITHVIRAEEHLSNTPRQMAIYEALGWEVPKF 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+ LI   D  K+SKR   TS+  Y  +GYLPEAL+NFLALL     E ++E     +L
Sbjct: 239 GHISLILGKDYKKMSKRHGATSVEQYKQLGYLPEALVNFLALLG-WAPEGEEEFFTQDEL 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WMKEK 350
           I  F +  ++K  AVFD  KL+ +N  +++       F   +                + 
Sbjct: 298 IQAFSMDRVAKNPAVFDIDKLNHINFHYMKNLSDEELFHLCLPHLKEVGLAPDSLNQADI 357

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTA--ESFKSTALCPEEIIDILKTTQE 408
           D LT   +  +  I+  + +           + L    E      L  E    +L   + 
Sbjct: 358 DWLTLLCSTFRDHISYGAQIKDHVGLFMGETVFLEEGHEEELRAVLNEETASIVLCAFRN 417

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
               +     E ++  ++ V +      K +  P+ +A+TG  +   L + + +LG+   
Sbjct: 418 ALAELDEITPEVVKATIKAVMKETSLKGKFVFMPIRVALTGQMHGPDLNNIVTLLGKEKC 477

Query: 469 YFRLRH 474
             RL +
Sbjct: 478 LHRLDN 483


>gi|57651404|ref|YP_185460.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL]
 gi|67461618|sp|Q5HIE7|SYE_STAAC RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|57285590|gb|AAW37684.1| glutamyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL]
          Length = 484

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 170/485 (35%), Positives = 267/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTD KR+  + E +  
Sbjct: 1   MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIEDTDKKRNLEDGETSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER++IYQP +  LL +  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V G +    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQTYSFDDMVKGNISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDDH M+I+ V RG++ IS+ PK I++Y+ F +  P F 
Sbjct: 181 GIGDWVIVKKDGIPTYNFAVAIDDHYMQISDVIRGDDHISNTPKQIMIYEAFGWEPPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ALL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFIALLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  FD   LSK+ A FDKQKL W+N +++++K + T F   +               ++
Sbjct: 300 FIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQLALPHLIKANLIPEVPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
                + + L Q  ++    +  +++  FK    L  E  +   +  +++ +++     +
Sbjct: 360 LSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEE--EQQVINGKQVPELMTHLFSK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFESAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKEKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 NRLKQ 482


>gi|261409543|ref|YP_003245784.1| glutamyl-tRNA synthetase [Paenibacillus sp. Y412MC10]
 gi|329925593|ref|ZP_08280434.1| glutamate--tRNA ligase [Paenibacillus sp. HGF5]
 gi|261286006|gb|ACX67977.1| glutamyl-tRNA synthetase [Paenibacillus sp. Y412MC10]
 gi|328939722|gb|EGG36064.1| glutamate--tRNA ligase [Paenibacillus sp. HGF5]
          Length = 487

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 179/489 (36%), Positives = 267/489 (54%), Gaps = 18/489 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + +VRVR APSPTG  HIG A TALFNYL A++  GKFI+RIEDTD KR+    E + +
Sbjct: 1   MTGEVRVRYAPSPTGHLHIGNARTALFNYLFARKNNGKFIIRIEDTDVKRNVEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           + LKW G++WDE  D+GG YGPYRQ+ER +IY+ Y Q+LL++ LA+RC+C+ E LE+ R 
Sbjct: 61  KYLKWLGMDWDESVDVGGEYGPYRQTERLDIYKEYWQDLLDRGLAYRCYCTEEELEQERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ ++ + L  E +   +R  VP      F D V G +     
Sbjct: 121 EQMARGETPRYSGKHRDLTEEQRQALEAEGRVASIRFRVPEDRVYTFDDMVKGTISFNSK 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
                V++K DG+PTY+ A  +DDHLMKI+HV RGE+ IS+ P+ +++Y+ F +  P+F 
Sbjct: 181 ETGDFVIVKKDGIPTYNFAVALDDHLMKISHVLRGEDHISNTPRQLMIYEAFGWEPPQFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI   D  KLSKR       I  Y  +GYLPEAL NF++LL      + +E+   +Q
Sbjct: 241 HMTLIVGEDHKKLSKRNESIIQFIEQYDQLGYLPEALFNFISLLGWSPEGE-EEVFSQEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------ 348
           LI  FD H LSK+ AVFD  KL  +N  +I+               ++            
Sbjct: 300 LISIFDEHRLSKSPAVFDTNKLAHMNNTYIKN-ADPDRIADLAIPHLQKASRLPSELTAE 358

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           +++     + L Q ++T  S +  +++  F++ L L AE  +   +  E++  +L     
Sbjct: 359 QEEWARALVALYQEQMTAASDIVDLSEVFFRTHLELDAEGIE--VMGGEQVPAVLSAFLA 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E    +  + I   ++ V +      K +  P+ +A+TG  +   L  +I +LGR  V
Sbjct: 417 KIEQSDEFNAQKIAAMIKEVQKETGFKGKQLFMPIRVALTGQTHGRDLNQTIWLLGRDRV 476

Query: 469 YFRLRHAIA 477
             RLR  I 
Sbjct: 477 LDRLRSQIK 485


>gi|303250644|ref|ZP_07336841.1| glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307252908|ref|ZP_07534796.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307257328|ref|ZP_07539098.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|302650632|gb|EFL80791.1| glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306859546|gb|EFM91571.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306864178|gb|EFM96091.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
          Length = 479

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 163/483 (33%), Positives = 248/483 (51%), Gaps = 26/483 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHFNGEFVLRIEDTDLERSTPEATAAILEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+ LA+RC+CS ERLE +R  Q 
Sbjct: 74  EWLNLAW--------EHGPYYQTKRFDRYNQVIDQMIEQGLAYRCYCSKERLENLRHEQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL    Q  +        HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLAHHDQPTDA------PHVVRFKNPQEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H+ 
Sbjct: 180 DLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFSREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQA-------LT 358
           D+H +SK+ + F+  KL WLN  ++R  L        ++  M ++   T         + 
Sbjct: 298 DIHSVSKSASAFNTDKLQWLNQHYMRS-LPVEHVAKYLAWHMNDQAIDTSNGPALEEIIP 356

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           +   R  TL  L   + + ++       ++         E +  L    E+   +  W  
Sbjct: 357 VLSERAKTLKELAAASRYFYQEFDGYDEKAAAKNF--KAEAVAPLAKLLEKLTALTDWSV 414

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E I  A+   A   E  +  +  P  LA+TGS  S  +  + +++GR     R++ AI  
Sbjct: 415 EAIHDAMNATAADLEIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGRERTLARIQKAIEF 474

Query: 479 VSS 481
           + +
Sbjct: 475 IQA 477


>gi|240950080|ref|ZP_04754381.1| glutamyl-tRNA synthetase [Actinobacillus minor NM305]
 gi|240295436|gb|EER46194.1| glutamyl-tRNA synthetase [Actinobacillus minor NM305]
          Length = 479

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/484 (33%), Positives = 248/484 (51%), Gaps = 28/484 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHNNGEFVLRIEDTDLERSTPEATAAIIEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+  A+RC+CS ERL+E+R  Q 
Sbjct: 74  EWLNLAW--------EHGPYFQTKRFDRYNQVIDQMIEEGTAYRCYCSKERLDELRANQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL   S +          HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLGDHSHDPSE------PHVVRFKNPTEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +     IP + H+ 
Sbjct: 180 DLIIRRTDGAPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAEIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFTREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------AL 357
           D+H +SK+ + F+ +KL WLN  ++R      E +++   W      +           +
Sbjct: 298 DIHSVSKSASAFNTEKLQWLNQHYMRSL--PAEHVAKYLAWHMNDQNIDTANGPTLEEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++       ++         E I  L    E+      W 
Sbjct: 356 PVLSERAKTLKELASQSRYFYQEFDSYDEKAVAKNF--KAEAIAPLAKLLEKLTACDDWT 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            ENI  A+   A   E  +  +  P  LA+TGS  S  +  + +++G+     RL+ AI 
Sbjct: 414 VENIHDAMNQTAAELEIGMGKVGMPFRLAVTGSAQSPSMDITAKLVGKERTLTRLQKAID 473

Query: 478 LVSS 481
            +++
Sbjct: 474 FINA 477


>gi|237732396|ref|ZP_04562877.1| glutamyl-tRNA synthetase [Citrobacter sp. 30_2]
 gi|226907935|gb|EEH93853.1| glutamyl-tRNA synthetase [Citrobacter sp. 30_2]
          Length = 471

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 243/487 (49%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+   G+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHDGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERL+ +R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKERLDALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYDG C               +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 ANGEKPRYDGRCRH-----GHEHHAADEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFTREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+ +KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTEKLQWLNHHYINSLAPEYVATHLQWHIEQENIDTRVGPQLSELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAISEWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G+S    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKSRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERESQQ 471


>gi|222152123|ref|YP_002561283.1| glutamyl-tRNA synthetase [Macrococcus caseolyticus JCSC5402]
 gi|222121252|dbj|BAH18587.1| glutamyl-tRNA synthetase [Macrococcus caseolyticus JCSC5402]
          Length = 484

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 177/487 (36%), Positives = 271/487 (55%), Gaps = 16/487 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            SKVRVR APSPTG  HIG A TALFNYL A+  GG FI+RIEDTD+ R+    E + ++
Sbjct: 1   MSKVRVRYAPSPTGFLHIGNARTALFNYLFARHNGGDFIIRIEDTDTARNVEGGEASQLK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            L+W G++WDE  D  G +GPYRQSER +IY P ++ LL +  A+RC+ + E LE  R A
Sbjct: 61  FLQWLGIDWDESIDKDGGFGPYRQSERADIYNPIIEKLLAEDKAYRCYMTAEELEAEREA 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q  R    RY G    L+ +E E L  E +K  +R+ VP      F D V GE+    N 
Sbjct: 121 QLARGEMPRYGGKHAHLTKEEEEALIAEGRKPAIRIRVPKDKVYTFNDMVKGEVSFDSNG 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +   V++K DG+PTY+ A  IDDH M+ITHV RG++ IS+ PK +++Y+   + IP F H
Sbjct: 181 IGDWVIVKKDGIPTYNFAVAIDDHFMEITHVIRGDDHISNTPKQMMVYEALGYEIPTFGH 240

Query: 244 LPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           + LI N D+ KLSKR       I  Y  +GYLPEAL NF+ LL      + +E+   +Q 
Sbjct: 241 MTLIVNEDRKKLSKRDGSIIQFIEQYHDLGYLPEALFNFIGLLGWSPEGE-EEIFTKEQF 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKEK 350
           I  FD   LSK+ A FDKQKL W+N ++++ K   T F   +               +E 
Sbjct: 300 IEMFDEKRLSKSPAFFDKQKLAWINNQYMKTKDLDTVFEMTLPHMKKAELVSEQPTDEEL 359

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEF 410
                 + L Q +++    + ++++  F+ ++ L     +S  +  E++ ++ ++   + 
Sbjct: 360 AWAKALVGLYQEQMSYAGEIVELSELFFRDEIELGE--AESEVINGEQVPELAQSLVGQL 417

Query: 411 EVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
           E +  +   +I+ A+++V +      K +  P+ +  TG  +   L +++E+LGR  V  
Sbjct: 418 EALDTFDAASIKGAIKSVQKETGIKGKNLFMPIRVMTTGQMHGPELPNTLELLGREKVIA 477

Query: 471 RLRHAIA 477
           R++  + 
Sbjct: 478 RVQKYVK 484


>gi|78222945|ref|YP_384692.1| glutamyl-tRNA synthetase [Geobacter metallireducens GS-15]
 gi|115305767|sp|Q39UV7|SYE_GEOMG RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|78194200|gb|ABB31967.1| glutamyl-tRNA synthetase [Geobacter metallireducens GS-15]
          Length = 465

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 160/484 (33%), Positives = 258/484 (53%), Gaps = 26/484 (5%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S VR+R APSPTG  H+G A TALFN+L++++  G FILRIEDTD  RST ES +A++Q
Sbjct: 1   MSDVRLRFAPSPTGYLHVGGARTALFNWLLSRKEKGTFILRIEDTDVARSTQESVDAILQ 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            + W GL WDEG        P+ QSER  +Y+ +V+ L+ +  A+RC+C++E LE  R  
Sbjct: 61  GMAWLGLGWDEG--------PFYQSERFPVYKEFVEKLVAEGKAYRCYCTSEALEAKREL 112

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             K     +YDG C     +  ++       +V+R   P++G  VF D + G +    + 
Sbjct: 113 AMKEGRKPKYDGTCRNGVEEPGDK------PYVIRFKAPHEGVTVFDDLIKGRIAFNNDE 166

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
           +D  ++ +SDG PTY+   VIDD  M IT V RG++ I++ P+ ILLY+   +P+P F H
Sbjct: 167 LDDLIIQRSDGTPTYNFVVVIDDATMGITTVIRGDDHINNTPRQILLYEALGYPVPRFAH 226

Query: 244 LPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           +P+I   DK++LSKR   TS+  Y  MG+LPEA++N+L  L       D E+   ++LI 
Sbjct: 227 VPMILGADKTRLSKRHGATSVMAYRDMGFLPEAMVNYLVRLGWS--HGDQEIFSREELIE 284

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ-------A 356
            F +  + K+  VF+  KL WLN  +I+E  S       +  +MKE+  + +        
Sbjct: 285 KFSIEAVGKSAGVFNPDKLLWLNHHYIKESAS-ERLAELLIPFMKERGIVPESGPSLSLV 343

Query: 357 LTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIW 416
           +   Q R  TL  +     F ++ D     ++     +   +   +L+   ++ E +  +
Sbjct: 344 VKTLQERSRTLVEMADGAIFYYRGDFAYDEQAAAKHLV--PDAAPLLEALADKLEALADF 401

Query: 417 KRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI 476
            + +IE   +     +   L  +   + +++ G   S  +++ IE LG+     RLR A+
Sbjct: 402 SQASIEALFKEFIAEKGIKLGQVGPAVRVSLCGGTASPGIYEVIEALGKEETLRRLRRAV 461

Query: 477 ALVS 480
           A + 
Sbjct: 462 AFIG 465


>gi|56961909|ref|YP_173631.1| glutamyl-tRNA synthetase [Bacillus clausii KSM-K16]
 gi|67461674|sp|Q5WLT5|SYE_BACSK RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|56908143|dbj|BAD62670.1| glutamyl-tRNA synthetase [Bacillus clausii KSM-K16]
          Length = 485

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 176/488 (36%), Positives = 277/488 (56%), Gaps = 17/488 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +  +RVR APSPTG  HIG A +ALFNYL AK  GG F+LRIEDTD  R+   +   +M
Sbjct: 1   MTKDIRVRFAPSPTGHLHIGGARSALFNYLFAKSAGGAFVLRIEDTDQARNVDTATEKLM 60

Query: 63  QSLKWCGLNWDEGPDI-GGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
            SL+W GL WDE  D   G YGPYR  ER +IY+ Y+Q LL++K A+ C+ + E LE  R
Sbjct: 61  DSLRWLGLEWDESIDTEAGKYGPYRSMERVDIYKNYIQQLLDEKKAYYCYMTEEELEAER 120

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
            AQ+ R    +Y G    L++++      +  + VVR  VP   +  F D V GE+    
Sbjct: 121 EAQKARGEMPKYSGRDRDLTAEQRAAYEAKGIQPVVRFRVPEGQTVSFHDAVRGEVSFET 180

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           + +   V+ + DG+P Y+ A V+DDHLM I+HV RGEE +S+ P+ ILLY+ F + +P+F
Sbjct: 181 DGIGDFVIARKDGVPMYNFAVVVDDHLMNISHVIRGEEHLSNTPRQILLYEAFGWDVPKF 240

Query: 242 IHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            H  LI NPD+ K+SKR       +  Y ++GY+PEA++NFLALL       ++E+  ++
Sbjct: 241 AHASLILNPDRQKMSKRDESIIQFVEQYKSLGYMPEAIVNFLALLGWS-PVGEEEIFSLE 299

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WMK 348
           +L   F L  +SKA A+FD  KL W+N ++++     T     +                
Sbjct: 300 ELCEQFTLDRVSKAPAIFDTDKLAWMNNQYMKNADLDTVVDLALPHLVASGKLPEQLDEG 359

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           +++   + + L Q ++   + + ++T+  FK ++  T E+   T L  E++ ++L    +
Sbjct: 360 KREWARRLIGLYQEQMHYGAEIVELTEMFFKEEVDYTEEA--KTVLAEEQVPEVLSQFAK 417

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           E E ++ +   +I+ A++   +   +  K +  P+  A++G  +   L D+IE+LG+SVV
Sbjct: 418 ELESLEGFFAADIKKAIKATQKATGQKGKKLFMPIRAAVSGQTHGPELGDTIELLGKSVV 477

Query: 469 YFRLRHAI 476
             RL+ AI
Sbjct: 478 KARLQAAI 485


>gi|260598797|ref|YP_003211368.1| glutamyl-tRNA synthetase [Cronobacter turicensis z3032]
 gi|260217974|emb|CBA32619.1| Glutamyl-tRNA synthetase [Cronobacter turicensis z3032]
          Length = 471

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 243/487 (49%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNQGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +L    A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDEMLAAGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P  GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQDGSVVFDDQIRGPIEFSNLELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALGAPVPLYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFSREEMIKFF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 ALDAVSKSASAFNTDKLLWLNHHYINTLAPEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   +  W  E
Sbjct: 347 LGERCKTLKEMAQTCRYFYEDFSEFDADAAKKH--LRPVARQPLEVVRDKLAAVTDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G+S    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPGLDVTVHAIGKSRSVERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|91225859|ref|ZP_01260828.1| glutamyl-tRNA synthetase [Vibrio alginolyticus 12G01]
 gi|91189509|gb|EAS75785.1| glutamyl-tRNA synthetase [Vibrio alginolyticus 12G01]
          Length = 475

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/487 (31%), Positives = 251/487 (51%), Gaps = 21/487 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ ++
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKNQGGEFVLRIEDTDLERNSQEAVDAILEGME 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   V  LL +  A++C+ S E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTQRFDRYNEMVDKLLAEDKAYKCYASKELLDEIRAEQEV 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +      +++    V+R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKA--ANEAAKDGDPCVIRFRNPKEGSVVFDDQIRGRIEIRNDQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGAPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINIYEALGAPVPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y  MGYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDMGYLPAALNNYLVRLGWS--HGDQEIFSQEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLS---TTEFLSRVSQWMKEKDR---LTQALTLA 360
           L+ +SK+ + F+  KL WLN  +I+              + Q   +      +T  + L 
Sbjct: 291 LNAVSKSASAFNTDKLQWLNNHYIKNSDPAYVAEHLQWHLDQQKLDVTNGPAITDVIKLV 350

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  TL  L +   + ++       E+  +         + L+    + E +  W   N
Sbjct: 351 GERCNTLVELAEQIRYFYEDFSEF--EAGAAKKHLRGVAKEPLELALAKVEALTEWTTAN 408

Query: 421 IET-ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           I+   +  V +  E  +  I  PL +A+TG   S  +   +E++G+     R++ A+  +
Sbjct: 409 IKDGVIAAVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMELVGKERCIARIKMALEFI 468

Query: 480 SSLVQNH 486
           +    N 
Sbjct: 469 AEREANA 475


>gi|197121662|ref|YP_002133613.1| glutamyl-tRNA synthetase [Anaeromyxobacter sp. K]
 gi|220916458|ref|YP_002491762.1| glutamyl-tRNA synthetase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|238689887|sp|B4UI79|SYE_ANASK RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|196171511|gb|ACG72484.1| glutamyl-tRNA synthetase [Anaeromyxobacter sp. K]
 gi|219954312|gb|ACL64696.1| glutamyl-tRNA synthetase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 474

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 150/478 (31%), Positives = 253/478 (52%), Gaps = 20/478 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K RVR APSPTG  HIG A TALFN+L A+R GG F+LRIEDTD +RST  + +A++  L
Sbjct: 3   KPRVRFAPSPTGYLHIGGARTALFNWLWARRNGGTFVLRIEDTDRERSTQLAVDAILDGL 62

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GL+WDEGP +GG + PY Q+ER ++Y+ + + L+ +  A+ C+C+ E L+  R+   
Sbjct: 63  RWLGLDWDEGPGVGGPHPPYFQTERLDLYKAHAERLIREGKAYACYCTREELDAQRKQAE 122

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                        +      ++     + HVVR  VP+ G+  + D V G +  P + + 
Sbjct: 123 AEK-------RQFRYPGTCRDKPYDPSRPHVVRFRVPDAGATSWNDLVKGVISTPHDTLQ 175

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
            +V+L+ DG+P Y+   V+DD  M+I  V RG++ +++  + IL+Y+   +P+P F H P
Sbjct: 176 DEVILRGDGVPLYNFGAVVDDITMEINLVGRGDDHVNNTARQILMYEALGYPVPTFAHFP 235

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   DK++LSKR   TS++ Y  MG+LPEA++N+L  L       D EL  + +L+ +F
Sbjct: 236 MILGADKARLSKRHGATSVTAYRDMGFLPEAVVNYLVRLGWS--HGDQELFTLDELVRYF 293

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK-------EKDRLTQALT 358
           DL  +     VF+ +K+ W+N  W++   S  E         +       + ++L     
Sbjct: 294 DLKDVGATAGVFNPEKMAWVNHEWLKR-RSPEELAKLALPHFRAAGLPAEDDEKLRHVCA 352

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           +A+ R  TL    Q   + +     +  +          +   +L+  ++    +   + 
Sbjct: 353 VARERAKTLGEYVQQFRYFYA---PIALDPKAKAKFLTADTRPVLQAVRDAIAALPALET 409

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI 476
           + +E      A+ R   L  + +P+ +A+TG   S  ++D ++ILG+     RL  A+
Sbjct: 410 QAVEQVFHGEAERRGVGLGKVAQPVRVALTGGTASPGMYDVVQILGKDETLKRLDEAL 467


>gi|120437626|ref|YP_863312.1| glutamyl-tRNA synthetase [Gramella forsetii KT0803]
 gi|187470992|sp|A0M6K0|SYE_GRAFK RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|117579776|emb|CAL68245.1| glutamyl-tRNA synthetase [Gramella forsetii KT0803]
          Length = 505

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 167/508 (32%), Positives = 263/508 (51%), Gaps = 33/508 (6%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            SSKVRVR APSPTG  HIG   TAL+NYL AK+ GG F+LRIEDTD  R    +E+ ++
Sbjct: 1   MSSKVRVRFAPSPTGPLHIGGVRTALYNYLFAKKHGGDFVLRIEDTDQNRYVEGAEDYII 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++L WCG+ +DEGP     +GPYRQSERK+ Y+ Y + L++   A+  F +++ L+  R+
Sbjct: 61  EALNWCGIPYDEGPGKEKGFGPYRQSERKDQYREYAEKLIKSGNAYYAFDTSDELDGHRK 120

Query: 123 AQRKRNIPSRYDGHCLKL-------SSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYG 175
              ++     Y+ H  +        S +E++     ++ +V+R   P   +   +D + G
Sbjct: 121 DHEEKGKTFIYNWHNRQKLKNSLSLSQEEVQEKLDGEEDYVIRFKSPQDETLHLKDVIRG 180

Query: 176 EMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN 235
           +MEI  N +D +VL KSDGMPTYHLAN++DDHLM+ITHV RGEEW+ S+  H +LY+ F 
Sbjct: 181 DMEIDTNILDDKVLFKSDGMPTYHLANIVDDHLMEITHVIRGEEWLPSLALHYMLYRAFG 240

Query: 236 FPIPEFIHLPLIKNPD-KSKLSKRRNPTSISY-----------------YSAMGYLPEAL 277
           +  P+F HLPLI  P  K KLSKR                         Y   GY PEA+
Sbjct: 241 WNAPQFAHLPLILKPQGKGKLSKRDGEKMGFPVFPLEWKDPESGDISAGYKEEGYFPEAV 300

Query: 278 INFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLST- 336
           +N LA L       ++E   ++ L   F+L  + K GA FD +K  W    +I+   +  
Sbjct: 301 VNMLAFLG-WNPGTEEEFFGLEDLTKAFELERVHKGGAKFDPEKTKWFQQHYIQLADNEF 359

Query: 337 --TEFLSRVSQWMKEKDRLTQ--ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKST 392
              EF  R+ +   E D++     + L + R+  +        F F +      +  K  
Sbjct: 360 LADEFEKRLEKKEIEADKIYISEVVALIKERVVFVEDFWDQGYFFFIAPTSFDPKDSKKA 419

Query: 393 ALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKY 452
               E   +++    E  + I  ++ E+++  ++   + +E     ++ PL +A+ G+  
Sbjct: 420 --WKEGTSELMTELNEYLKSIDNFEAEHLQETVKGWIKSKEIGFGKVMMPLRIALVGALQ 477

Query: 453 SLPLFDSIEILGRSVVYFRLRHAIALVS 480
              L+   E +G+     R++ A+  + 
Sbjct: 478 GPDLYKIAEFIGKEATLKRIQKAVDTLK 505


>gi|70727480|ref|YP_254396.1| glutamyl-tRNA synthetase [Staphylococcus haemolyticus JCSC1435]
 gi|118595559|sp|Q4L3I7|SYE_STAHJ RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|68448206|dbj|BAE05790.1| glutamyl-tRNA synthetase [Staphylococcus haemolyticus JCSC1435]
          Length = 484

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 168/487 (34%), Positives = 270/487 (55%), Gaps = 16/487 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTDSKR+  + E++  
Sbjct: 1   MSERIRVRYAPSPTGYLHIGNARTALFNYLFAKHYDGDFVVRIEDTDSKRNLEDGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER +IY P +Q LL++  A++C+ + E LE+ R 
Sbjct: 61  DNLKWLGLDWDESIDKDKGYGPYRQSERGDIYNPLIQQLLDEDKAYKCYMTEEELEKERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ +E ++   E ++  +R  VP   +  F D V GE+    N
Sbjct: 121 DQIARGEMPRYGGQHAHLTEEERQQFEAEGRRPSIRFRVPQDQTYTFNDMVKGEISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  IDD+ M I+ V RG++ +S+ PK +++Y+ F +  P F 
Sbjct: 181 NIGDWVIVKKDGIPTYNFAVAIDDYYMGISDVIRGDDHVSNTPKQLMIYEAFGWEAPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ LL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFITLLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVS-----------QWMKE 349
            I  FD   LSK+ A+FD+QKL W+N ++++ K + T F   +                +
Sbjct: 300 FIKIFDEKRLSKSPAMFDRQKLAWVNNQYMKTKDTDTVFELALPHLIKANLIPESPSEDD 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
           K+   + + L Q  ++    +  +++  F     L  E  +   +  E++ +++     +
Sbjct: 360 KEWGRKLVALYQKEMSYAGEIVPLSEMFFHEMPELGEE--EQEVINGEQVPELMTHLYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++  +I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAADIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKDKVL 477

Query: 470 FRLRHAI 476
            RL+  +
Sbjct: 478 SRLKKFV 484


>gi|308270613|emb|CBX27225.1| Glutamyl-tRNA synthetase [uncultured Desulfobacterium sp.]
          Length = 488

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/484 (30%), Positives = 246/484 (50%), Gaps = 25/484 (5%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V  R  PSPTG  H+G A TALFN+L A+   G+F+LRIEDTD++RST  S +A+ ++L+
Sbjct: 24  VITRFPPSPTGYLHVGGARTALFNWLYARHMKGRFVLRIEDTDTRRSTQASVDAIFEALE 83

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G++WDEG        PY QS+R +IY  Y+  L++   A+ C CS E+LEEMR     
Sbjct: 84  WLGIDWDEG--------PYFQSKRFDIYLEYIDKLIDSGNAYYCTCSQEKLEEMRATAMA 135

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                   G   K       +  ++    VVR+  P  G+ V +D +   +      +D 
Sbjct: 136 -------SGKKPKYDGTCRNKELKKTDNAVVRIKAPLDGTTVVRDVIKNNIVFNNTELDD 188

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ +SDG PTY+LA V+DD  M I  + RG++ +++ PK I++Y      +P F H+P+
Sbjct: 189 FIICRSDGTPTYNLAVVVDDITMSINTIIRGDDHVNNTPKQIIIYNALGHSLPVFGHVPM 248

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           +   DK++LSKR    S++ Y  MGYLP+A IN++  L       D E     +LI  F 
Sbjct: 249 VLGSDKTRLSKRHGAMSVTEYKDMGYLPDAFINYIVRLGWS--YGDQEFFTRDELIEKFS 306

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLST------TEFLSRVSQWMKEKDRLTQALTLA 360
           L ++ ++  VFD  KL  LN   I+             FL+++    +E   +   +   
Sbjct: 307 LENIGRSAGVFDINKLLALNADHIKLSDPDKITKHLAPFLNKLGFEFREGPFIEGVIKTL 366

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
            +R  TL  + +   F F+  +    ++  ++     + ++IL T    FE ++ +  ++
Sbjct: 367 NARSKTLKEMAENAAFYFQDTISYQEDA--ASKFLTADSVEILNTLIALFEALESFDEKS 424

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           IE     + +     L  I +P+ +A+TG   S  +F+ + +LG+     RL+ A + + 
Sbjct: 425 IENVFVKIMEQTGLKLGKIAQPVRVALTGKTISPGVFEILNVLGKEKSINRLKMAASFIG 484

Query: 481 SLVQ 484
               
Sbjct: 485 DKKS 488


>gi|54294798|ref|YP_127213.1| glutamyl-tRNA synthetase, catalytic subunit [Legionella pneumophila
           str. Lens]
 gi|67461676|sp|Q5WVE0|SYE_LEGPL RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|53754630|emb|CAH16114.1| Glutamyl-tRNA synthetase, catalytic subunit [Legionella pneumophila
           str. Lens]
          Length = 470

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 166/484 (34%), Positives = 258/484 (53%), Gaps = 24/484 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R APSPTG  H+G   TALF++L AK   G+FILRIEDTD +RST ES  A++  + 
Sbjct: 3   VRTRFAPSPTGFLHVGGVRTALFSWLYAKHHNGQFILRIEDTDRERSTQESVQAILDGMA 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GLN+DEG        PY Q+ER   YQ   Q LLE+  A+RC CS ERLE +R AQ  
Sbjct: 63  WLGLNFDEG--------PYYQTERYARYQQVAQQLLEEGKAYRCQCSKERLEALREAQLA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYDGHC   S      L      +V+R   P+ G   F D+VYG++ +  + +D 
Sbjct: 115 AKEKPRYDGHCRNQS------LPDSGIPYVIRFRNPDGGIVSFHDEVYGDIHVDNSELDD 168

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +L++SDG PTY+ A VIDD  MKITHV RG++ I++ P+ I L++  + P+P F HLP+
Sbjct: 169 LILVRSDGHPTYNFAVVIDDWDMKITHVIRGDDHINNTPRQINLFKALDAPVPVFAHLPM 228

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D  +LSKR    S+  +  +G LP AL+N+L  L       D E+  +Q++I  FD
Sbjct: 229 ILGEDGKRLSKRHGAVSVLQFKELGVLPHALLNYLVRLGWS--HGDQEIFSVQEMITSFD 286

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLST------TEFLSRVSQWMKEKDRLTQALTLA 360
           L ++S+  + F+  KL WLN  + +                +    + +   L   + + 
Sbjct: 287 LKNVSRGVSSFNYDKLYWLNQHYQKSDSPESVANALQWHFEQAGIDLNQGPDLKDLVAVQ 346

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  +L+ + Q++ + +   +    ++ K        +++ L    E  + +  WK + 
Sbjct: 347 AERCKSLAEMCQISQYFYTDTIEYNEDAVKKH--LRPVVLEPLMVLHERLKALDEWKNDK 404

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           I+  + +V+   + +L  I +PL +A+TGS  S  +  ++ +LG++    RL  A+  + 
Sbjct: 405 IQECINDVSLQFDLNLGKIAQPLRVAVTGSGTSPSIDMTLALLGKNKSIKRLEDALEKIR 464

Query: 481 SLVQ 484
           +   
Sbjct: 465 ARAS 468


>gi|299143743|ref|ZP_07036823.1| glutamate--tRNA ligase [Peptoniphilus sp. oral taxon 386 str.
           F0131]
 gi|298518228|gb|EFI41967.1| glutamate--tRNA ligase [Peptoniphilus sp. oral taxon 386 str.
           F0131]
          Length = 496

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 183/498 (36%), Positives = 281/498 (56%), Gaps = 23/498 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           +VRVR APSPTG  HIG   TAL+NYL A++  GKFILRIEDTD  R    +   ++ +L
Sbjct: 3   EVRVRFAPSPTGFLHIGGLRTALYNYLYARKNNGKFILRIEDTDRTRFVDGAIENLVNAL 62

Query: 66  KWCGLNWDEG-------PDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLE 118
           KW G+++DEG           G YGPY QS+R +IY+ YV  L+EK +A+ CFC+ ERL+
Sbjct: 63  KWAGIDYDEGVFFENGEVVEKGEYGPYIQSKRLDIYKKYVDELIEKDMAYYCFCTKERLD 122

Query: 119 EMRRAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEME 178
            +R  QR +    +YDG C   S  E ++     + +VVRL +P   +  F+D V G++ 
Sbjct: 123 HVREEQRIKGQVPKYDGFCRGGSLDEAKKRIANGEDYVVRLKLPRNTNITFEDAVRGKVT 182

Query: 179 IPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPI 238
           I  + +D QVL+KSDG PTYH+A V+DDHLM ITHV RGEEW+ S PKH+ LY+   +  
Sbjct: 183 INTDEIDDQVLMKSDGFPTYHMAVVVDDHLMGITHVVRGEEWLPSTPKHVFLYEALGWKA 242

Query: 239 PEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           P+F+HLP + N D+ KLSKR+   S+  +   GYLPE L N+LAL+     +  +E+M +
Sbjct: 243 PQFVHLPTVLNKDRKKLSKRQGDVSVEDFRQRGYLPEGLDNYLALVGWSPEDG-EEIMTL 301

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM----------- 347
           +Q+I  F    + K+G +FDK+KL+W+N  +I+E  ST E     + +M           
Sbjct: 302 EQMIEKFTFDRVGKSGGIFDKEKLNWVNAHYIKE-YSTEEIAKLSAAYMVEANLMTEEEI 360

Query: 348 -KEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTT 406
            K+ D     +   +  ++ L  +P+   FLF        E      L  E++  +++  
Sbjct: 361 NKKWDWYVLLIETVKESLSVLCEVPEKVKFLFGDLD--ITEDDAKEELSGEQVPQLIEAF 418

Query: 407 QEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRS 466
           +E+ + I+    E   T ++ + +      K +  P+  AI+G+ +   L + I +LG++
Sbjct: 419 KEQLDTIEEVDLEFANTVMKKIQKATGIKGKQLFMPVRAAISGNVHGPELKNIIYLLGKN 478

Query: 467 VVYFRLRHAIALVSSLVQ 484
            +  RL  A     ++ +
Sbjct: 479 ELLSRLEKAKNYTKNITE 496


>gi|333002199|gb|EGK21763.1| glutamyl-tRNA synthetase [Shigella flexneri K-272]
          Length = 471

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 154/487 (31%), Positives = 246/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYYQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +     +P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKALVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITGWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+  +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKTRSIERINKALDFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|153834475|ref|ZP_01987142.1| glutamyl-tRNA synthetase [Vibrio harveyi HY01]
 gi|148869171|gb|EDL68203.1| glutamyl-tRNA synthetase [Vibrio harveyi HY01]
          Length = 475

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/487 (31%), Positives = 252/487 (51%), Gaps = 21/487 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ ++
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKNQGGEFVLRIEDTDLERNSQEAVDAILEGME 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL W+EG        PY Q++R + Y   V  LLE+  A++C+ S E L+E+R  Q  
Sbjct: 63  WLGLEWNEG--------PYFQTQRFDRYNEMVDKLLEEDKAYKCYASKELLDEVRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +      +++    V+R   P +GS VF D++ G +EI    +D 
Sbjct: 115 NKEMPRYDANHPKIKA--ANEAAKDGDPCVIRFRNPKEGSVVFDDQIRGRIEISNTQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINIYEALGAPVPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y  MGYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDMGYLPAALNNYLVRLGWS--HGDQEIFTQEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLS---TTEFLSRVSQWMKEKDR---LTQALTLA 360
           L+ +SK+ + F+  KL WLN  +I+              + Q   +      +T+ + L 
Sbjct: 291 LNAVSKSASAFNTDKLQWLNNHYIKNSDPAYVAEHLQWHLDQQKLDVTNGPAITEVIKLV 350

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  TL  L +   + ++       E+  +         + L+    + E +  W   N
Sbjct: 351 GERCNTLVELAEQIRYFYEDFAEF--EAGAAKKHLRGVAKEPLELALAKAEALTDWTTAN 408

Query: 421 IET-ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           I+   +  V +  E  +  I  PL +A+TG   S  +   +E++G+     R++ A+  +
Sbjct: 409 IKDGVIAAVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMELIGKERCVARIKMALEFI 468

Query: 480 SSLVQNH 486
           +    N 
Sbjct: 469 AEREANA 475


>gi|206889689|ref|YP_002249792.1| glutamyl-tRNA synthetase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|238064695|sp|B5YIG1|SYE_THEYD RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|206741627|gb|ACI20684.1| glutamyl-tRNA synthetase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 465

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 164/482 (34%), Positives = 254/482 (52%), Gaps = 31/482 (6%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVR APSPTG  HIG A TALFN+L A+   GKFILRIEDTD  RST E   ++++++K
Sbjct: 2   VRVRFAPSPTGHLHIGGARTALFNWLFARHHNGKFILRIEDTDRSRSTEEYIESIIEAMK 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL+WDEG        P+RQ++R  +Y+ Y   LLE+  A+RC+C+ E LEE R+   K
Sbjct: 62  WLGLDWDEG--------PFRQTDRMEVYKAYAYKLLEEGKAYRCYCTPEELEERRQQAMK 113

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                  +G   +   +  E      K   +R  +P +G  V  D V G++    + ++ 
Sbjct: 114 -------EGKPPRYDRRCREIKETLNKPFAIRFKMPLEGETVVDDLVKGKVTFKNSEIED 166

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            V+L+SDG PTY+   V+DD  M ITHV RGE+ +++ PK I +Y       PEF H+P+
Sbjct: 167 LVILRSDGTPTYNFCVVVDDFEMGITHVIRGEDHLNNTPKQIHIYHALGMNPPEFAHIPM 226

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D+++LSKR   TS+  Y   GYL +AL+NFLA L       D E+   ++LI +F+
Sbjct: 227 ILGTDRARLSKRHGATSVLSYRDEGYLSDALVNFLARLGWS--YGDKEIFTREELIKYFN 284

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK-----------EKDRLTQ 355
           L  + KA AVF+ +KL WLN  +I+      +    V  ++            +KD   +
Sbjct: 285 LEQVGKANAVFNAEKLLWLNSEYIKL-TPEEKLFELVKPFLIKEGYLKEGETLDKDWACR 343

Query: 356 ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
           A+   + R  TL  L     +     + +  ++         E + +L+   E+   ++ 
Sbjct: 344 AIKSLKERCRTLKELAHAMRYYLLDYVEIEPKA--KEKYINAETVPVLREVTEKLAALEE 401

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA 475
           + +E IE    ++   +   L  + +P+ + +TGS  S  +++ +EI G+     RLR  
Sbjct: 402 FTQERIEKIFMDIVNEKGLKLGQVAQPVRVVMTGSTVSPGIYEVLEIAGKEKTLKRLRRV 461

Query: 476 IA 477
           I 
Sbjct: 462 ID 463


>gi|328950294|ref|YP_004367629.1| glutamyl-tRNA synthetase [Marinithermus hydrothermalis DSM 14884]
 gi|328450618|gb|AEB11519.1| glutamyl-tRNA synthetase [Marinithermus hydrothermalis DSM 14884]
          Length = 481

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 191/477 (40%), Positives = 274/477 (57%), Gaps = 12/477 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V  RIAPSPTG+PH+GTAY A+FNY+ A++  GKFI+RIEDTD  R    +E  + + ++
Sbjct: 2   VTTRIAPSPTGDPHVGTAYIAIFNYVWARKNNGKFIVRIEDTDRNRYVEGAEARIQEMIR 61

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL++DEG DIGG  GPYRQSER  IYQ +   L+E   A+RCFC+ ERLE +R  Q+K
Sbjct: 62  WLGLDYDEGTDIGGPNGPYRQSERTAIYQAHAAKLIETGAAYRCFCTPERLEALREEQKK 121

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           R +P  YDGHC  +  +E E  ++  + HVVRL VP  G  V +D++ G +      V  
Sbjct: 122 RGLPLGYDGHCRHIPPEEAEARAKAGEPHVVRLKVPRPGQTVVKDELRGLVTYDHAEVPD 181

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            VLLKSDG PTYHLANV+DDHLM +T V RGEEW+ S P H+LLYQ F +  P + H+PL
Sbjct: 182 VVLLKSDGFPTYHLANVVDDHLMGVTDVIRGEEWLVSTPIHVLLYQAFGWEAPLWYHMPL 241

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++ P  +KLSKR   TS+ +Y   G L EAL+N+L+L+     +  + +  +Q+LI  F 
Sbjct: 242 LRAPGGAKLSKRTGHTSVDWYRERGILAEALMNYLSLMGFSMPDGRE-IFTLQELIEAFS 300

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-------MKEKDRLTQALTL 359
              +S  G VFD +KL W+NG++IRE L+  +   RV  +             L + +  
Sbjct: 301 WERVSLGGPVFDYEKLKWMNGKYIREVLTLEDLTQRVKPFLERAGLEWGSDAYLQRVVAA 360

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            + R  TL    +   + F        ++ K      E +++     +E    +     E
Sbjct: 361 MRIRFETLEEFVEKARYFFTEAYPFEEKALKKLKAGLEYVVE----LKERLGTLPEMDPE 416

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAI 476
             E  +R  A  +      +++PL  A+TG+  S  +F+ +E+LG+  V  RL  AI
Sbjct: 417 LTEPLIRGYAAEKGAKPGAVMQPLRAALTGTLQSPGMFELLELLGKDRVLKRLERAI 473


>gi|320657288|gb|EFX25093.1| glutamyl-tRNA synthetase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
          Length = 471

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 155/487 (31%), Positives = 248/487 (50%), Gaps = 23/487 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE+  A++C+CS ERLE +R  Q 
Sbjct: 62  NWLSLEWDEG--------PYFQTKRFDRYNAVIDQMLEEGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            +    RYDG C             + +  VVR   P +GS VF D++ G +E     +D
Sbjct: 114 AKGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVVFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+ITHV RGE+ I++ P+ I + +    P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALKAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I +F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIKYF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L+ +SK+ + F+  KL WLN  +I         T     + Q   +     Q   L + 
Sbjct: 287 TLNAVSKSASAFNTDKLLWLNHHYINALPPEYVATHLQWHIEQENIDTRNGPQLADLVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEMAQSCRYFYEDFAEFDADAAKKH--LRPVARQPLEVVRDKLAAITDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  P+ +A+TG+  S  L  ++  +G++    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPMRVAVTGAGQSPALDVTVHAIGKTRSIERINKALAFI 464

Query: 480 SSLVQNH 486
           +      
Sbjct: 465 AERENQQ 471


>gi|295694813|ref|YP_003588051.1| glutamyl-tRNA synthetase [Bacillus tusciae DSM 2912]
 gi|295410415|gb|ADG04907.1| glutamyl-tRNA synthetase [Bacillus tusciae DSM 2912]
          Length = 491

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 167/482 (34%), Positives = 257/482 (53%), Gaps = 17/482 (3%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           ++RVR APSPTG  HIG A TALFN+L A++ GG+ +LRIEDTD  R    +E  ++ +L
Sbjct: 2   RIRVRYAPSPTGHLHIGGARTALFNWLFARQKGGQMVLRIEDTDRSREVAGAEEKMVDAL 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GL+WDEGPDIGG +GPYR  ER ++Y+     LLE+  A+ C+C+ E LE  R   R
Sbjct: 62  RWLGLDWDEGPDIGGKFGPYRSMERLDLYRSLANRLLEEGRAYPCYCTPEELEAQREEMR 121

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
           +R +  RY G C  L++ E  RL+ E +   VR  VP   +  F+D V+G +    + + 
Sbjct: 122 RRGVMPRYSGRCRHLTAAERRRLAAEGRPFTVRFRVPEGQTVSFEDLVHGTVSFETDGIG 181

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             V++KSDG+PTY+ A  +DDH M+I+HV RGEE +S+    +L+Y    FP P F H+P
Sbjct: 182 DFVIVKSDGIPTYNFAVAVDDHSMQISHVIRGEEHLSNTAIQLLVYDALGFPTPGFAHVP 241

Query: 246 LIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIH 303
           LI N    KLSKR       +  Y  +GY+PEA++N+LALL      + +  + +++L+ 
Sbjct: 242 LILNESGKKLSKRDESVVQFVEQYRDLGYVPEAVVNYLALLGWSPVGERE-FLSLEELVQ 300

Query: 304 HFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKEKDR 352
            F L  + K+GAVFD  KL WLN  ++R +         +               ++ + 
Sbjct: 301 EFSLDRVGKSGAVFDPVKLRWLNAHYLRGRPDEELLKLCLPHLVAAGLLAEPPSAEDLEW 360

Query: 353 LTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEV 412
             +A+ L + ++   + LP++  +L         +      L             +E   
Sbjct: 361 ARRAVELYRDQLEYAAQLPELAGWL---KSLPDPDPEGERILEDPSARKAADAFYQEISA 417

Query: 413 IQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRL 472
           +  W  + I  A + V +      + +  P+ +A+TG  +   L   + +LGR VV  RL
Sbjct: 418 LSQWTPDGIHAAFKRVQKTTGLRGRQLFMPIRVAVTGRTHGPELPKVLNLLGREVVLGRL 477

Query: 473 RH 474
           R 
Sbjct: 478 RE 479


>gi|315649726|ref|ZP_07902810.1| glutamyl-tRNA synthetase [Paenibacillus vortex V453]
 gi|315274914|gb|EFU38290.1| glutamyl-tRNA synthetase [Paenibacillus vortex V453]
          Length = 487

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 177/489 (36%), Positives = 266/489 (54%), Gaps = 18/489 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + +VRVR APSPTG  HIG A TALFNYL A++  GKFI+RIEDTD KR+    E + +
Sbjct: 1   MTGEVRVRYAPSPTGHLHIGNARTALFNYLFARKNNGKFIIRIEDTDVKRNVEGGEQSQL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           + LKW G++WDE  D+GG YGPYRQ+ER +IY+ Y Q+LL++ LA+RC+C+ E LE+ R 
Sbjct: 61  KYLKWLGMDWDESVDVGGEYGPYRQTERLDIYKEYWQDLLDRGLAYRCYCTEEELEQERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            Q  R    RY G    L+ ++ + L  E +   +R  VP +    F D V G +     
Sbjct: 121 EQMARGETPRYSGKHRDLTEEQRQALEAEGRVASIRFRVPEERIYTFDDMVKGTISFNSK 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
                V++K DG+PTY+ A  +DDHLMKI+HV RGE+ IS+ P+ +++Y+ F +  P+F 
Sbjct: 181 ETGDFVIVKKDGIPTYNFAVALDDHLMKISHVLRGEDHISNTPRQLMIYEAFGWEPPQFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI   D  KLSKR       I  Y  +GYLPEAL NF++LL      + +E+   +Q
Sbjct: 241 HMTLIVGDDHKKLSKRNESIIQFIEQYDQLGYLPEALFNFISLLGWSPEGE-EEVYSQEQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------------ 348
           LI  FD H LSK+ AVFD  KL  +N  +I+               ++            
Sbjct: 300 LISIFDEHRLSKSPAVFDTNKLAHMNNTYIKN-ADPDRIADLAIPHLQKASRLPFELNSE 358

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           +++     + L Q ++   S +  +++  F++ L L AE  +   +  E++  +L     
Sbjct: 359 QEEWARALVALYQEQMNAASDIVDLSEVFFRTHLELDAEGIE--VMGGEQVPAVLSAFLA 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E    +    I   ++ V +      K +  P+ +A+TG  +   L  +I +LG+  V
Sbjct: 417 KIEQSDEFNAAKIAALIKEVQKETGFKGKQLFMPIRVALTGQTHGRDLNQTIWLLGKDRV 476

Query: 469 YFRLRHAIA 477
             RLR  I 
Sbjct: 477 LDRLRSQIK 485


>gi|67461691|sp|Q5ZU96|SYE_LEGPH RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
          Length = 470

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 166/484 (34%), Positives = 258/484 (53%), Gaps = 24/484 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R APSPTG  H+G   TALF++L AK   G+FILRIEDTD +RST ES  A++  + 
Sbjct: 3   VRTRFAPSPTGFLHVGGVRTALFSWLYAKHHNGQFILRIEDTDRERSTQESVQAILDGMA 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GLN+DEG        PY Q+ER   YQ   Q LLE+  A+RC CS ERLE +R AQ  
Sbjct: 63  WLGLNFDEG--------PYYQTERYARYQQVAQQLLEEGKAYRCQCSKERLEALREAQLA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYDGHC   S      L      +V+R   P+ G   F D+VYG++ +  + +D 
Sbjct: 115 AKEKPRYDGHCRNQS------LPDSGIPYVIRFRNPDAGIVSFHDEVYGDIHVDNSELDD 168

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +L++SDG PTY+ A VIDD  MKITHV RG++ I++ P+ I L++  + P+P F HLP+
Sbjct: 169 LILVRSDGHPTYNFAVVIDDWDMKITHVIRGDDHINNTPRQINLFKALDAPVPVFAHLPM 228

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D  +LSKR    S+  +  +G LP AL+N+L  L       D E+  +Q++I  FD
Sbjct: 229 ILGEDGKRLSKRHGAVSVLQFKELGVLPHALLNYLVRLGWS--HGDQEIFSVQEMITSFD 286

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLST------TEFLSRVSQWMKEKDRLTQALTLA 360
           L ++S+  + F+  KL WLN  + +                +    + +   L   + + 
Sbjct: 287 LKNVSRGVSSFNYDKLYWLNQHYQKSDSPESVANALQWHFEQAGIDLNQGPDLKDLVAVQ 346

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  +L+ + Q++ + +   +    ++ K        +++ L    E  + +  WK + 
Sbjct: 347 AERCKSLAEMCQISQYFYTDIIEYNEDAVKKH--LRPVVLEPLMVLHERLKALDEWKNDK 404

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           I+  + +V+   + +L  I +PL +A+TGS  S  +  ++ +LG++    RL  A+  + 
Sbjct: 405 IQECINDVSLQFDLNLGKIAQPLRVAVTGSGTSPSIDMTLALLGKNKSIKRLEDALEKIR 464

Query: 481 SLVQ 484
           +   
Sbjct: 465 ARAS 468


>gi|187778238|ref|ZP_02994711.1| hypothetical protein CLOSPO_01830 [Clostridium sporogenes ATCC
           15579]
 gi|187775166|gb|EDU38968.1| hypothetical protein CLOSPO_01830 [Clostridium sporogenes ATCC
           15579]
          Length = 488

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 183/487 (37%), Positives = 278/487 (57%), Gaps = 10/487 (2%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            ++KVR R APSPTG  H+G   TAL+ YLIAK   G FILRIEDTD +R    + + + 
Sbjct: 4   MTNKVRTRFAPSPTGYMHVGNLRTALYAYLIAKHDNGDFILRIEDTDQERLVEGALDVIY 63

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +L+  GL+ DEGPDIGG  GPY QSER+NIY  Y + L+EK  A+ CFCS +RL+ +R 
Sbjct: 64  NTLEITGLSHDEGPDIGGPVGPYVQSERRNIYIEYAEKLIEKGEAYYCFCSKDRLDMLRA 123

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
                  P RYD HC+ LS +EI++   E   +V+R   P  GS  F D++YG++ +  +
Sbjct: 124 NSEALKRPFRYDKHCIDLSKEEIDKKIAEGIPYVIRQKNPTTGSTSFHDEIYGDISVDNS 183

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +D  +L+KSDG+PTY+ ANV+DDHLM ITHV RG E++SS PK+  LY+ F + +P ++
Sbjct: 184 ELDDMILIKSDGLPTYNFANVVDDHLMGITHVVRGSEYLSSSPKYNRLYEAFGWDVPIYV 243

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H P I   +  KLSKR    S     A GYL EA++N++ALL       + E+  M++LI
Sbjct: 244 HCPPIMKDEHHKLSKRNGDASFEDLMAKGYLKEAILNYIALLG-WNPGGEKEVFSMEELI 302

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK----EKDRLTQALT 358
             F+  +++KA AVFD +KL W+NG +IR  LS  +F      + K    +     +   
Sbjct: 303 EAFNYRNINKAPAVFDTKKLKWMNGEYIRA-LSLDKFHEMALPYYKEALTKDLDTKKISE 361

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAES--FKSTALCPEEIIDILKTTQEEFEVIQIW 416
           L  +R+  L+ +P+     F   L  + E    K      E  +  L+    + E ++ W
Sbjct: 362 LLHTRVEVLNEIPEQ-LDFFNDLLEYSEEMYIHKKMKTTYENSLKSLEEVLPKLESLEDW 420

Query: 417 KRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSL-PLFDSIEILGRSVVYFRLRHA 475
             ENI+    ++ +  E    +++ P+  A++G +++    F+  +ILG+     R++  
Sbjct: 421 TFENIKEVCMDLVKELEVKNGVVLWPIRTAVSGKQFTPGGAFEIADILGKEETIKRIKIG 480

Query: 476 IALVSSL 482
           I  + +L
Sbjct: 481 IEKLKAL 487


>gi|110834370|ref|YP_693229.1| glutamyl-tRNA synthetase [Alcanivorax borkumensis SK2]
 gi|123345497|sp|Q0VPE1|SYE_ALCBS RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|110647481|emb|CAL16957.1| glutamyl-tRNA synthetase [Alcanivorax borkumensis SK2]
          Length = 494

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 212/486 (43%), Positives = 305/486 (62%), Gaps = 2/486 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R+APSPTG+PH+GTAY ALFN   A++ GG+FILRIEDTD  RST +SE  ++ SLK
Sbjct: 3   VRTRVAPSPTGDPHVGTAYIALFNRCFAQQHGGQFILRIEDTDQTRSTDQSEQMILDSLK 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEGPD+GG +GPYRQSERK IY+ Y + L+EK  AF+C+ ++E L+ +R   ++
Sbjct: 63  WLGLTWDEGPDVGGPHGPYRQSERKGIYRQYAEQLIEKGHAFKCYRTSEELDALRAGLKE 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                      L+L + E  +   +   +V+R+ VP +G C   D + G +E+ W  VD 
Sbjct: 123 SGENRALKPSDLELPADEQAKREADGAPYVIRMRVPTEGRCEIHDMLRGPVELDWALVDA 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           Q+LLKSDGMPTYHLAN++DDHLM+ITHV RGEEW++S PKH LLY+YF + +P   H+PL
Sbjct: 183 QILLKSDGMPTYHLANIVDDHLMEITHVIRGEEWLNSAPKHKLLYEYFGWEMPVLCHMPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI +Y  MGYLPEAL+N+L  +     ++ ++   + Q+   FD
Sbjct: 243 LRNPDKSKLSKRKNPTSILFYQRMGYLPEALVNYLGRMGWSMPDESEK-FSLTQMQEAFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G VFD +KL WLNG+W+RE  S  +FL  +  W   +D   + +   + R+ T
Sbjct: 302 IQRVSLGGPVFDVEKLSWLNGQWLRE-QSDEQFLDSLLDWAFNRDYAMKIIPHLRQRVET 360

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS +     F F     ++  SF+      ++I   L+     +E    W RE +    +
Sbjct: 361 LSEVADKAAFCFNGMPAISEASFEHKQYSADDIKVWLQYLLWTYEARNDWNREGLFADAK 420

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
            +A   E  +K  + P+F+AI G+  S  + DS+EI+G  +   R+RHAI ++  + +  
Sbjct: 421 AIADALEVKIKDFLFPVFIAIAGTSASFSVVDSMEIIGSDISRARIRHAIEVLGGVSKKQ 480

Query: 487 KKKELK 492
            KK  K
Sbjct: 481 MKKLEK 486


>gi|183179484|ref|ZP_02957695.1| glutamyl-tRNA synthetase [Vibrio cholerae MZO-3]
 gi|183012895|gb|EDT88195.1| glutamyl-tRNA synthetase [Vibrio cholerae MZO-3]
          Length = 472

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 152/485 (31%), Positives = 249/485 (51%), Gaps = 24/485 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +RST  + +A+++ + 
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERSTQAAVDAIIEGMT 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R + Y   +  LL +  A++C+   E L+E+R  Q  
Sbjct: 63  WLGLEWDEG--------PYYQTKRFDRYNQVIDQLLAEGKAYKCYAPKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +          +   +R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKAVNDAAKE--GEPCCIRFRNPKEGSVVFDDQIRGRIEIRNDQLDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M I+HV RGE+ I++ P+ I +Y+     IP F H  +
Sbjct: 173 LIIRRTDGTPTYNFCVVVDDVDMGISHVIRGEDHINNTPRQINIYKAMGATIPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLPEAL+N+L  L       D E+    ++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWG--HGDQEIFSRDEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------ALT 358
           L+ +SK+ + F+  KL WLN  +I+   S  E++++  +W  E   + +         + 
Sbjct: 291 LNAISKSASAFNTDKLLWLNNHYIKT--SEPEYVAKHLEWHFENQGINKATGPALAEVVK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L Q + + ++      A++ K          + L     + E +  W  
Sbjct: 349 LVGERCNTLVELAQQSRYFYEDFAEFDADAAKKH--LRGVAKEPLMLALSKIEALTEWNT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E +   +  V +  E  +  I  PL +A+TG   S  +   + ++G+  V  R++ A+  
Sbjct: 407 EALHHVIAQVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMNLIGQERVIARIKMALEY 466

Query: 479 VSSLV 483
           + +  
Sbjct: 467 IETRE 471


>gi|297545338|ref|YP_003677640.1| glutamyl-tRNA synthetase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296843113|gb|ADH61629.1| glutamyl-tRNA synthetase [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 497

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 180/496 (36%), Positives = 272/496 (54%), Gaps = 15/496 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            S +RVR APSPTG  HIG   TALFNYL ++  G  F+LRIEDTD +RS+ + E  + +
Sbjct: 1   MSNLRVRFAPSPTGAIHIGNIRTALFNYLFSRSEGATFVLRIEDTDLERSSKDFEELIFK 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            L+W G+ WDEGPD  G YGPYRQSER  IY  + Q L+E+K A+RC+C+ E LEE R+ 
Sbjct: 61  ELEWLGIEWDEGPDKPGPYGPYRQSERLAIYHKFAQKLIEEKKAYRCYCTPEELEEDRKK 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
             +R    RY G C  L+ ++ E   +E +K V+R  VP+     F+D + G++ I  + 
Sbjct: 121 AVERGDIPRYSGRCRYLTKEQEEAFIKEGRKPVIRFIVPDDEVIEFEDMIKGKITIKSDT 180

Query: 184 VDMQV-LLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
           +   + ++KSDGMPTY+ A VIDD LMKITHV RGE+ I + PK IL+Y+   F IP F 
Sbjct: 181 LGGDMVIVKSDGMPTYNFAVVIDDALMKITHVIRGEDHIYNTPKQILIYKALGFEIPTFA 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H PLI  PD++KLSKR   T I  Y  +GYLPEA+ NFL+LL     ++ + +M  +++I
Sbjct: 241 HAPLILGPDRTKLSKRHGNTYIGQYRELGYLPEAMFNFLSLLSWSPEDNVE-IMSKEEII 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-----------MKEKD 351
             F+   +  A  VFD +KL+W+N ++I++  S    +                     +
Sbjct: 300 KKFNFRRIHSANPVFDIEKLNWMNQQYIQK-SSVERIVDLAIPHLRRAGYIDEINDMMYN 358

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
            L   ++L +  +  ++ + +     F  ++  + E+ K     P     +L+  +   E
Sbjct: 359 WLKDVISLYKDGLQYVAQIIEKAKMFFVEEVDYSEETMKILEENP-NSKIVLEGVKRAIE 417

Query: 412 VIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFR 471
             +    E ++  L+ + +      K    P+ +AITG  +   L   I ++G+  V  R
Sbjct: 418 ESEQLTEEYVKDLLKKLQKQTNVKGKEFFMPIRVAITGEDHGPELVKIIPLVGKDKVINR 477

Query: 472 LRHAIALVSSLVQNHK 487
           L+ AI L+       K
Sbjct: 478 LKRAINLIKEKSDEKK 493


>gi|237801115|ref|ZP_04589576.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|237806509|ref|ZP_04593213.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331023972|gb|EGI04029.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331027622|gb|EGI07677.1| glutamyl-tRNA synthetase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 482

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 217/478 (45%), Positives = 316/478 (66%), Gaps = 2/478 (0%)

Query: 15  PTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKWCGLNWDE 74
           PTG+PH+GTAY ALFNY  AK+ GG+FILRIEDTD  RST ESE  +  +L+W G++W E
Sbjct: 1   PTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQIFDALRWLGIDWSE 60

Query: 75  GPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKRNIPSRYD 134
           GPD+GG +GPYRQSER  IY+ Y Q L+E   AF CFC+ E L+EMR  Q+ R    RYD
Sbjct: 61  GPDVGGPHGPYRQSERCEIYKKYAQQLVELGHAFPCFCTAEELDEMRAEQQARGETPRYD 120

Query: 135 GHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQVLLKSDG 194
           G  L LS +E++R     + HV+R+ VP +G CV  D + GE+EIPW+ +DMQVL+K+DG
Sbjct: 121 GRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPWDRMDMQVLMKTDG 180

Query: 195 MPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLIKNPDKSK 254
           +PTY LANV+DDHLM ITHV RGEEW+ S PK ILLY+YF +  P+  ++PL++NPDKSK
Sbjct: 181 LPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQLCYMPLLRNPDKSK 240

Query: 255 LSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAG 314
           LSKR+NPTS+++Y  MG++PEA++N+L  +     ++ ++   +Q+++ +FDL  +S  G
Sbjct: 241 LSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREK-FSLQEMVDNFDLSRVSLGG 299

Query: 315 AVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMT 374
            +FD +KL WLNG+W+RE L   EF SR+  W    D + +     Q R+ T S +  + 
Sbjct: 300 PIFDIEKLSWLNGQWLRE-LPVEEFASRLQTWALNPDYMMKIAPHVQGRVETFSQVAPLA 358

Query: 375 DFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREK 434
            F F   +   A+ F+   L PE++  +++    + E ++ W++E I   ++ V +H + 
Sbjct: 359 GFFFAGGVTPDAKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKERIMGCIQAVVEHLQL 418

Query: 435 SLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNHKKKELK 492
            L+  +  +F AITG   S+ + D++EILG  +  FRLR A+ L+  + +   K+  K
Sbjct: 419 KLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGGVSKKENKEWEK 476


>gi|163786960|ref|ZP_02181408.1| glutamyl-tRNA synthetase [Flavobacteriales bacterium ALC-1]
 gi|159878820|gb|EDP72876.1| glutamyl-tRNA synthetase [Flavobacteriales bacterium ALC-1]
          Length = 505

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 166/508 (32%), Positives = 260/508 (51%), Gaps = 33/508 (6%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S  VRVR APSPTG  HIG   TALFNYL AK+ GG F+LRIEDTD  R    +E+ ++
Sbjct: 1   MSKNVRVRFAPSPTGPLHIGGVRTALFNYLFAKKHGGDFVLRIEDTDQNRYVEGAEDYIV 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +SL WCG+ +DEGP     +GPYRQSERK++Y+ Y   L+    A+  F ++E+L+  R+
Sbjct: 61  ESLSWCGIPFDEGPGKNEKFGPYRQSERKHLYKQYADQLISSGKAYYAFDTSEQLDAHRK 120

Query: 123 AQRKRNIPSRYDGHCLKL---------SSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKV 173
                     Y+ H  +          +  E +   +  + +VVR   P   + + +D +
Sbjct: 121 GHEAEGKTFIYNWHNREKGRLVNSLVLTEAETQAKIEGGEHYVVRFKSPQDETLLLKDII 180

Query: 174 YGEMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQY 233
            G++ I  N +D ++L KSDGMPTYHLAN++DDHLM+ITHV RGEEW+ S+  H LLY  
Sbjct: 181 RGDISIDTNVLDDKILFKSDGMPTYHLANIVDDHLMEITHVIRGEEWLPSLALHQLLYDA 240

Query: 234 FNFPIPEFIHLPLIKNPDKSKLSKRRNPTSISY-----------------YSAMGYLPEA 276
           F +  PEF HLPLI  P       +R+   + +                 Y   GY  +A
Sbjct: 241 FGWETPEFAHLPLILKPTGKGKLSKRDGDKLGFPVFPLEYTAPDGTVSRGYKEDGYFSDA 300

Query: 277 LINFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLST 336
           ++NFLA L       + E+  +++L+  FDL  ++KAGA FD  K  W N  +++++L  
Sbjct: 301 VVNFLAFLG-WNPGTEQEIFSLEELVKDFDLKRVNKAGARFDPDKTKWFNHHYMQQQLDL 359

Query: 337 T--EFLSRVSQW--MKEKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKST 392
              E    +       + + +   + L + R T +     ++ F F S      ++ K  
Sbjct: 360 DLAEQFKTIQPELADIDVNYIALVVGLVKERATFIVDFWNLSHFFFASPTSYDEKASKKA 419

Query: 393 ALCPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKY 452
               E+  DIL    E     + +K EN++  ++      +     ++ PL LA+ G+  
Sbjct: 420 --LKEDTADILNKVIELVNTTEDFKVENLQANIKGWITDSDIGFGKVMMPLRLALVGALQ 477

Query: 453 SLPLFDSIEILGRSVVYFRLRHAIALVS 480
              +FD + ++G+     R+R  +  ++
Sbjct: 478 GPDVFDIMFLIGKEETVKRIRALVKSIN 505


>gi|149369356|ref|ZP_01889208.1| glutamyl-tRNA synthetase [unidentified eubacterium SCB49]
 gi|149356783|gb|EDM45338.1| glutamyl-tRNA synthetase [unidentified eubacterium SCB49]
          Length = 509

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 168/506 (33%), Positives = 257/506 (50%), Gaps = 31/506 (6%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S KVRVR APSPTG  HIG   TALFNYL AK+ GG FILRIEDTD  R    +E+ ++
Sbjct: 7   MSQKVRVRFAPSPTGPLHIGGVRTALFNYLFAKKHGGDFILRIEDTDQTRYVEGAEDYIV 66

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           +++ W  + +DE P      GPYRQSERK++Y  Y Q+LL+   A+  F + E L+  R+
Sbjct: 67  EAMNWLNIPFDESPLKPANCGPYRQSERKDLYVKYAQDLLDSGNAYYAFDTAEALDAHRK 126

Query: 123 AQRKRNIPSRYDGHCLKL-------SSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYG 175
                     Y+ H           S  E+++   + + +V+R   P   +   +D + G
Sbjct: 127 DHEANGKTFIYNWHNRLKLDNSLVLSEAEVKQKIADGEPYVIRFKAPVGETLHLKDIIRG 186

Query: 176 EMEIPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFN 235
            + I  N +D +VL KSDGMPTYHLAN++DDHLM+I+HV RGEEW+ S+  H+LLY+ F 
Sbjct: 187 GITIDTNLLDDKVLFKSDGMPTYHLANIVDDHLMEISHVIRGEEWLPSMALHVLLYRAFG 246

Query: 236 FPIPEFIHLPLIKNPD-KSKLSKRRNPTSISY----------------YSAMGYLPEALI 278
           +  P+F HLPLI  P  K KLSKR                        Y   GYLPEA++
Sbjct: 247 WDAPQFAHLPLIMKPVGKGKLSKRDGDKMGFPVFPLQWKTADGDTFSGYREDGYLPEAVL 306

Query: 279 NFLALLFVHKSEDDDELMDMQQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLS--- 335
           N LA L       + E+ ++Q L+  FDL  +SK GA FD  K  W   ++++       
Sbjct: 307 NMLAFLG-WNPGTEQEIFNLQGLVDAFDLSRVSKGGAKFDPDKTKWFQNQYLQMMDEGVL 365

Query: 336 TTEFLSRVSQWMKEKD-RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTAL 394
             +F   ++         LT  + L + R T ++ L +   F F++      ++ K    
Sbjct: 366 VAQFEKFLADKGISTALNLTVIVPLLKERATFVADLWEQGSFFFETPTTYDEKATKKAF- 424

Query: 395 CPEEIIDILKTTQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSL 454
             E+  +I+       + ++ +    I   ++   + +E     ++ PL LA+ G+    
Sbjct: 425 -KEDTPEIIVNVLNILKDLEDFSASTISEKVKGWIKSQEMGFGKVMMPLRLALVGAMSGP 483

Query: 455 PLFDSIEILGRSVVYFRLRHAIALVS 480
            +F+   +LG+     R+ +A+  + 
Sbjct: 484 DVFEIASLLGKEETIKRVENAVKFME 509


>gi|253577156|ref|ZP_04854476.1| glutamyl-tRNA synthetase [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843400|gb|EES71428.1| glutamyl-tRNA synthetase [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 486

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 181/490 (36%), Positives = 273/490 (55%), Gaps = 18/490 (3%)

Query: 4   SSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQ 63
            ++VRVR APSPTG  HIG A TALFNYL A+  GGKFI+RIEDTD KR+    E   + 
Sbjct: 1   MAEVRVRYAPSPTGHLHIGNARTALFNYLFARHHGGKFIIRIEDTDVKRNVAGGEENQLT 60

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            LKW G++WDE  D+GG YGPYRQ+ER ++Y+P VQ+LL++ LA+RC+C+ E LE+ R  
Sbjct: 61  YLKWLGMDWDESVDVGGNYGPYRQTERLDLYRPLVQDLLDRGLAYRCYCTEEELEKEREE 120

Query: 124 QRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNA 183
           Q  R    RY G C  L+ +++     E +++ +R  VP   +  F D V G +    + 
Sbjct: 121 QMARGETPRYSGKCRHLTPEQLAAYDAEGRQYSIRFRVPEGRTFTFDDLVKGPISFESDV 180

Query: 184 VDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIH 243
               V++K DG+PTY+ A V+DDHLM ITHV RGE+ +S+ P+ +++Y  F +  P F H
Sbjct: 181 SGDFVIVKKDGIPTYNFAVVLDDHLMNITHVLRGEDHVSNTPRQLMIYDAFGWEPPVFGH 240

Query: 244 LPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
           + LI   +  KLSKR       I  Y  +GYLPEA+ NF+ALL      + +E+    +L
Sbjct: 241 MTLIVGENHKKLSKRDESVIQFIEQYDQLGYLPEAMFNFIALLGWSPEGE-EEIFSKDEL 299

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MKE 349
           I  FD + LS++ AVFD  KL  LN  +I+         S                  ++
Sbjct: 300 ISIFDANRLSRSPAVFDTNKLAHLNNHYIKN-ADPKRIASLAIPHLQRAGRLPAELSPEQ 358

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
           +      + L Q ++T  S + ++++  F+S+L +  E+  +  L   ++  +L T   +
Sbjct: 359 QAWAEALVALYQEQMTAASDIVELSELFFRSELSVDEEA--AAVLAEPQVPSVLSTFLAK 416

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E +  +  ENI  A++ V +      K +  P+ +A+TG  +   L  +I +LGR  V 
Sbjct: 417 VEGLADFSVENIGAAIKEVQKETGSKGKGLFMPIRVALTGQMHGRDLNQTIFLLGRDKVV 476

Query: 470 FRLRHAIALV 479
            RL+  IA +
Sbjct: 477 DRLKARIAAL 486


>gi|262370693|ref|ZP_06064018.1| glutamyl-tRNA synthetase [Acinetobacter johnsonii SH046]
 gi|262314493|gb|EEY95535.1| glutamyl-tRNA synthetase [Acinetobacter johnsonii SH046]
          Length = 502

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 227/482 (47%), Positives = 308/482 (63%), Gaps = 2/482 (0%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR RIAPSPTG PH+GTAY ALFN   AK+ GG+FILRIEDTD  RST ESE  ++ SL+
Sbjct: 3   VRTRIAPSPTGFPHVGTAYIALFNLCYAKQHGGEFILRIEDTDQLRSTPESEKMILDSLR 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GLNW EGPDIGG Y PYRQSER +IY+ Y  +L+EK  AF CF ++E L++MR  Q+ 
Sbjct: 63  WLGLNWSEGPDIGGPYAPYRQSERMHIYKQYALDLVEKGHAFYCFATSEELDQMRAEQQA 122

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           R    +YDG  LKLS++E++      + HV+R+ VP +G C   D + GE+EIPW  VDM
Sbjct: 123 RGETPKYDGRGLKLSAEEVQSRLAAGEPHVIRMKVPEEGICTVNDLLRGEVEIPWAQVDM 182

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           QVLLK+DG+PTYHLANV+DDHLM+ITHV RGEEW+ S PKH LLYQYF + +P   H+PL
Sbjct: 183 QVLLKTDGLPTYHLANVVDDHLMQITHVFRGEEWLPSAPKHQLLYQYFGWEMPVLGHMPL 242

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           ++NPDKSKLSKR+NPTSI+YY  +G LPEAL+N+L  +     ++ ++   + ++I HFD
Sbjct: 243 LRNPDKSKLSKRKNPTSINYYKNIGVLPEALLNYLGRMGWSMPDEREK-FTLAEMIEHFD 301

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITT 366
           +  +S  G +FD +KL+WLNG+WI+  LS  E L  +  W  ++  L       Q RI  
Sbjct: 302 IQRVSLGGPIFDVEKLNWLNGQWIKG-LSPAELLDTLLAWKADRKMLEDIAAAIQPRINL 360

Query: 367 LSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENIETALR 426
           LS     +   F     LT E F+S  L  E++   L+      E +  W  + +   L 
Sbjct: 361 LSEAVNWSAHYFNQFPSLTKEQFESKKLSEEQVRQSLQFAIWRLESMFTWNNDTVSQTLM 420

Query: 427 NVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVSSLVQNH 486
           ++A   E  L+  +   F+AI GS  S P+  ++  +G  + + RLRHA+ +V    +  
Sbjct: 421 DLANQMEIKLRDFMPAFFIAIAGSTASTPVMQTMVTIGPDLTFARLRHALEIVGGPSKKE 480

Query: 487 KK 488
            K
Sbjct: 481 AK 482


>gi|217967659|ref|YP_002353165.1| glutamyl-tRNA synthetase [Dictyoglomus turgidum DSM 6724]
 gi|217336758|gb|ACK42551.1| glutamyl-tRNA synthetase [Dictyoglomus turgidum DSM 6724]
          Length = 477

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 197/485 (40%), Positives = 283/485 (58%), Gaps = 20/485 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VRVRIAPSPTG  H+GTA+TALFN+L A+   G FILRIEDTD  RST E E  +++ LK
Sbjct: 4   VRVRIAPSPTGYLHVGTAHTALFNWLFARHNKGTFILRIEDTDLARSTKEYEENIIEGLK 63

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL WDEG        PY Q++R ++Y+ Y   LL K LA+ C+C+ E LEE R+    
Sbjct: 64  WLGLYWDEG--------PYYQTQRLDLYRKYADELLRKGLAYYCYCTPEELEERRKEALA 115

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           +  P +YD  CL LS +E  R  +E +K  +RL VP   +  F D + GE+E     +  
Sbjct: 116 QKKPPKYDRKCLYLSDEERARYEREGRKPAIRLLVPEGKTV-FNDIIRGEIEFNNEDIGD 174

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            V++KSDG+PTY+ A VIDD+ M ITHV RGE+ IS+ PK + +YQ F +  PEF HLPL
Sbjct: 175 FVIMKSDGIPTYNFAVVIDDYTMGITHVIRGEDHISNTPKQLFIYQAFGWSPPEFAHLPL 234

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           +  PD+SKLSKR   TS++ Y  MGYLP+AL+N+LALL     E++ E+  +++LI  FD
Sbjct: 235 LLGPDRSKLSKRHGVTSVTEYKNMGYLPQALVNYLALLG-WTPEENKEIYTVEELIELFD 293

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIRE---------KLSTTEFLSRVSQWMKEKDRLTQAL 357
           L  ++K   +FD  KL+W+N + IR               +      +   +++   + L
Sbjct: 294 LRRVTKNPGIFDVTKLEWINTQHIRRLSLEELADLTYPFLKEAEWFKEENFKREYYLKVL 353

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
           TL Q R+ TL+ + +  D+ F  DL    E  K     P+  +  L+  +E +  IQ + 
Sbjct: 354 TLLQERLKTLAQIREYADYFFVDDLDYDVEIAKKVCKHPDTPL-YLEKIKEVWSQIQEFT 412

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            EN+E +LRN+A+  +   K +V P+ +A+T       L++  E+LG+     RL   I 
Sbjct: 413 AENLENSLRNLAEENQIPTKNLVHPIRVALTNKTVGPGLYEIAEVLGKDKTLKRLEKFIE 472

Query: 478 LVSSL 482
            + SL
Sbjct: 473 FLRSL 477


>gi|15612672|ref|NP_240975.1| glutamyl-tRNA synthetase [Bacillus halodurans C-125]
 gi|13878782|sp|Q9KGF6|SYE_BACHD RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|10172721|dbj|BAB03828.1| glutamyl-tRNA synthetase [Bacillus halodurans C-125]
          Length = 485

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 168/489 (34%), Positives = 272/489 (55%), Gaps = 18/489 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +S+VRVR APSPTG  HIG A +ALFNYL AK  GG F+LRIEDTD  R+  +++  ++
Sbjct: 1   MASEVRVRFAPSPTGHLHIGGARSALFNYLFAKNQGGMFVLRIEDTDQARNVGQAKEKLL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            SLKW G+ WDE  D+GG YGPY   ER +IY+ +++ LL +  A+ C+ + E LE  R 
Sbjct: 61  DSLKWLGVEWDESIDVGGEYGPYSSMERLDIYKKHIEQLLNEGKAYYCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    +Y G    L+ ++      +  K VVR  VP       QD V GE+    +
Sbjct: 121 AQIARGEMPKYSGRDRDLTEEQRRAYEAKGIKPVVRFRVPEGQVIKIQDAVRGEVSFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V+ + DG+P Y+ A V+DDHLMKI+HV RGEE +S+ P+ ++LY+ F + +P F 
Sbjct: 181 GIGDFVIARKDGVPMYNFAVVVDDHLMKISHVIRGEEHLSNTPRQVMLYEAFGWDVPTFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H  LI NP++ K+SKR       +  Y  +GY+PEA++NFLALL       ++E+  +++
Sbjct: 241 HASLILNPNRQKMSKRDESIIQFVEQYKELGYMPEAIVNFLALLGWS-PVGEEEIFSLEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW------------MK 348
           L   F L  +SKA AVFD  KL W+N ++I+      + ++                  +
Sbjct: 300 LAAQFSLERVSKAPAVFDTDKLAWMNNQYIKN-ADLDDVVALALPHLQKAGKLPESLSEE 358

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           + +     ++L Q ++   + + ++T+  FK+++    E+ +   L  E++  +L    +
Sbjct: 359 QAEWAKAVISLYQEQLHYGAEIVELTELFFKTEIQYNDEAQE--VLNEEQVPGVLSGFLQ 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           E E +  W   +I+ A++   +   +  K +  P+ +A TG  +   L  +I+++G+ +V
Sbjct: 417 ELEGLDTWDAVSIKGAIKATQKATGQKGKKLFMPIRVATTGQTHGPELPSAIKLIGKEIV 476

Query: 469 YFRLRHAIA 477
             RLR  + 
Sbjct: 477 THRLRSLLN 485


>gi|219872164|ref|YP_002476539.1| glutamyl-tRNA synthetase [Haemophilus parasuis SH0165]
 gi|219692368|gb|ACL33591.1| glutamyl-tRNA synthetase [Haemophilus parasuis SH0165]
          Length = 479

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 158/484 (32%), Positives = 249/484 (51%), Gaps = 28/484 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L  K   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYTKHNNGEFVLRIEDTDLERSTPEATAAIIEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+  A+RC+CS ERL+E+R  Q 
Sbjct: 74  EWLNLAW--------EHGPYFQTKRFDRYNQVIDQMIEEGTAYRCYCSKERLDELRANQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL   S +          HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLGDHSHDPSE------PHVVRFKNPTEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +     IP + H+ 
Sbjct: 180 DLIIRRTDGAPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAEIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFTREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------AL 357
           D+H +SK+ + F+ +KL WLN  ++R      +++++  +W      +           +
Sbjct: 298 DIHSVSKSASAFNTEKLQWLNQHYMRSL--PADYVAKYLEWHMNAQGIDFSQGPALAEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++       ++         E +  L    E+      W 
Sbjct: 356 PVLSERAKTLKELASQSRYFYQEFDSYDEKAVAKNF--KAEAVAPLAKLLEKLTACDDWS 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            ENI  A+   A   +  +  +  P  LA+TGS  S  +  + +++G+     R++ AIA
Sbjct: 414 VENIHDAMNQTAAELDIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGKERTLARIQKAIA 473

Query: 478 LVSS 481
            + +
Sbjct: 474 FIEA 477


>gi|289551672|ref|YP_003472576.1| Glutamyl-tRNA synthetase/Glutamyl-tRNA(Gln) synthetase
           [Staphylococcus lugdunensis HKU09-01]
 gi|315659132|ref|ZP_07911997.1| glutamate--tRNA ligase [Staphylococcus lugdunensis M23590]
 gi|289181203|gb|ADC88448.1| Glutamyl-tRNA synthetase/Glutamyl-tRNA(Gln) synthetase
           [Staphylococcus lugdunensis HKU09-01]
 gi|315495856|gb|EFU84186.1| glutamate--tRNA ligase [Staphylococcus lugdunensis M23590]
          Length = 485

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 169/488 (34%), Positives = 271/488 (55%), Gaps = 16/488 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S++VRVR APSPTG  HIG A TALFNYL AK   G F++RIEDTDSKR+  + E +  
Sbjct: 1   MSNRVRVRYAPSPTGYLHIGNARTALFNYLFAKHYDGDFVVRIEDTDSKRNLEDGEASQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    YGPYRQSER + Y P +Q LL++  A++C+ + E LE  R 
Sbjct: 61  NNLKWLGLDWDESVDKDKGYGPYRQSERADFYNPLIQQLLDEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E ++  +R  VP   +  F D V GE+    N
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPAIRFRVPQNHTYTFNDMVKGEISFDSN 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  +DDH M+I+ V RG++ +S+ PK +++Y  F +  P F 
Sbjct: 181 NIGDWVIVKKDGVPTYNFAVAVDDHYMEISDVIRGDDHVSNTPKQLMIYDAFGWEPPRFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ LL      + DE+   + 
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFITLLGWSPEGE-DEIFSKET 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKE 349
            I  FD   LSK+ A+FD+QKL W+N ++++ K + T F   +               ++
Sbjct: 300 FIKIFDEKRLSKSPAMFDRQKLAWVNNQYMKTKDTETVFELALPHLIKANLIPEQPSEED 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
           ++   + + L Q  ++    +  +++  FK    L AE  +   +   ++ ++++    +
Sbjct: 360 REWGRKLIALYQKEMSYAGEIVPLSEMFFKDMPELGAE--EQEVINGAQVPELMQHLYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKDKVL 477

Query: 470 FRLRHAIA 477
            RL+  ++
Sbjct: 478 SRLKQYVS 485


>gi|313893250|ref|ZP_07826825.1| glutamate--tRNA ligase [Veillonella sp. oral taxon 158 str. F0412]
 gi|313442146|gb|EFR60563.1| glutamate--tRNA ligase [Veillonella sp. oral taxon 158 str. F0412]
          Length = 489

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 170/486 (34%), Positives = 254/486 (52%), Gaps = 16/486 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           +SS KV  R APSPTG  HIG A +ALFN+L+A++  G F+LRIEDTD  RST ESE  +
Sbjct: 1   MSSMKV--RFAPSPTGPFHIGGARSALFNWLLARKEEGTFVLRIEDTDLSRSTRESEENI 58

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
             SL+W G+NWDEG D+GG  GPYRQ+ER  +Y+   Q LL++  A+ C+CS E L+ +R
Sbjct: 59  KASLQWLGMNWDEGVDVGGENGPYRQTERLELYKEVTQRLLDEGHAYECYCSAEELDAVR 118

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
           + Q  R    +Y+GHC  L  +   +   E +K  +RL VP   +  F D V G +    
Sbjct: 119 QDQMDRGETPKYNGHCDHLDEETKAKYIAEGRKPTIRLRVPLNKTYTFDDMVRGRVSFES 178

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           N V   V++KSDG+P Y+ A V+DDH+M ITHV R EE +S+ P+ + +Y+   + IP F
Sbjct: 179 NGVGDFVIVKSDGIPVYNFAVVMDDHMMGITHVIRAEEHLSNTPRQMAIYEALGWDIPTF 238

Query: 242 IHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQL 301
            H+ LI   D  K+SKR   TS+  Y  +GYLPEAL+NFLALL     E ++E     +L
Sbjct: 239 GHISLILGKDYKKMSKRHGATSVEQYKQLGYLPEALVNFLALLG-WAPEGEEEFFTPDEL 297

Query: 302 IHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WMKEK 350
           I  F +  ++K  AVFD  KL+ +N  +++       F   +                + 
Sbjct: 298 IQAFSMDRVAKNPAVFDIDKLNHINFHYMKNLSDEDLFHLCLPHLKEVGLAPDSLNQADI 357

Query: 351 DRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTA--ESFKSTALCPEEIIDILKTTQE 408
           D LT   +  +  I+  + +           + L    E      L  E    +L   + 
Sbjct: 358 DWLTLLCSTFRDHISYGAQIKDHVGMFMGETVFLEEGHEEELRAVLNEETAPTVLSAFRN 417

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
               +     E ++  ++ V +      K +  P+ +A+TG  +   L + + +LG+   
Sbjct: 418 ALAELDEITPEVVKATIKAVMKETALKGKFVFMPIRVALTGQMHGPDLNNIVTLLGKEKC 477

Query: 469 YFRLRH 474
             RL +
Sbjct: 478 LHRLDN 483


>gi|148359458|ref|YP_001250665.1| glutamate tRNA synthetase catalytic subunit [Legionella pneumophila
           str. Corby]
 gi|296107503|ref|YP_003619204.1| glutamyl-tRNA synthetase [Legionella pneumophila 2300/99 Alcoy]
 gi|166226833|sp|A5ID69|SYE_LEGPC RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|148281231|gb|ABQ55319.1| glutamate tRNA synthetase catalytic subunit [Legionella pneumophila
           str. Corby]
 gi|295649405|gb|ADG25252.1| glutamyl-tRNA synthetase [Legionella pneumophila 2300/99 Alcoy]
          Length = 470

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 164/484 (33%), Positives = 258/484 (53%), Gaps = 24/484 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R APSPTG  H+G   TALF++L AK   G+FILRIEDTD +RST ES  A++  + 
Sbjct: 3   VRTRFAPSPTGFLHVGGVRTALFSWLYAKHHNGQFILRIEDTDRERSTQESVQAILDGMA 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GLN+DEG        PY Q+ER   YQ   Q LL++  A+RC CS ERLE +R AQ  
Sbjct: 63  WLGLNFDEG--------PYYQTERYARYQQVAQQLLKEGKAYRCQCSKERLEALREAQLA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYDGHC   +      L      +V+R   P+ G   F D+VYG++ +  + +D 
Sbjct: 115 AKEKPRYDGHCRNQT------LPDSGVPYVIRFRNPDAGIVSFHDEVYGDIHVDNSELDD 168

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +L++SDG PTY+ A VIDD  MKITHV RG++ I++ P+ I L++  + P+P F HLP+
Sbjct: 169 LILVRSDGHPTYNFAVVIDDWDMKITHVIRGDDHINNTPRQINLFKALDAPVPVFAHLPM 228

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D  +LSKR    S+  +  +G LP AL+N+L  L       D E+  +Q++I  FD
Sbjct: 229 ILGEDGKRLSKRHGAVSVLQFKELGVLPHALLNYLVRLGWS--HGDQEIFSVQEMITSFD 286

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLST------TEFLSRVSQWMKEKDRLTQALTLA 360
           L ++S+  + F+  KL WLN  + +                +    + +   L   + + 
Sbjct: 287 LKNVSRGVSSFNYDKLYWLNQHYQKSDSPESVANALQWHFEQAGIDLNQGPDLKDLVAVQ 346

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  +L+ + Q++ + +   +    ++ K        +++ L    E  + +  WK + 
Sbjct: 347 AERCKSLAEMCQISQYFYTDTIEYNEDAVKKH--LRPVVLEPLMVLHERLKALDEWKNDK 404

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           I+  + +V+   + +L  I +PL +A+TGS  S  +  ++ +LG++    RL  A+  + 
Sbjct: 405 IQECINDVSLQFDLNLGKIAQPLRVAVTGSGTSPSIDMTLALLGKNKSIKRLEDALEKIR 464

Query: 481 SLVQ 484
           +   
Sbjct: 465 ARAS 468


>gi|238019164|ref|ZP_04599590.1| hypothetical protein VEIDISOL_01027 [Veillonella dispar ATCC 17748]
 gi|237863863|gb|EEP65153.1| hypothetical protein VEIDISOL_01027 [Veillonella dispar ATCC 17748]
          Length = 486

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 163/481 (33%), Positives = 254/481 (52%), Gaps = 14/481 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           ++VR APSPTG  HIG A +ALFN+L+A++  G F+LRIEDTD  RST ESE  +  SL+
Sbjct: 1   MKVRFAPSPTGPFHIGGARSALFNWLLARKEKGTFVLRIEDTDLARSTRESEENIKASLQ 60

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+NWDEG D+GG  GPYRQ+ER ++Y+   Q LL++  A+ C+C+ E L+ +R+ Q  
Sbjct: 61  WLGMNWDEGIDVGGDNGPYRQTERLDLYKEVTQRLLDEGKAYECYCTPEELDAVRQEQMD 120

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           R    +Y+GHC  L  +   +   E +K  +RL VP   +  F D V G +    N V  
Sbjct: 121 RGETPKYNGHCQHLDEETKAKYIAEGRKPTIRLRVPLNKTYAFDDMVRGHVSFESNGVGD 180

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            V++KSDG+P Y+ A V+DDH+M ITHV R EE +S+ P+ + +Y+   + +P+F H+ L
Sbjct: 181 FVIVKSDGIPVYNFAVVMDDHMMGITHVIRAEEHLSNTPRQMAIYEALGWEVPKFGHISL 240

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D  K+SKR   TS+  Y  +GYLPEAL+NFLALL     E ++E     +LI  F 
Sbjct: 241 ILGKDYKKMSKRHGATSVEQYKQLGYLPEALVNFLALLG-WAPEGEEEFFTQDELIQAFS 299

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WMKEKDRLTQ 355
           +  ++K  AVFD  KL+ +N  +++       F   +                + D LT 
Sbjct: 300 MDRVAKNPAVFDIDKLNHINFHYMKNLSDEELFHLCLPHLKEVGLAPDSLNQADIDWLTL 359

Query: 356 ALTLAQSRITTLSALPQMTDFLFKSDLHLTA--ESFKSTALCPEEIIDILKTTQEEFEVI 413
             +  +  I+  + +           + L    E      L  E    ++   +     +
Sbjct: 360 LCSTFRDHISYGAQIKDHVGMFMGETVFLEEGHEEELRAVLNEETTPTVIGAFRSALAEL 419

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
                + ++  ++ V +      K +  P+ +A+TG  +   L + + +LG+     RL 
Sbjct: 420 DEITPDVVKATIKAVMKETALKGKFVFMPIRVALTGQMHGPDLNNIVTLLGKEKCLHRLD 479

Query: 474 H 474
           +
Sbjct: 480 N 480


>gi|256752499|ref|ZP_05493356.1| glutamyl-tRNA synthetase [Thermoanaerobacter ethanolicus CCSD1]
 gi|256748634|gb|EEU61681.1| glutamyl-tRNA synthetase [Thermoanaerobacter ethanolicus CCSD1]
          Length = 485

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 179/485 (36%), Positives = 272/485 (56%), Gaps = 16/485 (3%)

Query: 8   RVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKW 67
           RVR APSPTG  HIG   TALFNYL ++  G  F+LRIEDTD +RS+ E E  + + L+W
Sbjct: 5   RVRFAPSPTGAIHIGNIRTALFNYLFSRSEGATFVLRIEDTDLERSSKEFEELIFKELEW 64

Query: 68  CGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKR 127
            G+ WDEGPD  G YGPYRQSER  IY  + Q L+E+K A+RC+C+ E LEE RR   +R
Sbjct: 65  LGIEWDEGPDKPGPYGPYRQSERLEIYHKFAQKLIEEKKAYRCYCTPEELEEDRRKAVER 124

Query: 128 NIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQ 187
               RY G C  L+ ++ E   +E +K V+R  +P+     F+D + G++ I  + +   
Sbjct: 125 GDIPRYSGRCRYLTKEQEEAFIREGRKPVIRFIIPDDEVIEFEDMIKGKITIKSDTLGGD 184

Query: 188 V-LLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
           + ++KSDGMPTY+ A VIDD LMKITHV RGE+ I + PK IL+Y+   F IP+F H PL
Sbjct: 185 MVIVKSDGMPTYNFAVVIDDALMKITHVIRGEDHIYNTPKQILIYKALGFEIPKFAHAPL 244

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I  PD++KLSKR   T I  Y  +GYLPEA+ NFL+LL     ++ + +M  +++I  F+
Sbjct: 245 ILGPDRTKLSKRHGNTYIGQYRELGYLPEAMFNFLSLLSWSPEDNVE-IMSKEEIIKKFN 303

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQW-----------MKEKDRLTQ 355
              +  A  VFD +KL+W+N ++I++  S    +                     + L  
Sbjct: 304 FRRIHSANPVFDIEKLNWMNQQYIQK-SSIERIVDLAIPHLRRAGYIDEIDDMVYNWLKD 362

Query: 356 ALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQI 415
            ++L +  +  ++ + +     F  +++   E+ K   L       +L+  ++    +  
Sbjct: 363 VISLYKDGLQYVAQIAERAKMFFVEEVNYLDETIK--ILDSPNSKIVLEAVKKAIGEVDE 420

Query: 416 WKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHA 475
              E ++  L+ + +  +   K    P+ +AITG  +   L   I +LG+  V  RL+ A
Sbjct: 421 VTEEYVKDLLKKLQKETKVKGKEFFLPIRVAITGEDHGPELVKIIPLLGKDKVINRLKKA 480

Query: 476 IALVS 480
           I+L+ 
Sbjct: 481 ISLIK 485


>gi|210633398|ref|ZP_03297771.1| hypothetical protein COLSTE_01684 [Collinsella stercoris DSM 13279]
 gi|210159160|gb|EEA90131.1| hypothetical protein COLSTE_01684 [Collinsella stercoris DSM 13279]
          Length = 491

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/488 (31%), Positives = 250/488 (51%), Gaps = 17/488 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +S VRVR APSPTG+ HIG A TA++N+  A+  GG FILRI+DTD  RST E+   ++
Sbjct: 1   MTSPVRVRFAPSPTGKLHIGGARTAIYNWAFARSCGGAFILRIDDTDPARSTEENTQVIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++++W GL+WDEGP++GG +GPY Q+ER +IY+   + LL +  A+ CFC+ E+L   R 
Sbjct: 61  RAMRWLGLDWDEGPEVGGDFGPYSQTERLDIYREAAERLLAEGKAYPCFCTPEQLAADRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVV--RLTVPNQGSCVFQDKVYGEMEIP 180
           A   R  P +      +    +  R   E  +          ++G+ V  D V+G++   
Sbjct: 121 AAAARKDPFQGYQRRCRDIPADEARSRMEAGEPYTLRIKVPEDRGNVVINDAVHGKVTFD 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
              +D  V+ +SDG PTY+ A V+DD  M ITHV RG++ +S+ P+ +++Y+    P+P 
Sbjct: 181 AKELDDFVIFRSDGTPTYNFATVVDDAAMGITHVIRGDDHLSNTPRQVMVYEALGAPVPT 240

Query: 241 FIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           F H+ +I   D  KLSKR   TS+  Y   GYL +A +N+LALL     + +  ++    
Sbjct: 241 FAHISMILGADGKKLSKRHGATSVEEYRDAGYLSDAFVNYLALLGWS-LDGETTVIPRDV 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WMKE 349
           L   F L  +SK  A FD +KLDW+N  +I            +             +  +
Sbjct: 300 LASQFSLERISKNPATFDPKKLDWMNAEYINAMSDADFADQIMLPELLRAGLIDEGFEAD 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFK--SDLHLTAESFKSTALCPEEIIDILKTTQ 407
           +  +     + + R    +    +   +FK    L    +S     L  E +  +L   +
Sbjct: 360 EAWVDALAAIVRPRTKMPADAAVVATPVFKTAETLEYDEKSVAK-GLAKEGMGAVLDAAR 418

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
              E +  W  ENI+ AL  + +  +   +++   + +A+ G+  S PL +++ ++GR  
Sbjct: 419 TALEDVTDWTAENIDAALEPLPEVLDVKKRLVFGAVRVAVCGNMVSPPLGETMALIGRDD 478

Query: 468 VYFRLRHA 475
              R+  A
Sbjct: 479 CLARIDRA 486


>gi|156973569|ref|YP_001444476.1| glutamyl-tRNA synthetase [Vibrio harveyi ATCC BAA-1116]
 gi|166226865|sp|A7MY61|SYE_VIBHB RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|156525163|gb|ABU70249.1| hypothetical protein VIBHAR_01271 [Vibrio harveyi ATCC BAA-1116]
          Length = 475

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/487 (31%), Positives = 253/487 (51%), Gaps = 21/487 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ ++
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKNQGGEFVLRIEDTDLERNSQEAVDAILEGME 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL W+EG        PY Q++R + Y   V  LLE+  A++C+ S E L+E+R  Q  
Sbjct: 63  WLGLEWNEG--------PYFQTQRFDRYNEMVDKLLEEDKAYKCYASKELLDEVRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +      +++ +  V+R   P +GS VF D++ G +EI    +D 
Sbjct: 115 NKEMPRYDANHPKIKA--ANEAAKDGEPCVIRFRNPKEGSVVFDDQIRGRIEISNTQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINIYEALGAPVPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y  MGYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDMGYLPAALNNYLVRLGWS--HGDQEIFTQEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLS---TTEFLSRVSQWMKEKDR---LTQALTLA 360
           L+ +SK+ + F+  KL WLN  +I+              + Q   +      +T+ + L 
Sbjct: 291 LNAVSKSASAFNTDKLQWLNNHYIKNSDPAYVAEHLQWHLDQQKLDVTNGPAITEVIKLV 350

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  TL  L +   + ++       E+  +         + L+    + E +  W   N
Sbjct: 351 GERCNTLVELAEQIGYFYEDFAEF--EAGAAKKHLRGVAKEPLELALAKAEALTEWTTAN 408

Query: 421 IET-ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           I+   +  V +  E  +  I  PL +A+TG   S  +   +E++G+     R++ A+  +
Sbjct: 409 IKDGVIAAVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMELIGKERCVARIKMALEFI 468

Query: 480 SSLVQNH 486
           +    N 
Sbjct: 469 AEREANA 475


>gi|52842129|ref|YP_095928.1| glutamyl-tRNA synthetase [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52629240|gb|AAU27981.1| glutamate tRNA synthetase catalytic subunit [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 494

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 166/484 (34%), Positives = 258/484 (53%), Gaps = 24/484 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           VR R APSPTG  H+G   TALF++L AK   G+FILRIEDTD +RST ES  A++  + 
Sbjct: 27  VRTRFAPSPTGFLHVGGVRTALFSWLYAKHHNGQFILRIEDTDRERSTQESVQAILDGMA 86

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GLN+DEG        PY Q+ER   YQ   Q LLE+  A+RC CS ERLE +R AQ  
Sbjct: 87  WLGLNFDEG--------PYYQTERYARYQQVAQQLLEEGKAYRCQCSKERLEALREAQLA 138

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYDGHC   S      L      +V+R   P+ G   F D+VYG++ +  + +D 
Sbjct: 139 AKEKPRYDGHCRNQS------LPDSGIPYVIRFRNPDAGIVSFHDEVYGDIHVDNSELDD 192

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            +L++SDG PTY+ A VIDD  MKITHV RG++ I++ P+ I L++  + P+P F HLP+
Sbjct: 193 LILVRSDGHPTYNFAVVIDDWDMKITHVIRGDDHINNTPRQINLFKALDAPVPVFAHLPM 252

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D  +LSKR    S+  +  +G LP AL+N+L  L       D E+  +Q++I  FD
Sbjct: 253 ILGEDGKRLSKRHGAVSVLQFKELGVLPHALLNYLVRLGWS--HGDQEIFSVQEMITSFD 310

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLST------TEFLSRVSQWMKEKDRLTQALTLA 360
           L ++S+  + F+  KL WLN  + +                +    + +   L   + + 
Sbjct: 311 LKNVSRGVSSFNYDKLYWLNQHYQKSDSPESVANALQWHFEQAGIDLNQGPDLKDLVAVQ 370

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  +L+ + Q++ + +   +    ++ K        +++ L    E  + +  WK + 
Sbjct: 371 AERCKSLAEMCQISQYFYTDIIEYNEDAVKKH--LRPVVLEPLMVLHERLKALDEWKNDK 428

Query: 421 IETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           I+  + +V+   + +L  I +PL +A+TGS  S  +  ++ +LG++    RL  A+  + 
Sbjct: 429 IQECINDVSLQFDLNLGKIAQPLRVAVTGSGTSPSIDMTLALLGKNKSIKRLEDALEKIR 488

Query: 481 SLVQ 484
           +   
Sbjct: 489 ARAS 492


>gi|307246192|ref|ZP_07528273.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|307255172|ref|ZP_07536990.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|307259610|ref|ZP_07541334.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306852801|gb|EFM85025.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|306862045|gb|EFM94021.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|306866255|gb|EFM98119.1| Glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
          Length = 479

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 163/483 (33%), Positives = 247/483 (51%), Gaps = 26/483 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHFNGEFVLRIEDTDLERSTPEATAAILEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R   Y   +  ++E+ LA+RC+CS ERLE +R  Q 
Sbjct: 74  EWLNLAW--------EHGPYYQTKRFGRYNQVIDQMIEQGLAYRCYCSKERLENLRHEQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL    Q  +        HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLAHHDQPTDA------PHVVRFKNPQEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H+ 
Sbjct: 180 DLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFSREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQA-------LT 358
           D+H +SK+ + F+  KL WLN  ++R  L        ++  M ++   T         + 
Sbjct: 298 DIHSVSKSASAFNTDKLQWLNQHYMRS-LPVEHVAKYLAWHMNDQAIDTSNGPALEEIIP 356

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           +   R  TL  L   + + ++       ++         E +  L    E+   +  W  
Sbjct: 357 VLSERAKTLKELAAASRYFYQEFDGYDEKAAAKNF--KAEAVAPLAKLLEKLTALTDWSV 414

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           E I  A+   A   E  +  +  P  LA+TGS  S  +  + +++GR     R++ AI  
Sbjct: 415 EAIHDAMNATAADLEIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGRERTLARIQKAIEF 474

Query: 479 VSS 481
           + +
Sbjct: 475 IQA 477


>gi|33151555|ref|NP_872908.1| glutamyl-tRNA synthetase [Haemophilus ducreyi 35000HP]
 gi|38372512|sp|Q7VNZ3|SYE_HAEDU RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|33147775|gb|AAP95297.1| glutamyl-tRNA synthetase [Haemophilus ducreyi 35000HP]
          Length = 479

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 165/486 (33%), Positives = 252/486 (51%), Gaps = 28/486 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL+++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALYSWLYAKHFNGEFVLRIEDTDLERSTPEATAAILEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+ LA+RC+CS +RLE++R  Q 
Sbjct: 74  EWLNLTW--------EHGPYFQTKRFDRYNQVIDQMIEQGLAYRCYCSKDRLEQLRNEQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL    + I         HVVR   P QGS VF D V G +EI  + +D
Sbjct: 126 ASKEKPRYDRHCLNHQDRSINE------PHVVRFKNPQQGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H+ 
Sbjct: 180 DLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFSREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQA--------L 357
           DLH +S++ + F+ +KL WLN  ++R      E++++  +W      +  A        +
Sbjct: 298 DLHSVSRSASAFNTEKLQWLNQHYMRTL--PAEYVAKYLEWHMHDQAIDIANGPTLTELI 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++       ++   T     E    L    E+   +  W 
Sbjct: 356 PVLSERAKTLKELATASRYFYQEFDAYDEKAVAKTFKL--EAEQPLTMLWEKLTALVDWN 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            ENI  A+   A      +  +  P  LA+TGS  S  +  + +++GR     RL+ AI 
Sbjct: 414 VENIHQAMNATATELGIGMGKVGMPFRLAVTGSAQSPSMDITAKLVGRERTLARLQKAIK 473

Query: 478 LVSSLV 483
            + +  
Sbjct: 474 FIQAQS 479


>gi|258405532|ref|YP_003198274.1| glutamyl-tRNA synthetase [Desulfohalobium retbaense DSM 5692]
 gi|257797759|gb|ACV68696.1| glutamyl-tRNA synthetase [Desulfohalobium retbaense DSM 5692]
          Length = 463

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 162/475 (34%), Positives = 251/475 (52%), Gaps = 23/475 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
            +  R  PSPTG  HIG A TALFN+L+A+  GG+F+LRIEDTD+ RST E    +++ +
Sbjct: 3   PIITRFPPSPTGHLHIGGARTALFNWLLARHFGGRFVLRIEDTDAARSTDEMTEGILEGM 62

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W GL+WDEG        PY QS+R  +YQ +++ LL +  A+ C C+ + +E MR   R
Sbjct: 63  RWLGLDWDEG--------PYYQSQRTALYQEHIERLLAEDKAYYCQCTPDEVEAMREQAR 114

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
            R    +YDG C +       +        VVR   P  GS  + D V G   +  + +D
Sbjct: 115 ARGDKPKYDGRCRE-------KNLGPGPDRVVRFKAPLGGSTSYMDAVRGANAVDNSELD 167

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY LA V+DD  M ITH+ RG++ +S+ PK +LLY+   +P+P F H+P
Sbjct: 168 DFIIRRADGSPTYQLAVVVDDASMGITHILRGDDHMSNTPKQVLLYEALGYPLPVFGHVP 227

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I  PDK KLSKR    S+  Y   GYLPEA++N+LA L       D E+ ++++LI  F
Sbjct: 228 MILGPDKKKLSKRHGAASVLEYRDQGYLPEAVVNYLARLGWS--HGDQEIFEVEELIQLF 285

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ------WMKEKDRLTQALTL 359
              +L K+  VFD +KL+W+N + I+ +       +  +            + L Q + L
Sbjct: 286 TPDNLGKSACVFDTEKLEWVNAQHIKHRRPAELVQALNTALAEDNLPQGAAEYLEQIIPL 345

Query: 360 AQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
            Q R  T+  +  M       D  L  +         +E    L      FE +Q + + 
Sbjct: 346 LQPRAKTMREMADMAAVFVIDDDALPRDPGLVEKFITDEAKAHLHALASRFEALQDFSQS 405

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRH 474
            +E+ +R   +  +   K + +P+ +A+TG K S  LF+ +E+LG+  V  R + 
Sbjct: 406 GLESVVREYLEETDLKFKALAQPIRVALTGRKASPGLFEMMEVLGKDRVLRRFQA 460


>gi|288934181|ref|YP_003438240.1| glutamyl-tRNA synthetase [Klebsiella variicola At-22]
 gi|290508384|ref|ZP_06547755.1| glutamyl-tRNA synthetase [Klebsiella sp. 1_1_55]
 gi|288888910|gb|ADC57228.1| glutamyl-tRNA synthetase [Klebsiella variicola At-22]
 gi|289777778|gb|EFD85775.1| glutamyl-tRNA synthetase [Klebsiella sp. 1_1_55]
          Length = 472

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 157/488 (32%), Positives = 245/488 (50%), Gaps = 23/488 (4%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   +  +LE   A++C+CS ERLE +R  Q 
Sbjct: 62  NWLNLQWDEG--------PYYQTKRFDRYNNVIDEMLEAGTAYKCYCSKERLEALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYDG C             + +  VVR   P +GS +F D++ G +E     +D
Sbjct: 114 ANGEKPRYDGRCRH-----SHEHHADDEPCVVRFANPQEGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMAITHVIRGEDHINNTPRQINILKALNAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--HGDQEIFTREEMIEFF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLST---TEFLSRVSQWMKEKDRLTQALTLAQ- 361
            L  +SK+ + F+  KL WLN  +I    +    T     + Q   +     Q   L + 
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTLPAEYVATHLQWHIEQENIDTRNGPQLAELVKL 346

Query: 362 --SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRE 419
              R  TL  + Q   + ++      A++ K            L+  +++   I  W  E
Sbjct: 347 LGERCKTLKEIAQSCRYFYEEFAEFDADAAKKH--LRPVARQPLEVVRDKLAAIGDWTAE 404

Query: 420 NIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           N+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G+S    R+  A+A +
Sbjct: 405 NVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKSRSVERINKALAFI 464

Query: 480 SSLVQNHK 487
           +       
Sbjct: 465 AEREGQAS 472


>gi|323495405|ref|ZP_08100482.1| glutamyl-tRNA synthetase [Vibrio brasiliensis LMG 20546]
 gi|323310328|gb|EGA63515.1| glutamyl-tRNA synthetase [Vibrio brasiliensis LMG 20546]
          Length = 475

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/487 (31%), Positives = 253/487 (51%), Gaps = 21/487 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ +K
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKNQGGEFVLRIEDTDLERNSQEAVDAILEGMK 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL W+EG        PY Q++R + Y   V  LL +  A++C+ S E L+E+R  Q  
Sbjct: 63  WLGLEWNEG--------PYFQTQRFDRYNEMVDKLLAEDKAYKCYASKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +      +++    V+R   P QGS VF D++ G +EI  + +D 
Sbjct: 115 NKEMPRYDANHPKIKA--ANEAAKDGDPCVIRFRNPKQGSVVFDDQIRGRIEIRNDQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINIYEALGAPVPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y  MGYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDMGYLPAALNNYLVRLGWS--HGDQEIFSEEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLS---TTEFLSRVSQWM---KEKDRLTQALTLA 360
           L+ +SK+ + F+ +KL WLN  +I+              + +      +   +T+ + L 
Sbjct: 291 LNAVSKSASAFNTEKLQWLNNHYIKNSDPAYVAEHLQWHLDEQKLDVTDGPAITEVIKLV 350

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  TL  L +   + ++       E+  +         + L+    + E +  W   N
Sbjct: 351 GERCNTLVELAEQIRYFYEDFSEF--EAGAAKKHLRGVAKEPLELALAKAEAVTDWTTAN 408

Query: 421 IET-ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           I+   +  V +  E  +  I  PL +A+TG   S  +   +E++G+     R++ A+  +
Sbjct: 409 IKDGVITAVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMELIGKERCIARIKMALEFI 468

Query: 480 SSLVQNH 486
           +    N 
Sbjct: 469 AQREANA 475


>gi|188997238|ref|YP_001931489.1| glutamyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|229470643|sp|B2V5J1|SYE_SULSY RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|188932305|gb|ACD66935.1| glutamyl-tRNA synthetase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 478

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 167/479 (34%), Positives = 258/479 (53%), Gaps = 9/479 (1%)

Query: 8   RVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLKW 67
           RVR APSPTG  H+G A TALFNYL ++     FILRIEDTD +RS  E E  +M+ LKW
Sbjct: 3   RVRFAPSPTGYLHLGNARTALFNYLFSRHENATFILRIEDTDLERSKKEYEEMLMEDLKW 62

Query: 68  CGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRKR 127
            G+ WDEGPD GG +GPYRQSER  IY  YV  LL+   A+ C+C+ E LE+ R      
Sbjct: 63  MGIEWDEGPDAGGPHGPYRQSERLEIYMKYVDKLLKSGDAYYCYCTEEELEQEREKAIAE 122

Query: 128 NIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDMQ 187
             P RY G C  L+ +E      +  K V+R  VP++    F+D + G +EI        
Sbjct: 123 GRPYRYSGKCRNLTPEERAFYEGKSIKPVIRFKVPDKTVV-FEDIIRGHVEIDTKEFGDF 181

Query: 188 VLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPLI 247
           V+++ DGMP Y+   VIDD LM ITHV RGE+ +S+ PK I++Y+   F IP+F HLP+I
Sbjct: 182 VIVRQDGMPVYNFVVVIDDALMGITHVIRGEDHLSNTPKQIVIYEALGFAIPQFAHLPII 241

Query: 248 KNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFDL 307
              D++KLSKR    S+      G++ EA+ N+L+LL  H  E+ + ++  +++I  F +
Sbjct: 242 LGEDRTKLSKRHGAVSVRALKDDGFISEAVFNYLSLLGWHPKEEKE-ILSKEEIIKQFRI 300

Query: 308 HHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMK------EKDRLTQALTLAQ 361
             ++K+ A+FD+ KL W+NG +IRE L   +   R   + +      + +   + ++  +
Sbjct: 301 EDVNKSPAIFDRTKLRWMNGVYIREILDLDDLTKRAIPFFEGFGYKADYEFYKKVMSAIR 360

Query: 362 SRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKRENI 421
             I TL  + +     F  +   T E         E +  +++    + + +    +E+ 
Sbjct: 361 DSIETLMEIKERAKVFFVDEFPYTEEIVNEVK-SDENVYKVVEIFYNKIKNLSAITKEDF 419

Query: 422 ETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALVS 480
           +   + + +      K +  P+ +A+TG    + L   +E++G   V FRL   +    
Sbjct: 420 KNITKEIQKEYGYKGKALFHPIRIALTGEPSGVGLDLLVEVIGIERVKFRLERFLEYFG 478


>gi|59712494|ref|YP_205270.1| glutamyl-tRNA synthetase [Vibrio fischeri ES114]
 gi|67461596|sp|Q5E3L4|SYE_VIBF1 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|59480595|gb|AAW86382.1| glutamyl-tRNA synthetase [Vibrio fischeri ES114]
          Length = 474

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 156/488 (31%), Positives = 254/488 (52%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ + 
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLFAKNQGGEFVLRIEDTDLERNSQEAVDAIIEGMH 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEG        PY QS+R + Y   V  LL +  A++C+ S E L+E+R  Q  
Sbjct: 63  WMGMEWDEG--------PYYQSKRFDRYNEVVDQLLAEDKAYKCYASKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
               +RYD +  K+        ++E    V+R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMARYDANHPKI--VAANAAAKEGDACVIRFRNPKEGSVVFDDQIRGRIEISNSQLDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M IT V RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGAPTYNFVVVVDDWDMGITQVIRGEDHINNTPRQINIYEALGAPVPMFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDEGYLPNALNNYLVRLGWS--HGDQEIFSQEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM--------KEKDRLTQALT 358
           L  +SK+ + F+  KL WLN  +I+   S  E++++  QW              +T+ + 
Sbjct: 291 LSAVSKSASAFNTDKLLWLNNHYIKS--SEPEYVAKYLQWHLDQKEISLDNGPAITEVIK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L   + + ++       E+  +           L+    + E ++ W  
Sbjct: 349 LVGERCNTLIELADQSRYFYQDFEEF--EAGAAKKHLRGVAKGPLELALAKVEALEEWTT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           EN+   +  V    E  +  I  PL +A+TG   S  +   ++++G+  V  R++ A+A 
Sbjct: 407 ENLHNVIEEVCAELEIGMGKIGMPLRVAVTGGGQSPSVDAVMQLVGKERVVARIKMALAF 466

Query: 479 VSSLVQNH 486
           ++    N 
Sbjct: 467 IAEREANA 474


>gi|319399724|gb|EFV87973.1| glutamyl-tRNA synthetase [Staphylococcus epidermidis FRI909]
 gi|329729463|gb|EGG65866.1| glutamate--tRNA ligase [Staphylococcus epidermidis VCU144]
          Length = 484

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 168/485 (34%), Positives = 270/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTDSKR+  + E++  
Sbjct: 1   MSERIRVRYAPSPTGYLHIGNARTALFNYLFAKHYNGDFVVRIEDTDSKRNLEDGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    +GPYRQSER  IY P +Q LLE+  A++C+ + E LE  R 
Sbjct: 61  DNLKWLGLDWDESVDKDKGFGPYRQSERAEIYNPLIQQLLEEDKAYKCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQ  R    RY G    L+ ++ ++   E +K  +R  VP   +  F D V GE+    +
Sbjct: 121 AQIARGEMPRYGGQHAHLTEEQRQQYEAEGRKPSIRFRVPKDQTYTFNDMVKGEISFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V++K DG+PTY+ A  +DDH M+I+ V RG++ +S+ PK +++Y+ F +  P F 
Sbjct: 181 NIGDWVIVKKDGVPTYNFAVAVDDHYMQISDVIRGDDHVSNTPKQLMIYEAFGWEAPRFG 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H+ LI N ++ KLSKR       I  Y  +GYLPEAL NF+ LL      + +E+   ++
Sbjct: 241 HMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFITLLGWSPEGE-EEIFSKEE 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRV-----------SQWMKE 349
            I  FD   LSK+ A+FD+QKL W+N ++++ K + T F   +           +   K+
Sbjct: 300 FIKIFDEKRLSKSPAMFDRQKLAWVNNQYMKTKDTETVFELALPHLIKANLIPENPSEKD 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEE 409
           ++   + + L Q  ++    +  +++  F     L  +  +   L  E++ +++     +
Sbjct: 360 REWGRKLIALYQKEMSYAGEIVPLSEMFFHEMPELGKD--EQEVLQGEQVPELMNHLYGK 417

Query: 410 FEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVY 469
            E ++ ++   I+  ++ V +      K +  P+ +A+TG  +   L ++IE+LG+  V 
Sbjct: 418 LESLESFEATEIKKMIKEVQKETGIKGKQLFMPIRVAVTGQMHGPELPNTIEVLGKDKVL 477

Query: 470 FRLRH 474
            RL+ 
Sbjct: 478 SRLKK 482


>gi|317126833|ref|YP_004093115.1| glutamyl-tRNA synthetase [Bacillus cellulosilyticus DSM 2522]
 gi|315471781|gb|ADU28384.1| glutamyl-tRNA synthetase [Bacillus cellulosilyticus DSM 2522]
          Length = 485

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 165/489 (33%), Positives = 267/489 (54%), Gaps = 18/489 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            + +VRVR APSPTG  HIG A +ALFNYL A+   GKFI+RIEDTD  R+   +   ++
Sbjct: 1   MTQQVRVRFAPSPTGHLHIGGARSALFNYLFARNQNGKFIVRIEDTDQARNVDTATEKLL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            SLKW G+ WDE  DIGG + PY+  ER +IY+ Y+  L+E+  A+ C+ + E LE  R 
Sbjct: 61  NSLKWLGIEWDESVDIGGPHAPYKSMERIDIYKKYIDQLIEEGKAYYCYMTEEELEAERE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
            QR R    +Y G    L++++     QE +K VVR  VP   + V  D V G +    +
Sbjct: 121 EQRGRGETPKYSGRDRHLTAEQRNAYEQEGRKPVVRFLVPENKTIVVDDIVRGNVTFDSD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   V+ + DG+PTY+ A VIDD+LM+I+HV RGEE +S+ P+ +LLY+   +  P F 
Sbjct: 181 GIGDFVIARKDGIPTYNFAVVIDDYLMEISHVIRGEEHLSNSPRQVLLYEALGWETPRFA 240

Query: 243 HLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           H  LI N D  K+SKR       +  Y  +GYLPEA++NF+ALL      + +E++   Q
Sbjct: 241 HASLILNEDHKKMSKRDESIIQFVEQYRDLGYLPEAIVNFIALLGWSPGGE-EEILTKDQ 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
           L++ F L  + KA AVFD +KL W+N ++++E     + +      +             
Sbjct: 300 LVNQFSLERVIKAPAVFDTKKLAWMNNQYMKE-ADIDKVVEVSLPHLIHAGRLPEDLDGE 358

Query: 350 -KDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
            +    + + L Q +++  + + ++T+  FK ++    E+ +       ++ ++L+  +E
Sbjct: 359 ERQWAYELIALHQEKMSYGAEIVELTELFFKEEIDYNEEATEVLEEE--QVNEVLQAFKE 416

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           +  ++  +  E I+ A++ V +      K +  P+ +A TG  +   L  +I +LG+  V
Sbjct: 417 KLTLLNEFSAEAIKKAMKEVQKETGHKGKKLFMPIRVATTGQTHGPDLPKAIVLLGKEKV 476

Query: 469 YFRLRHAIA 477
             R+   I 
Sbjct: 477 ISRITSIIK 485


>gi|146312572|ref|YP_001177646.1| glutamyl-tRNA synthetase [Enterobacter sp. 638]
 gi|166980001|sp|A4WD15|SYE_ENT38 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|145319448|gb|ABP61595.1| glutamyl-tRNA synthetase [Enterobacter sp. 638]
          Length = 471

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 151/489 (30%), Positives = 247/489 (50%), Gaps = 27/489 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           K++ R APSPTG  H+G A TAL+++L A+  GG+F+LRIEDTD +RST E+  A+M  +
Sbjct: 2   KIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDGM 61

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
            W  L WDEG        PY Q++R + Y   + +++    A++C+CS ERL+ +R  Q 
Sbjct: 62  NWLNLEWDEG--------PYFQTKRFDRYNAVIDDMIVAGTAYKCYCSKERLDALREEQM 113

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYDG C             + +  VVR   P  GS +F D++ G +E     +D
Sbjct: 114 ANGDKPRYDGRCRH-----SHEHHADDEPCVVRFANPQDGSVIFDDQIRGPIEFSNQELD 168

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M+I+HV RGE+ I++ P+ I + +  N P+P + H+ 
Sbjct: 169 DLIIRRTDGSPTYNFCVVVDDWDMEISHVIRGEDHINNTPRQINILKALNAPVPVYAHVS 228

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEAL+N+L  L       D E+   +++I  F
Sbjct: 229 MINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWS--SGDQEIFSREEMIKLF 286

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQA--------L 357
            L  +SK+ + F+  KL WLN  +I       E+++   QW  E+  +           +
Sbjct: 287 SLGAVSKSASAFNTDKLLWLNHHYINTMQP--EYVATYLQWHIEQANIDTRTGPELAELV 344

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            L   R  TL  + +   + ++      A++ K            L+  +++   I  W 
Sbjct: 345 KLLGERCKTLKEIAESCRYFYEEFDAFDADAAKKH--LRPVARQPLEVVRDKLAAITAWT 402

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            EN+  A++  A   E  +  +  PL +A+TG+  S  L  ++  +G++    R+  A+ 
Sbjct: 403 AENVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPGLDVTVHAIGKTRSVARINKALG 462

Query: 478 LVSSLVQNH 486
            ++      
Sbjct: 463 FIAERESQQ 471


>gi|188584810|ref|YP_001916355.1| glutamate--tRNA(Gln) ligase, glutamyl-tRNA synthetase
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|229560036|sp|B2A4B3|SYE_NATTJ RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|179349497|gb|ACB83767.1| glutamate--tRNA(Gln) ligase, glutamyl-tRNA synthetase
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 488

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 189/491 (38%), Positives = 271/491 (55%), Gaps = 15/491 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            ++K R+R APSPTG+ HIG   TALFN+L ++   G+FILR+EDTD  RS  E E  + 
Sbjct: 1   MTNKARLRFAPSPTGQIHIGNIRTALFNWLYSRHIDGEFILRVEDTDMNRSVEEYEQIIF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++L W GL+WDEGP  GG +GPYRQSERK+IY  Y   LLE   A+ C+C+ E LEEMR 
Sbjct: 61  RALSWLGLDWDEGPQKGGDFGPYRQSERKDIYHKYANKLLEAGKAYYCYCTEEELEEMRE 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
           AQR R    RY G C  LSS+E   L  E +K V+R  VP   +    D V GE++   +
Sbjct: 121 AQRARGEMPRYSGKCADLSSEERAELENEGRKSVIRFKVPENQTIRVNDLVKGEVDFESD 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +   +L+KSD M +Y+ A V+DD+LM ITHV RGE+ +S+ PK +++Y+   F  PEF 
Sbjct: 181 GIGDFILIKSDDMASYNFACVVDDYLMNITHVLRGEDHLSNTPKQVMIYEALGFETPEFG 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           HL LI  PDK+KLSKR   T I  Y   GYLPEA++NFLALL      + DEL    +LI
Sbjct: 241 HLSLILGPDKAKLSKRHGDTFIGEYREKGYLPEAMVNFLALLGWSPPGE-DELFTQDELI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFL-----------SRVSQWMKEKD 351
             FD+  +SK+ AVFD  KL+W+N  +I+E  +                    Q   + +
Sbjct: 300 RLFDIGRVSKSAAVFDVDKLNWMNSHYIKEADTERLLNLSKEYLINSDLVSQEQLEHDWE 359

Query: 352 RLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFE 411
               A+ L + +I  LS LP      +  D+ L  E  +   L  + + ++L     +F 
Sbjct: 360 WFVSAVDLVKEKIDMLSELPPQLKIFYGDDVDLKGEEVE--FLEKDHVPELLSEVINQFN 417

Query: 412 VIQIW-KRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYF 470
            +  +   + I+ A+    +      K +  P+ +A++G  +   L   I +LGR     
Sbjct: 418 DLDSFEDPKAIKKAVNKAGKQVGVKGKQLFMPVRIAVSGQMHGPELDQLISLLGRERAIN 477

Query: 471 RLRHAIALVSS 481
           R+   ++ + S
Sbjct: 478 RVNSTLSQIQS 488


>gi|303228976|ref|ZP_07315786.1| glutamate--tRNA ligase [Veillonella atypica ACS-134-V-Col7a]
 gi|302516390|gb|EFL58322.1| glutamate--tRNA ligase [Veillonella atypica ACS-134-V-Col7a]
          Length = 486

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 174/481 (36%), Positives = 262/481 (54%), Gaps = 14/481 (2%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           ++VR APSPTG  HIG A +ALFN+L+A++  G F+LRIEDTD  RST ESE  +  SL+
Sbjct: 1   MKVRFAPSPTGPFHIGGARSALFNWLLARKEKGTFVLRIEDTDLSRSTRESEENIKASLQ 60

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+NWDEG D+GG  GPYRQ+ER ++Y+   Q LL++  A+ CFC+ E L+E+R+AQ +
Sbjct: 61  WLGMNWDEGIDVGGENGPYRQTERLDLYKEVTQRLLDEDKAYECFCTAEELDEVRQAQME 120

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
           R    +Y+GHC  L+ +E E+   E +K  +RL VP   +  F D V G +    N V  
Sbjct: 121 RGETPKYNGHCCHLTEEEKEKYRAEGRKPTIRLRVPLNKTYAFDDMVRGHVSFESNGVGD 180

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            V++KSDG+P Y+ A V+DDH+MKITHV R EE +S+ P+ + +Y+   + IP F H+ L
Sbjct: 181 FVIVKSDGIPVYNFAVVMDDHMMKITHVIRAEEHLSNTPRQMAIYEALGWEIPTFGHISL 240

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D  K+SKR   TS+  Y  +GYLPEAL+NFLALL     E ++E     +LI  F 
Sbjct: 241 ILGKDYKKMSKRHGATSVDQYKQLGYLPEALVNFLALLG-WAPEGEEEFFTQDELIQAFS 299

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WMKEKDRLTQ 355
           +  ++K  AVFD  KL+ +N  +++       F   +                + D LT 
Sbjct: 300 MDRVAKNPAVFDIDKLNHINFHYMKNLSDEELFRLCLPHLKEVGLAPDSLNQSDIDWLTL 359

Query: 356 ALTLAQSRITTLSALPQMTDFLFKSDLHLTA--ESFKSTALCPEEIIDILKTTQEEFEVI 413
             +  +  I+  + +           + L    E      L  E    +L   +E+   +
Sbjct: 360 LCSTFRDHISFGAQIKDHVGMFMGETVFLEEGHEEELKAVLNEESAPTVLNAFKEKLADM 419

Query: 414 QIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLR 473
                E ++ A++ V +      K +  PL +A+TG  +   L + + +LG+      L 
Sbjct: 420 DEVTPEAVKKAIKAVMKETALKGKFVFMPLRVALTGQMHGPDLNNIVTLLGKEKCLHHLD 479

Query: 474 H 474
           +
Sbjct: 480 N 480


>gi|139436891|ref|ZP_01771051.1| Hypothetical protein COLAER_00022 [Collinsella aerofaciens ATCC
           25986]
 gi|133776538|gb|EBA40358.1| Hypothetical protein COLAER_00022 [Collinsella aerofaciens ATCC
           25986]
          Length = 491

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 157/488 (32%), Positives = 257/488 (52%), Gaps = 17/488 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            +S VRVR APSPTG+ HIG A TA++N+  A+  GG FILRI+DTD  RST E+   ++
Sbjct: 1   MASDVRVRFAPSPTGKLHIGGARTAIYNWAFARANGGTFILRIDDTDPTRSTDENTQIIL 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
           ++++W GL+WDEGP++GG +GPY Q+ER ++Y+   Q L ++  A+ CFC+ E+L+  R+
Sbjct: 61  RAMRWLGLDWDEGPEVGGDFGPYAQTERLDLYKQAAQKLWDEGKAYPCFCTKEQLDADRK 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVV--RLTVPNQGSCVFQDKVYGEMEIP 180
           A ++R  P +      +    E  R   E  +  V       ++G  V  D V+GE+   
Sbjct: 121 AAQERKDPFQGYQRRCRDLDPEEARRRIEAGESYVLRIKVPEDRGDVVIHDAVHGEVTFD 180

Query: 181 WNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPE 240
              +D  V+ +SDG PTY+ A V+DD +MKITHV RG++ +S+ P+ +++Y+    P+P 
Sbjct: 181 AKELDDFVIFRSDGTPTYNFATVVDDAMMKITHVIRGDDHLSNTPRQVMVYEALGAPVPT 240

Query: 241 FIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQ 300
           F H+ +I   D  KLSKR   TS+  Y   GYL +A +N+LALL     + +  ++    
Sbjct: 241 FAHISMILGADGKKLSKRHGATSVEEYRDAGYLSDAFVNYLALLGWS-LDGETTIIPRDV 299

Query: 301 LIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKE----------- 349
           L + F L  +SK  A FD +KLDW+N  +I            +   + E           
Sbjct: 300 LANKFSLDRISKNPATFDPKKLDWVNAEYINGMSDAQFADEIMVPELHEAGLIEGNVEYG 359

Query: 350 KDRLTQALTLAQSRITTLSALPQMTDFLF--KSDLHLTAESFKSTALCPEEIIDILKTTQ 407
           +D +     + + R    +    +   +F     L    +S     L  E +  IL   +
Sbjct: 360 EDWIDALAAIVKPRTKMPADAVTVAAPIFATAETLEYDEKSVNK-GLAKEGMGAILDAAK 418

Query: 408 EEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSV 467
              E +  W   NI+ AL  + +  +   +++ + + +A+ G+  S PL +++ ++GR  
Sbjct: 419 AALEGVNEWTAANIDAALEPLPEQMDLKKRVVFQAVRVAVCGNMVSPPLGETMALVGRDD 478

Query: 468 VYFRLRHA 475
              R+  A
Sbjct: 479 CLARIDRA 486


>gi|229815477|ref|ZP_04445809.1| hypothetical protein COLINT_02525 [Collinsella intestinalis DSM
           13280]
 gi|229809010|gb|EEP44780.1| hypothetical protein COLINT_02525 [Collinsella intestinalis DSM
           13280]
          Length = 493

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 162/490 (33%), Positives = 259/490 (52%), Gaps = 17/490 (3%)

Query: 1   MISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENA 60
           M  S  VRVR APSPTG+ HIG A TA++N+  A+  GG FILRI+DTD  RST E+   
Sbjct: 1   MSMSDSVRVRFAPSPTGKLHIGGARTAIYNWAFARANGGTFILRIDDTDPTRSTDENTQI 60

Query: 61  VMQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEM 120
           ++++++W GL+WDEGP++GG +GPY Q+ER ++Y+   + LL +  A+ CFC+ E+L   
Sbjct: 61  ILRAMRWLGLDWDEGPEVGGDFGPYSQTERLDLYKQTAERLLAEGKAYPCFCTPEQLAAD 120

Query: 121 RRAQRKRNIPSR-YDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQG-SCVFQDKVYGEME 178
           R A + R  P + Y   C  L+ +E +      + +V+R+ VP    + V  D V+GE+ 
Sbjct: 121 REAAQARKDPFQGYQRRCRDLTPEEAQARIDAGEPYVLRIKVPENRGNVVINDAVHGEVT 180

Query: 179 IPWNAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPI 238
                +D  VL +SDG PTY+ A V+DD LM ITHV RG++ +S+ P+ +++Y+    P+
Sbjct: 181 FDAKELDDFVLFRSDGTPTYNFATVVDDALMGITHVIRGDDHLSNTPRQVMVYEAMGAPV 240

Query: 239 PEFIHLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDM 298
           P F H+ +I   D  KLSKR   TS+  Y   GYL +A +N+LALL     + +  ++  
Sbjct: 241 PTFAHISMILGADGKKLSKRHGATSVEEYRDAGYLSDAFVNYLALLGWS-LDGETTVIPR 299

Query: 299 QQLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WM 347
             L   F L  +SK  A FD +KLDW+N  +I      T     +             + 
Sbjct: 300 DVLASKFSLDRISKNPATFDPKKLDWMNAEYINAMDDKTFADEIMLPQLIEAGLIDEGFE 359

Query: 348 KEKDRLTQALTLAQSRITTLSALPQMTDFLFK--SDLHLTAESFKSTALCPEEIIDILKT 405
            ++  +     + + R    +    +   +FK    L    +S     L  E +  +L  
Sbjct: 360 ADEAWVDALAAIVRPRTKMPADAATVAAPVFKTAETLEYDEKSVAK-GLAKEGLGAVLDA 418

Query: 406 TQEEFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGR 465
            +   E +  W  ENI+ AL  + +  +   +++   + +A  G+  S PL +++ ++GR
Sbjct: 419 AKTALEAVTDWTPENIDAALEPLPEALDVKKRLVFGAVRVAECGNMVSPPLGETMALIGR 478

Query: 466 SVVYFRLRHA 475
                R+  A
Sbjct: 479 DDCLARIDRA 488


>gi|197335110|ref|YP_002156714.1| glutamyl-tRNA synthetase [Vibrio fischeri MJ11]
 gi|238690304|sp|B5FGU2|SYE_VIBFM RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|197316600|gb|ACH66047.1| glutamyl-tRNA synthetase [Vibrio fischeri MJ11]
          Length = 474

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 156/488 (31%), Positives = 255/488 (52%), Gaps = 24/488 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ + 
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLFAKNQGGEFVLRIEDTDLERNSQEAVDAIIEGMH 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W G+ WDEG        PY QS+R + Y   V  LL +  A++C+ S E L+E+R  Q  
Sbjct: 63  WMGMEWDEG--------PYYQSKRFDRYNEVVDQLLAEDKAYKCYASKELLDEIRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
               +RYD +  K+        ++E    V+R   P +GS VF D++ G +EI  + +D 
Sbjct: 115 NKEMARYDANHPKI--VAANAAAKEGDACVIRFRNPKEGSVVFDDQIRGRIEISNSQLDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M IT V RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGAPTYNFVVVVDDWDMGITQVIRGEDHINNTPRQINIYEALGAPVPMFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y   GYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDEGYLPNALNNYLVRLGWS--HGDQEIFSQEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM--------KEKDRLTQALT 358
           L  +SK+ + F+  KL WLN  +I+   S  E++++  QW              +T+ + 
Sbjct: 291 LSAVSKSASAFNTDKLLWLNNHYIKS--SEPEYVAKYLQWHLDQKEISLDNGPAITEVIK 348

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKR 418
           L   R  TL  L + + + ++       E+  +           L+    + E ++ W  
Sbjct: 349 LVGERCNTLIELAEQSRYFYQDFEEF--EAGAAKKHLRGVAKGPLELALAKVEALEEWTT 406

Query: 419 ENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIAL 478
           EN+   +  V    E  +  I  PL +A+TG   S  +   ++++G+  V  R++ A+A 
Sbjct: 407 ENLHNVIEEVCAELEIGMGKIGMPLRVAVTGGGQSPSVDAVMQLVGKERVVARIKMALAF 466

Query: 479 VSSLVQNH 486
           ++    N 
Sbjct: 467 IAEREANA 474


>gi|196036411|ref|ZP_03103808.1| glutamyl-tRNA synthetase [Bacillus cereus W]
 gi|218901290|ref|YP_002449124.1| glutamyl-tRNA synthetase [Bacillus cereus AH820]
 gi|228925341|ref|ZP_04088437.1| Glutamyl-tRNA synthetase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228943894|ref|ZP_04106279.1| Glutamyl-tRNA synthetase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|195991041|gb|EDX55012.1| glutamyl-tRNA synthetase [Bacillus cereus W]
 gi|218537465|gb|ACK89863.1| glutamyl-tRNA synthetase [Bacillus cereus AH820]
 gi|228815727|gb|EEM61963.1| Glutamyl-tRNA synthetase [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228834263|gb|EEM79804.1| Glutamyl-tRNA synthetase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 491

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 173/488 (35%), Positives = 275/488 (56%), Gaps = 16/488 (3%)

Query: 2   ISSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAV 61
           I   +VRVR APSPTG  HIG A TALFNYL A+   GKFI+RIEDTD KR+    E + 
Sbjct: 6   IMEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIEDTDVKRNVAGGEESQ 65

Query: 62  MQSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMR 121
           ++ LKW G++WDEG D+GG +GPYRQ+ER +IY+   ++LLE+ LA++C+ + E LE  R
Sbjct: 66  LKYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGLAYKCYMTEEELEAER 125

Query: 122 RAQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPW 181
             Q  R    RY G+   L+  +++    E +   +R  VP      F+D V  E+    
Sbjct: 126 EGQIARGETPRYAGNHRDLTEAQVKEFEAEGRIPSIRFRVPADRDYTFKDIVKDEVAFHS 185

Query: 182 NAVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEF 241
           N     V++K DG+PTY+ A  +DDHLM+ITHV RG++ IS+ PK +++Y+ F + IP+F
Sbjct: 186 NDFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNTPKQMMIYEAFGWDIPQF 245

Query: 242 IHLPLIKNPDKSKLSKRRNP--TSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQ 299
            H+ LI N  + KLSKR       I  Y  +GYLPEA+ NF+ALL       ++E+   +
Sbjct: 246 GHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFIALLGWS-PVGEEEIFSQE 304

Query: 300 QLIHHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQ-----------WMK 348
           + I  FD   LSK+ A+FD QKL W+N ++++++   T     +               +
Sbjct: 305 EFIKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVELSLPHLVKAGRIGETLSEQ 364

Query: 349 EKDRLTQALTLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQE 408
           E+  +   + L   +++  + + ++++  FK  +    E  +   L  E++ ++L+    
Sbjct: 365 EQAWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQE--VLKGEQVPEVLRAFAG 422

Query: 409 EFEVIQIWKRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVV 468
           + E ++  +   I+TA++ V +      K +  P+ +A TG  +   L ++I +LG+  V
Sbjct: 423 QVEALEAMEPAAIKTAIKAVQKETGHKGKNLFMPIRVATTGQTHGPELPNAIALLGKEKV 482

Query: 469 YFRLRHAI 476
             RL+  I
Sbjct: 483 LNRLQKVI 490


>gi|148379082|ref|YP_001253623.1| glutamyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502]
 gi|153932830|ref|YP_001383466.1| glutamyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397]
 gi|153937156|ref|YP_001387013.1| glutamyl-tRNA synthetase [Clostridium botulinum A str. Hall]
 gi|153938314|ref|YP_001390449.1| glutamyl-tRNA synthetase [Clostridium botulinum F str. Langeland]
 gi|168178516|ref|ZP_02613180.1| glutamyl-tRNA synthetase [Clostridium botulinum NCTC 2916]
 gi|226948369|ref|YP_002803460.1| glutamate--tRNA ligase [Clostridium botulinum A2 str. Kyoto]
 gi|187470983|sp|A7FSY9|SYE_CLOB1 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|187470984|sp|A5I0T6|SYE_CLOBH RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|187470985|sp|A7GCD9|SYE_CLOBL RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|148288566|emb|CAL82647.1| glutamyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3502]
 gi|152928874|gb|ABS34374.1| glutamyl-tRNA synthetase [Clostridium botulinum A str. ATCC 19397]
 gi|152933070|gb|ABS38569.1| glutamate--tRNA ligase [Clostridium botulinum A str. Hall]
 gi|152934210|gb|ABS39708.1| glutamate--tRNA ligase [Clostridium botulinum F str. Langeland]
 gi|182671212|gb|EDT83186.1| glutamyl-tRNA synthetase [Clostridium botulinum NCTC 2916]
 gi|226841301|gb|ACO83967.1| glutamate--tRNA ligase [Clostridium botulinum A2 str. Kyoto]
 gi|295318533|gb|ADF98910.1| glutamate--tRNA ligase [Clostridium botulinum F str. 230613]
          Length = 485

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 185/487 (37%), Positives = 277/487 (56%), Gaps = 10/487 (2%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            ++KVR R APSPTG  H+G   TAL+ YLIAK   G FILRIEDTD +R    + + + 
Sbjct: 1   MTNKVRTRFAPSPTGYMHVGNLRTALYAYLIAKHDNGDFILRIEDTDQERLVEGALDVIY 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LK  GL+ DEGPDIGG  GPY QSER+NIY  Y + L+EK  A+ CFCS ERL+ +R 
Sbjct: 61  NTLKITGLSHDEGPDIGGPVGPYVQSERRNIYIEYAEKLIEKGEAYYCFCSKERLDMLRA 120

Query: 123 AQRKRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWN 182
                  P RYD HC+ LS +EI++   E   +V+R   P  GS  F D++YG++ +  +
Sbjct: 121 NSEALKRPFRYDKHCIDLSKEEIDKKIAEGVPYVIRQKNPTTGSTSFHDEIYGDISVDNS 180

Query: 183 AVDMQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFI 242
            +D  +L+KSDG+PTY+ ANV+DDHLM ITHV RG E++SS PK+  LY+ F + +P ++
Sbjct: 181 ELDDMILIKSDGLPTYNFANVVDDHLMGITHVVRGSEYLSSSPKYNRLYEAFGWDVPIYV 240

Query: 243 HLPLIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLI 302
           H P I   +  KLSKR    S     A GYL EA++N++ALL       + E+  M++LI
Sbjct: 241 HCPPIMKDEHHKLSKRNGDASFEDLMAKGYLKEAILNYIALLG-WNPGGEKEVFSMEELI 299

Query: 303 HHFDLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWM----KEKDRLTQALT 358
             F+  +++KA AVFD +KL W+NG +IR  LS  +F      +            +   
Sbjct: 300 EAFNYRNINKAPAVFDTKKLKWMNGEYIRA-LSLDKFHEMALPYYEEALTRDLDTKKISE 358

Query: 359 LAQSRITTLSALPQMTDFLFKSDLHLTAES--FKSTALCPEEIIDILKTTQEEFEVIQIW 416
           L  +R+  L+ +P+     F + L  + E    K      E  +  L+    + E ++ W
Sbjct: 359 LLHTRVEVLNEIPEQ-LDFFNNLLEYSPEMYIHKKMKTTYENSLKSLEEVLPKLEALENW 417

Query: 417 KRENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSL-PLFDSIEILGRSVVYFRLRHA 475
             ENI+    N+ +  E    +++ P+  A++G +++    F+  +ILG+     R++  
Sbjct: 418 TFENIKEVCMNLVKELEVKNGVVLWPIRTAVSGKQFTPGGAFEIADILGKEETLERIKIG 477

Query: 476 IALVSSL 482
           I  + +L
Sbjct: 478 IDKLKAL 484


>gi|269961585|ref|ZP_06175947.1| Glutamyl-tRNA synthetase [Vibrio harveyi 1DA3]
 gi|269833626|gb|EEZ87723.1| Glutamyl-tRNA synthetase [Vibrio harveyi 1DA3]
          Length = 475

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/487 (31%), Positives = 252/487 (51%), Gaps = 21/487 (4%)

Query: 7   VRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSLK 66
           V+ R APSPTG  H+G A TAL+++L AK  GG+F+LRIEDTD +R++ E+ +A+++ ++
Sbjct: 3   VKTRFAPSPTGYLHVGGARTALYSWLYAKNQGGEFVLRIEDTDLERNSQEAVDAILEGME 62

Query: 67  WCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQRK 126
           W GL W+EG        PY Q++R + Y   V  LLE+  A++C+ S E L+E+R  Q  
Sbjct: 63  WLGLEWNEG--------PYFQTQRFDRYNEMVDKLLEEDKAYKCYASKELLDEVRAEQEA 114

Query: 127 RNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVDM 186
                RYD +  K+ +      +++    V+R   P +GS VF D++ G +EI    +D 
Sbjct: 115 NKEMPRYDANHPKIKA--ANEAAKDGDPCVIRFRNPKEGSVVFDDQIRGRIEISNTQMDD 172

Query: 187 QVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLPL 246
            ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I +Y+    P+P F H  +
Sbjct: 173 LIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINIYEALGAPVPTFAHCAM 232

Query: 247 IKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHFD 306
           I   D +KLSKR    S+  Y  MGYLP AL N+L  L       D E+   +++I+ F 
Sbjct: 233 ILGDDGAKLSKRHGAVSVMQYRDMGYLPAALNNYLVRLGWS--HGDQEIFTQEEMINLFS 290

Query: 307 LHHLSKAGAVFDKQKLDWLNGRWIREKLS---TTEFLSRVSQWMKEKDR---LTQALTLA 360
           L+ +SK+ + F+  KL WLN  +I+              + Q   +      +T+ + L 
Sbjct: 291 LNAVSKSASAFNTDKLQWLNNHYIKNSDPAYVAQHLQWHLDQQKLDVTNGPAITEVIKLV 350

Query: 361 QSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWKREN 420
             R  TL  L +   + ++       E+  +         + L+    + E +  W   N
Sbjct: 351 GERCNTLVELAEQIRYFYEDFAEF--EAGAAKKHLRGVAKEPLELALAKAEALTEWTTAN 408

Query: 421 IET-ALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIALV 479
           I+   +  V +  E  +  I  PL +A+TG   S  +   +E++G+     R++ A+  +
Sbjct: 409 IKDGVIAAVCEELEIGMGKIGMPLRVAVTGGGQSPSVDAVMELIGKERCVARIKMALEFI 468

Query: 480 SSLVQNH 486
           +    N 
Sbjct: 469 AEREANA 475


>gi|126208741|ref|YP_001053966.1| glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae L20]
 gi|166200155|sp|A3N1S5|SYE_ACTP2 RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|126097533|gb|ABN74361.1| glutamyl-tRNA synthetase [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
          Length = 479

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 162/484 (33%), Positives = 246/484 (50%), Gaps = 28/484 (5%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVMQSL 65
           KVR R APSPTG  H+G A TAL ++L AK   G+F+LRIEDTD +RST E+  A+++ +
Sbjct: 14  KVRTRFAPSPTGYLHVGGARTALSSWLYAKHFNGEFVLRIEDTDLERSTPEATAAILEGM 73

Query: 66  KWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRAQR 125
           +W  L W         +GPY Q++R + Y   +  ++E+ LA+RC+CS ERLE +R  Q 
Sbjct: 74  EWLNLAW--------EHGPYYQTKRFDRYNQVIDQMIEQGLAYRCYCSKERLENLRHEQE 125

Query: 126 KRNIPSRYDGHCLKLSSQEIERLSQEQKKHVVRLTVPNQGSCVFQDKVYGEMEIPWNAVD 185
                 RYD HCL    Q  +        HVVR   P +GS VF D V G +EI  + +D
Sbjct: 126 ANKEKPRYDRHCLAHHDQPTDA------PHVVRFKNPQEGSVVFDDAVRGRIEISNSELD 179

Query: 186 MQVLLKSDGMPTYHLANVIDDHLMKITHVARGEEWISSVPKHILLYQYFNFPIPEFIHLP 245
             ++ ++DG PTY+   V+DD  M ITHV RGE+ I++ P+ I + +    PIP + H+ 
Sbjct: 180 DLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAHVS 239

Query: 246 LIKNPDKSKLSKRRNPTSISYYSAMGYLPEALINFLALLFVHKSEDDDELMDMQQLIHHF 305
           +I   D  KLSKR    S+  Y   GYLPEALIN+L  L       D E+   +++I  F
Sbjct: 240 MINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG--HGDQEIFSREEMIELF 297

Query: 306 DLHHLSKAGAVFDKQKLDWLNGRWIREKLSTTEFLSRVSQWMKEKDRLTQ--------AL 357
           D+H +SK+ + F+  KL WLN  ++R      E +++   W      +           +
Sbjct: 298 DIHSVSKSASAFNTDKLQWLNQHYMRSL--PAEHVAKYLAWHMNDQAIDTSSGPALEEII 355

Query: 358 TLAQSRITTLSALPQMTDFLFKSDLHLTAESFKSTALCPEEIIDILKTTQEEFEVIQIWK 417
            +   R  TL  L   + + ++       ++         E +  L    E+   +  W 
Sbjct: 356 PVLSERAKTLKELAAASRYFYQEFDGYDEKAAAKNF--KAEAVAPLAKLLEKLTALTDWS 413

Query: 418 RENIETALRNVAQHREKSLKIIVKPLFLAITGSKYSLPLFDSIEILGRSVVYFRLRHAIA 477
            E I  A+   A   E  +  +  P  LA+TGS  S  +  + +++GR     R++ AI 
Sbjct: 414 VEAIHDAMNATAADLEIGMGKVGMPFRLAVTGSGQSPSMDITAKLVGRERTLARIQKAIE 473

Query: 478 LVSS 481
            + +
Sbjct: 474 FIQA 477


>gi|27467208|ref|NP_763845.1| glutamyl-tRNA synthetase [Staphylococcus epidermidis ATCC 12228]
 gi|57866105|ref|YP_187764.1| glutamyl-tRNA synthetase [Staphylococcus epidermidis RP62A]
 gi|242241859|ref|ZP_04796304.1| glutamyl-tRNA synthetase [Staphylococcus epidermidis W23144]
 gi|251809944|ref|ZP_04824417.1| glutamyl-tRNA synthetase [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875022|ref|ZP_06283897.1| glutamate--tRNA ligase [Staphylococcus epidermidis SK135]
 gi|293367903|ref|ZP_06614541.1| glutamate-tRNA ligase [Staphylococcus epidermidis M23864:W2(grey)]
 gi|30173135|sp|Q8CTU3|SYE_STAES RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|67461623|sp|Q5HRM5|SYE_STAEQ RecName: Full=Glutamyl-tRNA synthetase; AltName:
           Full=Glutamate--tRNA ligase; Short=GluRS
 gi|27314750|gb|AAO03887.1|AE016744_290 glutamyl-tRNA synthetase [Staphylococcus epidermidis ATCC 12228]
 gi|57636763|gb|AAW53551.1| glutamyl-tRNA synthetase [Staphylococcus epidermidis RP62A]
 gi|242234637|gb|EES36949.1| glutamyl-tRNA synthetase [Staphylococcus epidermidis W23144]
 gi|251806487|gb|EES59144.1| glutamyl-tRNA synthetase [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296350|gb|EFA88869.1| glutamate--tRNA ligase [Staphylococcus epidermidis SK135]
 gi|291317932|gb|EFE58340.1| glutamate-tRNA ligase [Staphylococcus epidermidis M23864:W2(grey)]
 gi|329734687|gb|EGG70994.1| glutamate--tRNA ligase [Staphylococcus epidermidis VCU028]
 gi|329738045|gb|EGG74266.1| glutamate--tRNA ligase [Staphylococcus epidermidis VCU045]
          Length = 484

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 168/485 (34%), Positives = 271/485 (55%), Gaps = 16/485 (3%)

Query: 3   SSSKVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTDSKRSTLESENAVM 62
            S ++RVR APSPTG  HIG A TALFNYL AK   G F++RIEDTDSKR+  + E++  
Sbjct: 1   MSERIRVRYAPSPTGYLHIGNARTALFNYLFAKHYNGDFVVRIEDTDSKRNLEDGESSQF 60

Query: 63  QSLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRR 122
            +LKW GL+WDE  D    +GPYRQSER  IY P +Q LLE+  A++C+ + E LE  R 
Sbjct: 61  DNLKWL