RPSBLAST alignment for GI: 255764513 and conserved domain: PRK04156

>gnl|CDD|179754 PRK04156, gltX, glutamyl-tRNA synthetase; Provisional. Length = 567
 Score =  106 bits (267), Expect = 1e-23
 Identities = 50/120 (41%), Positives = 68/120 (56%), Gaps = 11/120 (9%)

Query: 6   KVRVRIAPSPTGEPHIGTAYTALFNYLIAKRTGGKFILRIEDTD--SKRSTLESENAVMQ 63
           KV +R AP+P+G  H+G A  A+ N   AK  GGKFILR EDTD  +KR   E+ + +++
Sbjct: 101 KVVMRFAPNPSGPLHLGHARAAILNDEYAKMYGGKFILRFEDTDPRTKRPDPEAYDMILE 160

Query: 64  SLKWCGLNWDEGPDIGGAYGPYRQSERKNIYQPYVQNLLEKKLAFRCFCSTERLEEMRRA 123
            LKW G+ WDE            QS+R  IY  Y + L+E   A+ C C  E  +E+R A
Sbjct: 161 DLKWLGVKWDE---------VVIQSDRLEIYYEYARKLIEMGGAYVCTCDPEEFKELRDA 211